CLUSTAL format seed alignment for MF_01699

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUTA_AGRFC      ------------------------------MEVGVFIPIGNNGWLLSENAPQYKPSFDLN
RUTA_VARPS      ------------------------------MNVGIFIPIGNNGWLLSENAPQYKPSFELN
RUTA_CAUVC      ------------------------------MQVGVFIPIGNNGWLISETSPQYMPSFELN
RUTA_CAUVN      ------------------------------MQVGVFIPIGNNGWLISETSPQYMPSFELN
RUTA_CAUST      ------------------------------MQVGVFIPIGNNGWLISETSPQYMPSFELN
RUTA_CAUSK      ------------------------------MEIGVFIPIGNNGWLISEAAPQYMPSFALN
RUTA_HALO1      ------------------------------MEVGVFIPIGNNGWLISENSPQYQPSFDLN
RUTA_METC4      ------------------MTQAQDHAKDHAMNIGVFIPIGNNGWLLSENAPQYMPSFELN
RUTA_METED      ------------------------------MNIGVFIPIGNNGWLLSENAPQYMPSFELN
RUTA_METEP      ----------------------MTQAKDHAMNIGVFIPIGNNGWLLSENAPQYMPSFDLN
RUTA_METEA      ------------------------------MNIGVFIPIGNNGWLLSENAPQYMPSFELN
RUTA_METPB      ------------------MTQANNHANNHAMNIGVFIPIGNNGWLLSENAPQYMPSFELN
RUTA_AGRRK      ------------------------------MEIGVFIPIGNNGWLLSENAPQYKPSFELN
RUTA_METRJ      -------------MMRSHADDSAEARPAPAMSVGVFIPIGNNGWLLSENAPQYRPSFALN
RUTA_ACIAD      ------------------------------MKIGVFCPIGNNGWLLSENAPQYMPSFELN
RUTA_ECOBW      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOD1      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECODH      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOLI      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO27      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOSM      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO45      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOK1      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO81      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOKI      MQTSHYAAEKDMQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOUT      MQTSHYAAEKDMQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOL6      MQTSHYAAEKDMQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOS5      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOL5      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO8A      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOSE      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOLU      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO55      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO26      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO1A      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO10      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO57      -----------MQNAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO5T      -----------MQNAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOLC      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOBD      -----------MQDAVPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO5E      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOCB      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO7I      MQTSHYAAEKDMQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECOHS      MQTSHYAAEKDMQDAVPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO24      MQTSHYAAEKDMQDAVPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_SHIDS      -----------MQDAVPRLTFTLRDEERLMVKIGVFVPIGNNGWLISPHAPQYMPTFELN
RUTA_ECOBR      -----------MQDAVPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ECO44      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_SHIF2      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_SHIFL      -----------MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_SHIF8      -----------------------------MMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_ENT38      ------------------------------MKIGVFVPIGNNGWLISTTAPQYMPTFELN
RUTA_ENTCC      ------------------------------MKIGVFVPIGNNGWLISTTAPQYMPTFELN
RUTA_CROTZ      --------------MQRHATVLLPAKERFVMKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_CROS8      -----------------------------------------------------MPTFELN
RUTA_KLEP3      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_KLEVT      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_KLEP7      ------------------------------MKIGVFVPIGNNGWLISTHAPQYMPTFELN
RUTA_PANAM      ------------------------------MKIGVFIPIGNNGWLISETAPQYKPTFELN
RUTA_SERP5      ------------------------------MKIGVFIPIGNNGWLISSNAPQYQPTFELN
RUTA_YERE8      ------------------------------MKIGVFIPIGNNGWLISSNAPQYMPSFELN
RUTA_PSE14      ------------------------------MDIGIFIPIGNNGWLISSNAPQYMPTFELN
RUTA_PSEU2      ------------------------------MDIGIFIPIGNNGWLISSNAPQYMPTFELN
RUTA_PSEU5      ------------------------------MDVGVFIPIGNNGWLISENAPQYMPTFELN
RUTA_BRASB      ------------------------------MDLGVFIPIGNNGWLISTASPQYKPTFELN
RUTA_AGRVS      -----------------------------MTKIGVFIPIGSRGWLISTTSPATMPSFELN
