CLUSTAL format seed alignment for MF_01811

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YIDC2_BACCR      ---MKKKLGL------LAMVVALMAIATGCSETGQPITSK-------STGIWNEYFVYPL
MISCA_BACSU      -MLLKRRIGL------LLSMVGVFMLLAGCSSVKEPITAD-------SPHFWDKYVVYPL
YIDC1_BACHD      ---MYRKFGM------AAMLVSILLLMTGCFNVNEPINAQ-------SEGIWDSYFVYPL
YIDC_OCEIH       ---MRKKFGI------IVALIALTTLLSGCTEINEPITPN-------SDGIWNTIFVYPV
YIDC2_BACHD      -MNYMKRRLL------LFAGILLLVALAGCSTT-DPITSE-------SEGIWNHFFVYPM
YIDC_BACPE       ----MKKVLW------IIIIILMVGALAGCGANGQPITAE-------TEGIWNHFFVYPL
YIDC1_STRA3      ---MKKKLKT------FSLILLTGSLLVACG--RGEVSSH-------SATLWEQ-IVYAF
YIDC1_STRP1      ---MRKVLRVKKN-IKIARIVPLVLLLVACG--RGEVTAQ-------SSSGWDQ-LVYLF
YIDC1_STRMU      ---MKKKYRI------IGLAVAALLFLSACG--RSQVTSH-------SSDAWEK-FVYFF
YIDC2_STRR6      -MGVKKKLKL------TSLLGLSLLIMTACA--TNGVTSD---ITAESADFWSK-LVYFF
YIDC_STRS2       ---MKKKVKW------AGLLVASLIVLTACG--TGPVTS-------QSTDAWDR-LIYWF
YIDC1_LACLA      ---MKKKFSL------IAMAGAALLLLTACG--TTAVTSS-------STNLWDQ-IVYGF
YIDC_ENTFA       ---MKKYKRL----LLMAGLVTLVFVLSACG--TAPVSES-------STGIWDRYIVYYF
YIDC2_LACPL      ---MKKYRKI----LAMLAVLAIVLVLSGCS--NTPITDK-------STGFWDGLIILNF
YIDC_PEDPA       ---MKHLKRN----MALLSVAALSFILTACS--TAPITSH-------STGIWDGVIVYNF
YIDC2_LISIN      ---MKKKKRFKQKLLIASLVIGLVAVLSGCGYSTDPITKD-------STGFWSHYIVFPL
YIDC1_BACAN      ---MLKSYRA----VLVSLSLLLVFVLSGCSN-ATPIDAH-------STGIWDHYFVYPI
YIDC2_STRA3      MKKTLKRILF------SSLSLSILLLLTGCVSVD-------KA-G-KPYGVIWNTLGVPM
YIDC2_STRP1      MKLTLNRILF------SGLALSILLTLTGCVGRD-------AH-G-NPKGMIWEFLGKPM
YIDC2_STRMU      MKKIYKRLLF------SGLALSMLFFLSGCVQMK-------NG-KPTGEGWVYKFFAAPM
YIDC1_STRPN      -MKSIKRFAL------SAMGVAMLLVLTGCVNVD-------KT-TGQPTGFIWNTIGAPM
YIDC2_LACLA      MKNLKKKLTL------TGLMTAGLLFLSGCVQTHVVDGVRVPT-EAATHGITYNFLVRPM
YIDC1_LACPL      -MKSKKGLTL------TITLGTLALFLSGCVQTT--------K-AGKPYGFVYEYLAKPG
YIDC2_STAES      -----MHKRL------FITLLGFIILLAGCDYSK----------EENQTGIFYNVFVKSM
YIDC_STAHJ       ----MKKKAL------LPLLLGVMVFLAGCDYSK----------SSNRDGFFYNTFVEPM
YIDC1_LISIN      --MKKKNIIL------ISVLLGALLLITGCSMDP----------SQNTDGFFSTYLIQPF
MISCB_BACSU      MLKTYQKLLA------MGIFLIVLCSGNAAFAAT-----NQVG-GLSNVGFFHDYLIEPF
                                             ..                         .    