                                                                      *:* **

RUTA_AGRFC      KAITLKAEQYGFDFALSMIKLRGFGGKTEFWDYNLESFTLMAGLAAVTSKIKLFGTAATL
RUTA_VARPS      KEITLTAERYGVDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTTKIKLFATAASL
RUTA_CAUVC      KEITQKAEKYGFDFALSMIKLRGFGGKTEFWEHNLESFTLMAGLAAVTSKIKIFATVATL
RUTA_CAUVN      KEITQKAEKYGFDFALSMIKLRGFGGKTEFWEHNLESFTLMAGLAAVTSKIKIFATVATL
RUTA_CAUST      KEITQKAETYGFDFALSMIKLRGFGGKTQFWEHNLESFTLMAGLAAVTSKIKIFATVATL
RUTA_CAUSK      KEIVQKAEKYGFDFALSMIKLRGFGGKTQFWEHNLESFTLMAGLAAVTDRIKIFATAATL
RUTA_HALO1      KEIAQRAEAHGLDFLLSMIKLRGFGGKTEFWEYNLESFTLMAGLASVTERIKLFATCATL
RUTA_METC4      KQITLKAEQHGLDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKLYATAPTL
RUTA_METED      KQITLKAEQHGLDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKLYATAPTL
RUTA_METEP      KQITLKAEQHGLDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKLYATAPTL
RUTA_METEA      KQITLKAEQHGLDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKLYATAPTL
RUTA_METPB      KQITLKAEQYGLDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKLYATAPTL
RUTA_AGRRK      KEITLKAEKYGFDFVLSMIKLRGFGGKTEFWDHNLESFTLMSGLAAVTTRIKLFATAATL
RUTA_METRJ      KAITLKAEGYGLDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTTRIRLFATAATL
RUTA_ACIAD      KKIVQRAEHYGFDFALSMIKLRGFGGKTEFWDHNLETFTLMAGLAAVTSKIKIYATAATL
RUTA_ECOBW      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOD1      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECODH      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOLI      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO27      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOSM      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO45      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOK1      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO81      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOKI      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOUT      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOL6      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOS5      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOL5      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO8A      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOSE      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOLU      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO55      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO26      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO1A      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO10      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO57      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO5T      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOLC      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOBD      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO5E      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOCB      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO7I      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOHS      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO24      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_SHIDS      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECOBR      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ECO44      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_SHIF2      KAIAQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_SHIFL      KAIAQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_SHIF8      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ENT38      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_ENTCC      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_CROTZ      KAIVQKAEQQQFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_CROS8      KAIVQKAEQQQFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATL
RUTA_KLEP3      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSKIQIYATAATL
RUTA_KLEVT      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSKIQIYATAATL
RUTA_KLEP7      KAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSKIQIYATAATL
RUTA_PANAM      KTIVQKAEHYHFDFALSMIKLRGFGGKTEFWEHNMESFTLMAGLAAVTSRIQLYATAATL
RUTA_SERP5      KTIVQKAEHYNFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKIYATAATL
RUTA_YERE8      KAIVQQAEHYQFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIKIYATAATL
RUTA_PSE14      KQIVQTAEGYGFDFALSMIKLRGFGGKTEFWEHNLESFTLMAGLAAVTSKIQLFATVATL
RUTA_PSEU2      KQIVQKAEGYGFDFALSMIKLRGFGGKTQFWEHNLESFTLMAGLAAVTSRIQLFATVATL
RUTA_PSEU5      KAIVQKAEGYGFDFALSMIKLRGFGGKTEFWEHNLESFTLMAGLAAVTSKIQLFATAATL
RUTA_BRASB      KQIVQRAEHYGFEFALSMIKLRGFGGKSEFWDYNLESFTLMAGLAAVTSRIKLFASTAVL
RUTA_AGRVS      KAVVQQAEHYGLDFALSMIKLRGYNGPSEYWVHNLESFTLMAGLAAVTKKIQLFASVAML
                * :.  **   .:* ********:.* :::* :*:*:****:***:** :*:::.: . *

RUTA_AGRFC      VMPPAIVARMATTIDSISGGRFGINLITGWQRPEYSQMGLWPGDDYFGDRYEYLGEYTSV
RUTA_VARPS      VMPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYSQMGMWPGDQFFGTRYQYLSEYIQV
RUTA_CAUVC      TIPPAIVARMASTIDSIAPGRFGVNLVTGWQKAEYSQMGLWPGEAHYTDRYNYLAEYTTV
RUTA_CAUVN      TIPPAIVARMASTIDSIAPGRFGVNLVTGWQKAEYSQMGLWPGEAHYTDRYNYLAEYTTV
RUTA_CAUST      TIPPAIVARMASTIDSIAPGRFGVNLVTGWQKAEYSQMGLWPGEAHYTDRYNYLAEYTTV
RUTA_CAUSK      TLPPAIVARMASTIDSIAPGRFGINLVTGWQKAEYDQMGLWPGEQHYTDRYNYLAEYATV
RUTA_HALO1      LIPPAYAARMCNTIDSISHGRFGLNLITGWQRPEYSQMGMWPGDEHFARRYDMLSEYAHI
RUTA_METC4      CLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYAQMGLWPGDEYFGRRYEYLSEYAQV
RUTA_METED      CLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYAQMGLWPGDEYFGRRYEYLSEYAQV
RUTA_METEP      CLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYAQMGLWPGDEYFGRRYEYLSEYAQV
RUTA_METEA      CLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYAQMGLWPGDEYFGRRYEYLSEYAQV
RUTA_METPB      CLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYSQMGLWPGDEYFGRRYAYLSEYAQV
RUTA_AGRRK      VMPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYSQMGMWPGDEYFAKRYDYLGEYATV
RUTA_METRJ      CLPPAIVARMAATIDSISDGRFGLNLVTGWQKPEYDQMGLWPGDAHFANRYDYLAEYAQI
RUTA_ACIAD      VMPPAIVARMASTIDSISNGRFGLNVVTGWQAPEYSQMGMWPGDEYFAKRYEYLSEYVQI
RUTA_ECOBW      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOD1      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECODH      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOLI      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO27      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOSM      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO45      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOK1      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO81      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOKI      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOUT      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOL6      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOS5      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOL5      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO8A      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOSE      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOLU      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO55      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO26      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO1A      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO10      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO57      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO5T      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOLC      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOBD      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO5E      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOCB      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO7I      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOHS      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO24      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_SHIDS      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECOBR      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ECO44      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_SHIF2      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_SHIFL      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_SHIF8      TLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQV
RUTA_ENT38      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYDQMGIWPGDEYFSRRYDYLTEYVQV
RUTA_ENTCC      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYDQMGLWPGDEYFSRRYEYLTEYVQV
RUTA_CROTZ      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYEQMGLWPGDEYFSRRYDYLTEYVHV
RUTA_CROS8      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYEQMGLWPGDDYFSRRYDYLTEYVHV
RUTA_KLEP3      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYDQMGMWPGDDYFASRYDYLTEYVQV
RUTA_KLEVT      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYDQMGMWPGDDYFASRYDYLTEYVQV
RUTA_KLEP7      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYDQMGMWPGDDYFASRYDYLTEYVQV
RUTA_PANAM      VMPPAIVARMAATIDSISNGRFGVNVVTGWQKPEYEQMGMWPGDDYFTRRYDYLTEYVSV
RUTA_SERP5      TMPPAIVARMASTIDSISNGRFGLNVVTGWQKPEYEQMGMWPGDDYFGRRYDYLAEYVNV
RUTA_YERE8      TLPPAIVARMASTIDSISNGRFGLNVVTGWQKPEYEQMGLWPGDEYFSRRYDYLSEYVEV
RUTA_PSE14      TIPPAIAARMASTIDSISNGRFGINLVTGWQKPEYEQMGLWPGDEFFHTRYEYLAEYAQV
RUTA_PSEU2      TIPPAIAARMASTIDSISNGRFGINLVTGWQKPEYEQMGLWPGDEFFHTRYEYLAEYAQV
RUTA_PSEU5      TLPPAIVARMASTIDSISGGRFGVNLVTGWQKPEYSQMGLWPGDEFFGTRYQYLGEYAQV
RUTA_BRASB      TLPPAIVARMATTIDSISGGRFGINIVSGWAKAEYEQMGLWPGDDYFGYRYAYSTEYVQV
RUTA_AGRVS      TMPPAVVARMAATIDSIAPGRFGINMVTGWQPKEYQQMGLELTPEHFARRYDYASEYVQV