YIDC2_BACCR      SQLITYFAD-LFNSNYGLAIVITTLIIRFALLPLMIKQTKST----KAMQALQPEMVKLK
MISCA_BACSU      SELITYVAK-LTGDNYGLSIILVTILIRLLILPLMIKQLRSS----KAMQALQPEMQKLK
YIDC1_BACHD      SWLMIYFAN-AFNGSFGLAIIVVTLLIRLLILPLMIKQLKST----RAMQALQPEMQALR
YIDC_OCEIH       SWLITNVAG-VFNEGYGLAIIIVTLFVRLLLMPLNVKQIKSS----KAMQEIQPKLQEIQ
YIDC2_BACHD      SWLITTVAN-LLNGSYGLSIIIVTILIRLALLPLTLKQQKSM----RAMQVIRPEMEAIQ
YIDC_BACPE       SWVLISVAD-LLNGSFGLSIIVVTIGIRLFLLPLMIKQQKSS----RAMQALRPEMEALQ
YIDC1_STRA3      AKSIQWLS---FNHSIGLGIILFTLIIRAIMMPLYNMQMKSS----QKMQEIQPRLKELQ
YIDC1_STRP1      ARAIQWLS---FDGSIGVGIILFTLTIRLMLMPLFNMQIKSS----QKMQDIQPELRELQ
YIDC1_STRMU      AETIRFLS---INGRIGIGIILFTFLIRTILLPLFNLQLKSG----QKMQELQPELKALQ
YIDC2_STRR6      AEIIRFLS---FDISIGVGIILFTVLIRTVLLPVFQVQMVAS----RKMQEAQPRIKALR
YIDC_STRS2       ASIIQFLS---INGQIGIGIILFTILIRTLLLPLFQIQMNSS----RKMQELQPQLKKLQ
YIDC1_LACLA      AQVIRFLS---FGGLTGVGIILFTIVIRAALLPLMNIQIKSS----QRMQEIQPEIKKIQ
YIDC_ENTFA       AQAIKFLS---LGGSVGIGIILFTLVIRIILLPLMHFQTKSM----RKTQELQPQLKALQ
YIDC2_LACPL      SRAIIWLSN-LFGHSYGLGIIVFTLIIRIIILPLMIFQTRNM----VAMQEVQPQMKALQ
YIDC_PEDPA       SRFIIYLSK-LFGGNYGWGIIVFTIIIRIIILPLMIYQTRTT----MKTAELQPKLKQLQ
YIDC2_LISIN      SWVITWFSD-LFGGNYAVGIIVVTILIRLLIMPLMIKQLKSQ----KAMTSLQPKIKELQ
YIDC1_BACAN      SFMIQFVAHHIPGASFGIAIIIMTLVIRSAMIPLAVSQYRSQ----AKMKKMQPELQKLK
YIDC2_STRA3      ANLITYFAQ-HQGLGFGVAIIIVTIIVRVIILPLGLYQSWKASYQAEKMAYFKPLFEPIN
YIDC2_STRP1      SYFIDYFAN-NAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPIN
YIDC2_STRMU      GSVIQYLAN-NLGLGFGFAIIIVTVIVRLLILPLGLSQVRKMTYQSEKMAYLKPVFDPIQ
YIDC1_STRPN      AEAIKYFAT-DKGLGFGVAIIIVTIIVRLIILPLGIYQSWKATLHSEKMNALKHVLEPHQ
YIDC2_LACLA      SAFVDLFAN-NLHMGYGWGIIFVTLIIRFLILPLGLNQAYKSTYMQEKMAYLAPVFAPLQ
YIDC1_LACPL      QNVMEWLSQ-LFGNNYGWAIIGLTVIVRLVLLPMMINQQRKSTYQQEKMSAVRPQMEKIQ
YIDC2_STAES      DGFLHFLGR-VFQDNYGFAIISIVLIVRFILLPFMLIQVKNMHMMREKTKVVQPELDAIR
YIDC_STAHJ       SKVLHWLGHSVFNDDYGIAIIVLVLVIRIILLPFMLSNYKNSHLMREKMKVAKPEVDGVQ
YIDC1_LISIN      TSFIMFVAK-FVGGNYGIAIIITTLLIRALIMPLNLRTAKAQMGMQSKMAVAKPEIDEIQ
MISCB_BACSU      SALLKGVAG-LFHGEYGLSIILVTIIVRIVVLPLFVNQFKKQRIFQEKMAVIKPQVDSIQ
                    :  ..        . .*:  .. :*  ::*.                     .   .