                 :***  ***. *****: ****:*:::**   ** ***:     .:  **    **  :

RUTA_AGRFC      LKELLTEGQSDFKGKFFQMDDCRMKPVPQGDVKLICAGSSNSGMAFSAKFADYSFC-FGV
RUTA_VARPS      LRELWGKGQSDFKGDHFQMDDCRLSPQPQADMKVICAGQSDAGMDFSARYADYNFC-FGK
RUTA_CAUVC      LKDLLETGVSDFKGKYFTMDDCRVSPHPK-ETKLICAGSSDEGLAFTAQYADYSFA-LGK
RUTA_CAUVN      LKDLLETGVSDFKGKYFTMDDCRVSPHPK-ETKLICAGSSDEGLAFTAQYADYSFA-LGK
RUTA_CAUST      LKDLLETGVSDFKGKYFTMDDCRVSPHPK-ETKLICAGSSDEGLAFTAQYADYSFA-LGK
RUTA_CAUSK      LRELLETGVSDFKGKYFQMTDCRVSPHPK-DTKLICAGSSNEGLAFTAQYADYSFA-LGK
RUTA_HALO1      LRELWEKGESSFQGEFYQMEDCRVRPQPQGDMKLICAGSSDAGLAFSAKYADYAFC-LGK
RUTA_METC4      LRELWETGRSDLKGEFFQMEDCRLSPRPQAEMKIICAGQSAAGMAFTATYADYNFC-FGK
RUTA_METED      LRELWETGRSDLKGEFFQMEDCRLSPRPQAEMKIICAGQSAAGMAFTATYADYNFC-FGK
RUTA_METEP      LRELWETGRSDLKGEFFQMEDCRLSPRPQAEMKIICAGQSAAGMAFTATYADYNFC-FGK
RUTA_METEA      LRELWETGRSDLKGEFFQMEDCRLSPRPQAEMKIICAGQSTAGMEFTATYADYNFC-FGK
RUTA_METPB      LRDLWETGSSDLKGEFFQMEDCRLSPRPQAEMKIICAGQSAAGMAFTATYADYNFC-FGK
RUTA_AGRRK      LRDLWETGKSDLKGEFFQMDDCRLSPRPQADMKVICAGSSTAGMEFSAQYADYNFC-FGV
RUTA_METRJ      LRDLWETGASDRKGAYFQMNDCRLSPRPQAPVKIICAGQSGAGLAFTAQYADYNFC-LGK
RUTA_ACIAD      LRELWATGQSDFKGEHFQMEDCRVSPQPQAEMKIICAGQSDTGLEFSAQHADYNFV-FGK
RUTA_ECOBW      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOD1      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECODH      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOLI      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECO27      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOSM      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECO45      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOK1      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECO81      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOKI      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOUT      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOL6      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOS5      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECOL5      LRDLWGSGKSDFKGDFFTMDDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFC-FGK
RUTA_ECO8A      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOSE      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOLU      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO55      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO26      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO1A      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO10      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO57      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO5T      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOLC      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOBD      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO5E      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOCB      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO7I      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOHS      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO24      LRDLWGSGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_SHIDS      LRDLWGSGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECOBR      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ECO44      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_SHIF2      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSIPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_SHIFL      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSIPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_SHIF8      LRDLWGTGKSDFKGDFFTMNDCRVSPQPSIPMKVICAGQSDAGMAFSAQYADFNFC-FGK
RUTA_ENT38      LRDLWGTGKSDFKGDYFTMNDCRVSPQPSTPMKVICAGQSDAGMAFSAQHADFNFC-FGK
RUTA_ENTCC      LRDLWGTGKSDFKGDYFTMNDCRVSPQPSAPMKVICAGQSDAGMAFSAKYADFNFC-FGK
RUTA_CROTZ      LRDLWDTGQSDFKGDYFTMNDCRVSPRPQQPMKVICAGQSDAGMAFSAQHADYNFC-FGK
RUTA_CROS8      LRDLWDTGRSDFKGDYFTMNDCRVSPRPQQPMKVICAGQSDAGMAFSAQHADYNFC-FGK
RUTA_KLEP3      LRDLWGTGRSDFKGDYFTMNDCRVSPRPSQPMKVICAGQSDAGMAFSAQHADYNFC-FGK
RUTA_KLEVT      LRDLWGTGRSDFKGDYFTMNDCRVSPRPSQPMKVICAGQSDAGMAFSAQHADYNFC-FGK
RUTA_KLEP7      LRDLWGTGRSDFKGDYFTMNDCRVSPRPSQPMKVICAGQSDAGMAFSAQHADYNFC-FGK
RUTA_PANAM      LRDLWGTGHCTLDGEFFKMDDCRVSPRPQSEMKVICAGQSDAGMAFSAKHADFNFC-FGK
RUTA_SERP5      LRDLWGTGKSDFKGEFFQMDDCRVSPQPQADIKVICAGQSDAGMAFSAKYADYNFC-FGK
RUTA_YERE8      LQDFWGTGQSDFNGEFFQMDDCRVSPQPQTPIKLICAAQSDAGMAFSAKYADYNFC-FGK
RUTA_PSE14      LRDLWATGSSDFKGEHFSMQDCRVSPRPKADMKLICAGQSEAGMAFSAQYADYNFC-FGK
RUTA_PSEU2      LRDLWATGSSDFKGEHFSMQDCRVSPRPQADMKLICAGQSEAGMAFSAQYADYNFC-FGK
RUTA_PSEU5      LRDLWATGRSDFKGEHFQMEDCRVSPKPQADMKIICAGSSDAGMAFSAQYADYNFC-FGK
RUTA_BRASB      MQELWRTGASDFKGKYFQMTDCHMKPLPAHKIEIVAAGQSPTGMAFAATYADYNFV-LAS
RUTA_AGRVS      MRDLWTKGVSNFKGEFFQMDDCKLSPRPSAHIPVVGAGQSERGMRFVAEYGDYNFIGAGG
                ::::   * .  .* .: * **:: * *     :: *..*  *: * * ..*: *   . 

RUTA_AGRFC      GVNTPKAFAPTNERLLAATEKSGREVKSVVLTMVLAEEKSEDAWAKWEHYKAGADEDAIK
RUTA_VARPS      GVNTPKAFAPAAEKLIEATRKTGRHVTTYVLMMVIADETDEAARAKWEHYKAGADHEAIA
RUTA_CAUVC      GTNTPTAFASVNRRLEAAAAKTGRDVQSFILFMVIADETDEKAMAKWQKYRDGADQEALA
RUTA_CAUVN      GTNTPTAFASVNRRLEAAAAKTGRDVQSFILFMVIADETDEKAMAKWQKYRDGADQEALA
RUTA_CAUST      GTNTPTAFASVNKRLEAAAEKTGRDVQSFILFMIIADETDEKAMAKWQSYRDGADQEALA
RUTA_CAUSK      GTNTPTAFGGVNDRLKAAADKTGRDVASYILFMIIADETDEAAMAKWQAYRAGADQEALA
RUTA_HALO1      GVNTPTAFAGNNERLAAATAKTGRDVSIYVLMMVIAAETDDEAMDKWMHYRAGVDEEAVA
RUTA_METC4      GVNTPTAFAPTVERLEEAKAKTGRDVSSYVLFMVISDETDEAARAKWEHYKAGADAEAIA
RUTA_METED      GVNTPTAFAPTVERLEEAKAKTGRDVSSYVLFMVISDETDEAARAKWEHYKAGADAEAIA
RUTA_METEP      GVNTPTAFAPTVERLEEAKAKTGRDVSSYVLFMVISDETDEAARAKWEHYKAGADAEAIA
RUTA_METEA      GVNTPTAFAPTVERLEEAKAKTGRDVSSYVLFMVISDETDEAARAKWEHYKAGADAEAFA
RUTA_METPB      GVNTPTAFAPTVERLEEAKAKTGRDVSSYVLFMIISDETDEAARAKWEHYKAGADQEAIA
RUTA_AGRRK      GVNTPKAFAPAAERLQVATAKTGRDVSSFVLFMVIADETDEAARAKWESYKDGADQEAIA
RUTA_METRJ      GLNTPTAFAPVVEKLAEASARTGRRVTAFALFMIIADETDDAAMATWAHYRAGADAEAIA
RUTA_ACIAD      GLNTPTAYAGINDRLKHFTDQTGRDVQTYVLFMVIAAETDAEAMAKWQSYNDGADVEAIN
RUTA_ECOBW      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOD1      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECODH      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOLI      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO27      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOSM      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO45      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOK1      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO81      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOKI      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOUT      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOL6      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOS5      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOL5      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO8A      GVNTPTAFAPTAVRMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOSE      GVNTPTAFAPTAARMKQAAEQSGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOLU      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO55      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO26      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO1A      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO10      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO57      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO5T      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOLC      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOBD      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO5E      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOCB      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO7I      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARTKWEHYKAGADEEALS
RUTA_ECOHS      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO24      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_SHIDS      GVNTPTAFAPTAVRMKQAAEQTGRDVGSYILFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECOBR      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_ECO44      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDAARTKWEHYKAGADEEALS
RUTA_SHIF2      GVNTPTAFAPTAARMKQATEQTGRDVGSYVLFMVIADETDDATRAKWEHYKAGADEEALS
RUTA_SHIFL      GVNTPTAFAPTAARMKQATEQTGRDVGSYVLFMVIADETDDATRAKWEHYKAGADEEALS
RUTA_SHIF8      GVNTPTAFAPTAARMKQAAEQTGRDVGSYVLFMVIADETDDATRAKWEHYKAGADEEVLS
RUTA_ENT38      GVNTPAAFAPTAARMKDAAEKTGRDVGSYVLFMVIADETDEAARAKWEHYKAGADEDALS
RUTA_ENTCC      GVNTPAAFAPTAARMKEAADKTGRDVGSYVLFMVIADETDEAARAKWERYKDGADDEALS
RUTA_CROTZ      GVNTPAAFAPTAARMKAAADKAGRNVGSYVLFMVIADETDDAARAKWEHYKAGADEEALS
RUTA_CROS8      GVNTPAAFAPTAARMKAAAEKAGRDVGSYVLFMVIADETDEAARAKWEHYKAGADEEALS
RUTA_KLEP3      GVNTPTAFAPTAARMIQAAEKTGRDVGSYVLFMVIADETDEAARAKWEHYKAGADEEALA
RUTA_KLEVT      GVNTPTAFAPTAARMMQAAEKTGRDVGSYVLFMVIADETDEAARAKWEHYKAGADEEALA
RUTA_KLEP7      GVNTPTAFAPTAARMMQAAEKTGRDVGSYVLFMVIADETDEAARAKWEHYKAGADEEALA
RUTA_PANAM      GVNTPTAFAPTAARMKTAADAENRDVSSYVLFMVIADETDEAARAKWELYKAGADAEALS
RUTA_SERP5      GVNTPTAFAPTAARLKIAADSEGRSVACYVLFMIIADETDEAARAKWESYKAGADTEALA
RUTA_YERE8      GVNTPTAFAPTAARLQKAAEQAGREVSSYVLFMIIADETDELARAKWESYKAGADTEALA
RUTA_PSE14      GVNTPTAFAPTAQKLIEANEKTGRNVTSCVLFMIIADDTDEAARARWEHIKDGADEEAIA
RUTA_PSEU2      GVNTPTAFAPTAQKLLEANEKTGRNVTSCVLFMIIADDTDEAARARWEHIKDGADEEAIA
RUTA_PSEU5      GVNTPTAFAPAAERLQAACAKTGRHVTSCVLFMVIADETDEAARAKWEHYKAGADEEAIA
RUTA_BRASB      GVNTPTAHVKLNEQLLDAVAKTGRDVGAYVLFMVIADETDEAAMAKWQAYKDGTDVDALV
RUTA_AGRVS      DMNQTDGARTMVAKVEAAAKQSGRDTGAFLLLMVIADRTDELAFAKWELYKQGTDIEALE
                . * . .      ::       .* .    * *:::  ..  :   *   . * * ... 

RUTA_AGRFC      WLGLQSAVDTKSGSDTNVRHMSNPV-SAVNINMGTLIGSYEEVAAMLDEMS-EVPGTGGV
RUTA_VARPS      WLGQQGAADTRSGADTNVRQMADPT-SAVNINMGTLVGSYATVARLLDEMA-EVPGTEGV
RUTA_CAUVC      WLTQQAAPNAKAGATTNTQQLAAPE-SAVNLNMGTLVGSYESIARMMDEIA-QVPGTAGV
RUTA_CAUVN      WLTQQAAPNAKAGATTNTQQLAAPE-SAVNLNMGTLVGSYESIARMMDEIA-QVPGTAGV
RUTA_CAUST      WLTQQAAPNAKAGATTNTQQLAAPE-SAVNLNMGTLVGSYESIAKMLDEIA-AVPGTAGV
RUTA_CAUSK      WLTNQAAPNAAAGATTNTAQLAAPE-SAVNLNMGTLVGSYENVARMLDEVA-AVEGTAGV
RUTA_HALO1      WLGNQGAAD-KTSDTTNVRQLAARE-SAVNLNMGTLVGSYENIARMLDEVA-TVPNTGGV
RUTA_METC4      WLGLQGAADTKSGADTNIRQMADPT-SAVNINMGTLVGSHATVAALLDEVV-TVPGTGGV
RUTA_METED      WLGLQGAADTKSGADTNIRQMADPT-SAVNINMGTLVGSHATVAALLDEVV-TVPGTGGV
RUTA_METEP      WLGLQGAADTKSGADTNIRQMADPT-SAVNINMGTLVGSHATVAALLDEVV-TVPGTGGV
RUTA_METEA      WLGLQGAADTKSGADTNIRQMADPT-SAVNINMGTLVGSHATVAALLDEVV-TVPGTGGV
RUTA_METPB      WLGLQGAADTKSGADTNIRQMADPT-SAVNINMGTLVGSYATVAALLDEVV-TVPGTGGV
RUTA_AGRRK      WLGVQGAADTKSGSDTNIRQMADSV-SAVNINMGTLVGSYETIAKLLDEVP-TVPGTGGV
RUTA_METRJ      WLGAQGAADTRSGSDTNVRQLADPA-SAVNLNMGTLVGSYASVAAMLDAVM-TIDGVEGV
RUTA_ACIAD      WLMNQGGKDTKSGADTNIRQMASSV-SPVNINMGTLVGSYEKVAAMLDEIA-EIKGTEGI
RUTA_ECOBW      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOD1      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECODH      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOLI      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO27      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOSM      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-TVPGAEGV