YIDC2_BACCR      EKYS---SKDQATQQKLQQEMMQLYQKNGVNPLAG---CLPIFVQMPILFAFYHAIMR--
MISCA_BACSU      EKYS---SKDQKTQQKLQQETMALFQKHGVNPLAG---CFPILIQMPILIGFYHAIMR--
YIDC1_BACHD      EKYS---AKDQRTQQKLQQETMALFQKHGVNPLAG---CFPVLIQMPILLAFYHAIMR--
YIDC_OCEIH       KKYT---SKDANTQQKLQQETMELFQKNGVNPLAG---CLPILVQMPIFVAMYHAIMR--
YIDC2_BACHD      KKYKEKGSKDPKVQQEMQKELLGLYQKHGVNPMAG---CLPLFIQLPILMAFYFAIMR--
YIDC_BACPE       KKYGQGTKRDPKDQQKMQKELMALYKDSGVNPMAG---CLPLFIQLPVMMAFYFAIMR--
YIDC1_STRA3      KKYP---GKDPDSRLKLNDEMQSMYKAEGVNPYAS---VLPLLIQLPVLWALFQALTR--
YIDC1_STRP1      RKYA---GKDTQTRMKLAEESQALYKKYGVNPYAS---LLPLLIQMPVMIALFQALTR--
YIDC1_STRMU      TKYP---GKDRESRMRMAEESQELYKKYGVNPYAS---LFPLLIQMPVLWALYQALTR--
YIDC2_STRR6      EQYP---GRDMESRTKLEQEMRKVFKEMGVRQSDS---LWPILIQMPVILALFQALSR--
YIDC_STRS2       AEYP---GTDMESRQQLYEATQALYKENGVSMRAS---MIPLFIQMPILLALFQALTR--
YIDC1_LACLA      AKYP---SKDMESRRLMNEEIQKLYAENKVNPYMG---CLPLVVQMPVLWALYQALSR--
YIDC_ENTFA       QKYS---SKDPETQRLFREEQQRLYAENNVNPYIG---CLPLLVQLPIMMALYQAISR--
YIDC2_LACPL      KKYS---SRDMETQQKLQAEMKKLYAKHGVHPMAS---MLPLLVQLPILIALYQAIWR--
YIDC_PEDPA       QKYS---SRDAESQQKLREEQQKLYAEAGVNPMAG---CLPLIIQLPVMYALYAAVSR--
YIDC2_LISIN      EKYS---SKDNETKQKLQQETMRLYQENSVNPMMG---CLPLLIQMPILLGFYQAISR--
YIDC1_BACAN      QKYGD-VSKDLEKQKQYQKEMSELMKSGGWNPLAG---CWPLLIQMPIFSALYYAISR--
YIDC2_STRA3      ERLRN--AKTQEEKLAAQTELMTAQRENGLSMFGG-IGCLPLLIQMPFFSAIFFAARY--
YIDC2_STRP1      KRIKQ--ANSQEEKMAAQTELMAAQRAHGINPLGG-IGCLPLLIQMPFFSAMYFAAQY--
YIDC2_STRMU      ERMKN--AKTQEEKMAAQTELMQAQRHYGMSMFGG-LGCLPLLIQMPFFSALYISTRY--
YIDC1_STRPN      TRLKE--ATTQEEKLEAQQALFAAQKEHGISMFGG-VGCFPILLQMPFFSAIYFAAQH--
YIDC2_LACLA      ERLKK--AQTPEEKMAAQQALMAAQKDNGINMLSS-IGCLPMLIQWPFFIALYNAAAY--
YIDC1_LACPL      ARQKA--ATTQEEKAAISNELMQLYRDNGISMTGG-IGCLPLLIQLPIFSALYYAIRY--
YIDC2_STAES      DKMKH--ATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPVLIQMPILMGLYMSLKYPS
YIDC_STAHJ       EKVKR--ARTQEEKMAANQEMMEVYKKYDINPMKSALGCLPVLIQMPVVMGLYFVLRYRI
YIDC1_LISIN      ARLKR--ATSKEEQANIQKEMMAVYSKYNINPIQ--MGCLPLLIQMPILMAFYYAIR---
MISCB_BACSU      VKLKK--TKDPEKQKELQMEMMKLYQEHNINPLAM--GCLPMLIQSPIMIGLYYAIRS--
                  .           :                          *:.:* *.. .::       

YIDC2_BACCR      -TAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNP------------
MISCA_BACSU      -TQAISEHSFLWFDLGEKDPYYILPIVAGVATFVQQKLMMAGNAQQNP------------
YIDC1_BACHD      -TREIGDEHFLWFVLNQPDP-ILLPIIAGITTFLQQKMMMVTD---NP------------
YIDC_OCEIH       -TPEISTHSFLWFQLG--SPDYILPILTGLFTFLQQKLMMSTNTSMNSN----------P
YIDC2_BACHD      -TEEIRYHTFLWFDLGQPD--YILPFVAGITTYFQFKMTMSHQQQMQKTNPSDSDNPMAN
YIDC_BACPE       -TEVIALHSFLWFDLGSPDPLYILPVVAGITTFLQVKMT-------------------SF
YIDC1_STRA3      -VSFLKVGTFLSLELSQPDPYYILPVLAALFTFLSTWLTNKAAVE---------------
YIDC1_STRP1      -VSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKE---------------
YIDC1_STRMU      -VEFLKTGSFLWMDIGNKDPYFILPVLAAIFTFLSSWLTNKAAKE---------------