RUTA_ECO45      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOK1      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO81      WLTEQSQKDTRSDTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOKI      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOUT      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOL6      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-NVPGAEGV
RUTA_ECOS5      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-NVPGAEGV
RUTA_ECOL5      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO8A      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOSE      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOLU      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO55      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO26      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO1A      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO10      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO57      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO5T      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOLC      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOBD      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO5E      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECOCB      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO7I      WLTEQSQKDTRSGTDTNVRQMADPT-SASAFNH---------------------------
RUTA_ECOHS      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO24      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_SHIDS      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPSAEGV
RUTA_ECOBR      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ECO44      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_SHIF2      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_SHIFL      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_SHIF8      WLTEQSQKDTRSGTDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGAEGV
RUTA_ENT38      WLTEQSQKDTRSGADTNVRQMADPT-SAVNINMGTLVGSYASVAKMLDEVA-SVPGAEGV
RUTA_ENTCC      WLTEQSQKDTRSGADTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-AVPGAEGV
RUTA_CROTZ      WLTEQSQKDTRSGADTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-AVPGTEGV
RUTA_CROS8      WLTEQSQKDTRSGADTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-AVPGTEGV
RUTA_KLEP3      WLTEQSQKDTRSGSDTNVRQMADPT-SAVNINMGTLVGSYASIARMLDEVA-SVPGTDGV
RUTA_KLEVT      WLTEQSQKDTRSGSDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGTDGV
RUTA_KLEP7      WLTEQSQKDTRSGSDTNVRQMADPT-SAVNINMGTLVGSYASVARMLDEVA-SVPGTDGV
RUTA_PANAM      WLTDQSSKDTRSGSDTNVRQMADPT-SAVNINMGTLVGSWASVARMLDEID-TVPGAGGV
RUTA_SERP5      WLTEQSGKDTKSGADTNVRQMADPT-SAVNINMGTLVGSYANVARMMDEIA-TVPGTEGV
RUTA_YERE8      WLTEQSGKDTQSGADTNVRQMADPT-SAVNINMGTLVGSYANVAKMMDDIA-TVPGTEGI
RUTA_PSE14      WLSEKGSADK--SAGSNLRQMADPT-SAVNINMGTLVGSWATVARMLDEVA-SVPGTQGV
RUTA_PSEU2      WLSEKGSADK--SAGSNLRQMADPT-SAVNINMGTLVGSWATVARMLDEVA-SVPGTQGV
RUTA_PSEU5      WLGEQGAADK--GADSNIRQMADPT-SAVNINMGTLVGSYANVARMLDEIA-TVPGMQGV
RUTA_BRASB      WMADQGSKDQSAAGSSTAKTINLPE-QALNFNMGTIVGSYATVARLLDEAA-SVPGTKGL
RUTA_AGRVS      WQASQAGQDTVAKEGSTAAALVRQIKNPQPTGMLKLIGSYEKVAAMLDEIALSTPGLKGI
                *   :.  :      :.   :     ..   .                            

RUTA_AGRFC      MLTFDDFLEGVEKFGKYVQPLMKSRQHVLAELEAAE-------
RUTA_VARPS      LLTFDDFVQGVAAFGERIQPLMKSRVHVQSPVPSQAEAERLAA
RUTA_CAUVC      LLTFDDFVQGVEDFGTKIQPLMKSRKGG---------------
RUTA_CAUVN      LLTFDDFVQGVEDFGTKIQPLMKSRKGG---------------
RUTA_CAUST      LLVFDDFLRGVEDFGTRIQPLMKSRT-----------------
RUTA_CAUSK      LLVFDDFVAGVENFGTKIQPLMTSRAGV---------------
RUTA_HALO1      LLVFDDFVAGVETFGTRIQPLMKTRQHTAG-------------
RUTA_METC4      LLVFDDFLKGLDDFGTKIQPLMRSRRHVTGEALAEVA------
RUTA_METED      LLVFDDFLKGLDDFGTKIQPLMRSRRHVTGEALAEVA------
RUTA_METEP      LLVFDDFLKGLDDFGTKIQPLMRSRRHVTGEALAEVA------
RUTA_METEA      LLVFDDFLKGLDDFGTKIQPLMRSRRHVTGEMLAEVA------
RUTA_METPB      LLVFDDFLKGLDDFGTKIQPLMASRRHVTGEALAEVA------
RUTA_AGRRK      LLTFDDFVKGVEDFGTKIQPLMKCREHIKPMLEAAE-------
RUTA_METRJ      LLVFDDFLKGLDAFGTRIQPLMRSRRHVTAAALPEVA------
RUTA_ACIAD      LLTFDDFVQGVEDFGERIQPLMTSRQDIVAEYQPVTPLEKSA-
RUTA_ECOBW      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOD1      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECODH      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOLI      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO27      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOSM      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO45      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOK1      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO81      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOKI      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOUT      LLTFDDFLSGIENFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOL6      LLTFDDFLSGIETFGERIQPLMLCRAHLPALTQEVA-------
RUTA_ECOS5      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOL5      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO8A      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOSE      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECOLU      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO55      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO26      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO1A      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO10      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_ECO57      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECO5T      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECOLC      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECOBD      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECO5E      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECOCB      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECO7I      -------------------------------------------
RUTA_ECOHS      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECO24      LLTFDDFLSGIETFGERIQPLMQCRAHLPALTQEVA-------
RUTA_SHIDS      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECOBR      LLTFDDFLSGIETFGERIQPLMQCRAHLPVLTQEVA-------
RUTA_ECO44      LLTFDDFLSGIETFGERIQPLMQCRAHLPTLTQEVA-------
RUTA_SHIF2      LLTFDDFLSGIETFGERIQPLMQCRAHLSALTQEVA-------
RUTA_SHIFL      LLTFDDFLSGIETFGERIQPLMQCRAHLSALTQEVA-------
RUTA_SHIF8      LLTFDDFLSGIETFGERIQPLMQCRAHLSALTQEVA-------
RUTA_ENT38      LLTFDDFLQGVETFGERIQPLMECRSHIPAVTREVA-------
RUTA_ENTCC      LLTFDDFLTGVETFGERIQPLMQCRAHIPAITKEVA-------
RUTA_CROTZ      LLTFDDFLTGIDAFGEHIQPLMRCRDHLR-VTQEVA-------
RUTA_CROS8      LLTFDDFLTGIDAFGEHIQPLMRCRDHLR-VTQEVA-------
RUTA_KLEP3      LLTFDDFLAGIDAFGERIQPLMRCRDHIAPVTREVA-------
RUTA_KLEVT      LLTFDDFLAGIDAFGERIQPLMRCRDHIAPVTREVA-------
RUTA_KLEP7      LLTFDDFLAGIDAFGERIQPLMRCRNHIASVTREVA-------
RUTA_PANAM      LLTFDDFVEGIENFGRYIQPLMKTRQHIGIEQKEVA-------
RUTA_SERP5      LLTFDDFITGVENFGERIQPLMKSRADVC-PQTAASREVA---
RUTA_YERE8      LLTFDDFLSGIENFGQHIQPLMNSRADIVDTLPPAAREVA---
RUTA_PSE14      MLTFDDFVKGVEDFGEKIQPLMTSRKHIAQLKEVV--------
RUTA_PSEU2      MLTFDDFVKGVEDFGEKIQPLMTSRKHIAQLKEVV--------
RUTA_PSEU5      MLTFDDFLEGVEAFGQKIQPLMQSRRHVTALKESA--------
RUTA_BRASB      MLTFDDFVQGIESFGQHVQPLMTSRAARLLPAA----------
RUTA_AGRVS      MLTFDDFVIGMEQFGQYIQPLMRSRNPNLKRNLDAA-------