YIDC2_STRR6      -VDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSE---------------
YIDC_STRS2       -VEALKVGHFLWLNLGEPDPFFILPILAAVFTFLSSWLTNKSAIE---------------
YIDC1_LACLA      -VDFLKHGTFLWFEIGAKDPTFILPILAAVFTFLSSYLMMKSAPE---------------
YIDC_ENTFA       -VPELKEGTFLWLSLDKPDPYLILPILAAVFTFASTYLSSMSQLE---------------
YIDC2_LACPL      -TQALKTGSFLWLQLGSKDPYYVLPILAAIFTFASSWLAMKSQPE---------------
YIDC_PEDPA       -TQVLKEGTFLWLQLSDKDPYFILPILAALFTFMSTWLSMKSQPAGS-------------
YIDC2_LISIN      -TAEIKTDTFLWMQLGNPDPYYILPIVAALTTFLSSKISMMGQTQ---------------
YIDC1_BACAN      -TEEIRTSTFLWVNLGHADPYHILPIIAALTTFIQMKVFQSNSTSGE-------------
YIDC2_STRA3      -TPGVSSATFLGLNLGQKS--LTLTVIIAILYFVQSWLSMQGVPDE--------------
YIDC2_STRP1      -TKGVSTSTFMGIDLGSRS--LVLTAIIAALYFFQSWLSMMAVSEE--------------
YIDC2_STRMU      -TKGIASASFLGIKLGSPN--MIITVIIGILYLVQSWVSTLSVPEA--------------
YIDC1_STRPN      -TEGVAQASYLGIPLGSPS--MILVACAGVLYYLQSLLSLHGVEDEM-------------
YIDC2_LACLA      -TTGISSSTFYGIPLGHPS--VVLVIISGVLYFIQTWISTLSMTPE--------------
YIDC1_LACPL      -SPELSKATFMGISLGKSS--LILAILAFLSYLAQGYLSMIGLPEE--------------
YIDC2_STAES      SHGITEYPHFLWFDLTQPD--LIMTIIAAIMYFVQPLVNSIHYPKD--------------
YIDC_STAHJ       GGGIAEHPHFLWFNLIHPD--IWITIIAGVLYFIQAWVSSKQMPQE--------------
YIDC1_LISIN      GSSEIASHTFLWFNLGSPD--MVLAIIAGLVYLAQYFVSMIGYSPE--------------
MISCB_BACSU      -TPEIASHSFLWFSLGQSD--ILMSLSAGIMYFVQAYIAQKLSAKYSAVPQ-------NP
                          :  . :   .    :          .  :                      

YIDC2_BACCR      ----QMAMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEI---------
MISCA_BACSU      ----QMAMMLWIMPIMIIVFAINFPAALSLYWVVGNLFMIAQTFLIKGPDI---------
YIDC1_BACHD      ----QMKVLLYVMPVMILVFAMFLPSSLALYWVIGNLFMILQTYFITGPNVGA-------
YIDC_OCEIH       QMKLQMQIMLYVMPIMIGVMAFFFPAALALYWVTGNIFMVFQTLLINKPMM---------
YIDC2_BACHD      MMQMQMKVMLYVMPVMIIIAGLSLPSALSLYWVIGNIFMIIQTYFIVVKAPPL-------
YIDC_BACPE       QLNDQMKVIIYIMPVMIVVAGVTLPSALSLYWVVGNLFMIIQTYFTVVRFEQL-------
YIDC1_STRA3      -KNIALTLMTYVMPFIILVTSFNFASGVVLYWTVSNAFQVFQILLLNNPYKIIKVREEAV
YIDC1_STRP1      -KNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLA
YIDC1_STRMU      -RNGMMITMNIILPIFILLIGFNLASGVALYWVVSNAYQVFQILLLNNPFKIIAERQRLE
YIDC2_STRR6      -RNGATTAMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVV
YIDC_STRS2       -KNMAMTIMTYVMPVMIFFFAVAAASGVALYWTVSNAYQVAQTLVFNNPFKIIAERQAKI
YIDC1_LACLA      -RNAMTTSMTYIMPIFILIMGVNFAAGIALYWVISNAFQVFQTMLLANPYKIIAAREAKV
YIDC_ENTFA       -TNASLKIMNYVMPAMIFFMGISLASSLSLYWVVSNAFQTGQTLLLNNPFKIRKEREEAA
YIDC2_LACPL      -QNGMTTSMTYLMPVIILITAINVPSALSLYWVISNAFQVGQTLLLQNPFKINREREAKK
YIDC_PEDPA       -QNGMTSAMTFGMPLVILITALNFPAAITLYWVVTNLFQVGQTLIIQNPFKIQKEREEKI
YIDC2_LISIN      -QNKSMAMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALA
YIDC1_BACAN      -QVQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTMMQTIVLRKIMERE-------
YIDC2_STRA3      -QRQQMKTMMYVMPIAMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEE
YIDC2_STRP1      -QREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKE
YIDC2_STRMU      -QRQQTRNMMFMMPIMMVMISIGAPAGGALYWLVSGIFGLIQQLITNHIIKPKLRKQIDE
YIDC1_STRPN      -QREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVRE
YIDC2_LACLA      -QKKSGMAMLIMSPAMIVVFSFMSPAGVALYWAVGGFVIVIQQIIITFIMKPRMRRRIDE
YIDC1_LACPL      -QKKTMRLMLIMSPVMILFVSMSAPAGLGLYFFVGGLFACLQTLIINF-FRPRIRREVEA
YIDC2_STAES      -QRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAKK
YIDC_STAHJ       -QRQMTYMMMIVSPIMIIWISLSSASALGLYWSVSAAFLVVQTYFANMYYEKVAQREVAP
YIDC1_LISIN      -QKKQMKIIGLMSPIMILFVSFTAPSALALYWAVGGLFLAGQTLLTKKLYMNKHPEIKVM
MISCB_BACSU      AAQQSAKLMVFIFPVMMTIFSLNVPAALPLYWFTSGLFLTVQNIVLQMTHHKSKKTAALT
                              *  :   ..  ...  **:         *  .               

YIDC2_BACCR      -----------KAS-KAGKAGGSSK--------------------------------
MISCA_BACSU      -----------KKNPEPQKAGGKKK--------------------------------
YIDC1_BACHD      -----------KKVAADVKVGGKKK--------------------------------
YIDC_OCEIH       ----------------------AKK--------------------------------
YIDC2_BACHD      -----------EVEQTKQKSSKPNKA-------------------------------
YIDC_BACPE       -----------KTDISK----------------------------------------
YIDC1_STRA3      RVAHE-----KEQRVKRAKRKASKKRK------------------------------
YIDC1_STRP1      NEEKE-----RRLRERRARKKAMKRK-------------------------------
YIDC1_STRMU      DEARE-----LEAKKRRAKKKAHKKRK------------------------------
YIDC2_STRR6      QAQKD-----LENRKRKAKKKAQKTK-------------------------------
YIDC_STRS2       DAEKE-----RQAKIRRAQKKAQKKK-------------------------------
YIDC1_LACLA      QVEKD-----KIKAREKALKKARKK--------------------------------
YIDC_ENTFA       RQAKA-----RERALERAKSPKKKGKKK-----------------------------
YIDC2_LACPL      QAERD-----RKRTLEKARKRAIRNHKR-----------------------------
YIDC_PEDPA       QTEKA-----KRKAIEKAKRRAMKSKRK-----------------------------
YIDC2_LISIN      AAQLEEERLKKKAANMKASKKGGKKRK------------------------------
YIDC1_BACAN      -----------ELQLQKA---------------------------------------
YIDC2_STRA3      EYTKNPPKA--YKSNNARKDVTSSTKTTESNQAIITSKKTNR-----NAGKQKRRG-
YIDC2_STRP1      EYAKNPPKA--YQSTSSRKDVTPSQNMEQAN--LPKKIKSNR-----NAGKQRKR--
YIDC2_STRMU      EFKKNPPKP--FKS-NARKDITPQANNDKKL-ITSKKQKSNR-----NAGKQRHHKQ
YIDC1_STRPN      ELAKNPPKASAFSKPSGRKDVTPEQPTAITS----KKKHKNR-----NAGKQRSR--
YIDC2_LACLA      EFTKNPPKI----NNEGLKDVTPTSVQENFKEITSERNEKERKSGGRNAGKQNRK--
YIDC1_LACPL      ELKKHPIKT---PTPTQPKPINATESKPSHP---RPQNNAGR---GRNAGKQQRHHK
YIDC2_STAES      LKQKLEQNKDNS-------ELLTEES-------------------------------
YIDC_STAHJ       MIEKFKENNSNSNKKGKNTQVVSKNNKKKK---------------------------
YIDC1_LISIN      EQEEKE-----------FEQIVEEQNKEK----------------------------
MISCB_BACSU      ESVK-----------------------------------------------------