CLUSTAL format seed alignment for MF_01812

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B2GGW2_KOCRD      MSTTPPQDQPVETTHSARGNTYTLRRFHVGEGSLADNPEAVQWNRAVYQGFHDSEPTDEA
M7ML20_9MICC      ---MPVQQLRFAEVPLER-----------NPATGAPSAAYAAWVDTAWEGFHEKPATAEQ
A1R6E8_PAEAT      --MADPIDNNSGKYTVQRFPA-------VADPADPGYSRCTTWVQAVSHGFHQQRRDDEY
Y4024_STRAW       -----------------------MSRPDDIDVRPIAEAETADWIRALNTGFLRSPE----
Y4186_STRCO       -----------------------MSRRTEIDVRPITEAEFPDWNRALNTGFLRPPA----
Y3976_STRGG       -----------------------MS----LDVRTITPSESAEWMRAVSTGFLTAGT----
C7QCZ0_CATAD      ---------------------------MPLEITAVGDAGFDDFCDAVEVGMNRPGG----
D5UCG0_CELFN      ----------------------------------MSTLPAGYRTVAVPSDRVMDYRHVDE
F8A0K6_CELGA      -------------------------------MGAMTPLPDGYRIVTVPLDRKDEFRAVNH
D1BJV2_SANKS      -----------------------------------MPLPDTYALVDLPESRRDELLEIDR
C7R2Y3_JONDD      -----------------------------------MTLPTGFSFTQPTTADRAEVLTYNS
A1SJ53_NOCSJ      ------------------------------------MSPDPIKVDRATDAERYLATDHTV
Y5428_STRAW       ---------------------------------------MTTDVRVLRQDDWNLWYDTLI
Y2625_STRCO       ---------------------------------------MTMEPRVLRREEWDSWYGSLI
H2K8V1_STRHJ      -----------------------------------MGTESGTELRTLRPEEFDRWWDHLV
D7C3J1_STRBB      -----------------------------------------MELRVLAPSHWDEWYGTLM
C7Q3R2_CATAD      -------------------------------MSSDATPHAAHPVRPITDDEVEAFTAQLD
I0GZZ6_ACTM4      -------------------------------MDEELS------VRPATTDDFAAICELLG
A0LTW9_ACIC1      -------------------------------MAGDVSRPGDIVFRPVTDEEFPRFLATGM
C6WQ48_ACTMD      ---------------------------------------MAFTTRSFAITELGDFQRLSD
D7B5L9_NOCDD      ------------------------MTGAPQHDPSRRDDAPAWTVREGTEKDYPEAVRVFC
E3J0P1_FRAIE      ----------MDEPAPTASPAHESRSGLARSREAGAVEIRTLAPE-ERHAARRVFRAAML
V5XGG8_MYCNE      ----------------------------------MSHDIRVLTAEDELIEAGNIFRTAMI
A4FBZ7_SACEN      ---------------------------------MDDLDVRPLADSEHRRARSLFMRS--L
C6WIF3_ACTMD      ---------------------------------MIDHDIRVLGDETHYRAANNVFRRALL
EIS_MYCTU         ---------------------------------------MTVTLCSPTEDDWPGMFLLAA
EIS_MYCBO         ---------------------------------------MTVTLCSPTEDDWPGMFLLAA
A0QY29_MYCS2      -------------------------------------MITPRTLHTITDDDWTRIALLAR
A1THZ4_MYCVP      ------------------------------------------------------MALIAA
H6QY22_NOCCG      -----------------------------------MAIHDDIVIRSARPDDGDAILLLLE
Q73XI4_MYCPA      ----------------------------------MNTQDDGIAIRHPTEDDWQAVFENQA
T2GVQ4_MYCHT      ----------------------------------MDTTDDTIRIRFATEDDWQAVYANQA
D5UTW6_TSUPD      ----------------------------------------MIEIRTATEADWPEMFAHDV
E4N4T8_KITSK      ---------------------------MITEVRPPGRDEMRAYYRVLPFANGLPQWEPTD
D1BAK7_SANKS      ---------------------MPAHSFTLDHFPAAADDRTRAWTRAVRQAFLEPDPTPAR
E8NBL2_MICTS      ----------------MPTTDTRTLALDATSAADLQATGLEYTLVSADDAAFEPFLRAVS
                                                                              

B2GGW2_KOCRD      TRRILRSLRAAGTRLRSVYTADPVPPAALGAE---------------RPVATFCSWDSEL
M7ML20_9MICC      LEQLLQAEVCDGRVLTGVFD-DSRPTDLVDAL---------------TPVATYASFTRTM
A1R6E8_PAEAT      LAKTLTAYQTDKRELTGVYVNGSVPDHSLGAD---------------VPVATYATMRKAL
Y4024_STRAW       -----VSEREVADR--SSYLVPARTLGAFDNG---------------RCVATFRSFPQEL
Y4186_STRCO       -----VAEEQLEAR--RNEFVPGRSLGAFDGD---------------RCVATFRSFDQEL
Y3976_STRGG       -----PSEELVADR--FAGADLSRTQGAFEAG---------------RCVATFRSFAQEL
C7QCZ0_CATAD      -----RGHGPFQRGLFAADVAAGRAIGAHDGG---------------RVVGTFGNYRNTL
D5UCG0_CELFN      LAFATTSDPEIDAVAPFPVPTDRLMAVEG--PD-------------GAYVAVHGSYEF-R
F8A0K6_CELGA      LAFAFEPDEKTSEIIPDQLEWDRTAAVER--PD-------------GTLAAVHASYDF-D
D1BJV2_SANKS      WAFPSSTSDEVARSLPLPLSWDRTSGVVVRVPDPTAVPIDGAVPVRETLVAIHSSYPFSH
C7R2Y3_JONDD      LVVASTHPVSDLLTLPQPYEDERAVIVRDQ---------------HGQIAAFHASYEFSQ
A1SJ53_NOCSJ      WFAEVPSAPTEVQLTGLAPEQRFAVDLDGADPA----------TYPGIYGVFPLTLSIPG
Y5428_STRAW       RAFGGVAEASEERELWQTLTECDRSIGVWDGD---------------ACVGTAGAFSFRV
Y2625_STRCO       RAFGGVPEPAEELELFRELTRVDRSIGVWERDG-----------EAEACVGTTGSFDFRM
H2K8V1_STRHJ      RAFGGGAASAEERELDKSLTEFDRSLAAWDGD---------------ALVGTSGAFSFRM
D7C3J1_STRBB      LAFGGAQVSPEERALDRDLTECERSIGAWDGD---------------EIVGTAGLFSFRL
C7Q3R2_CATAD      LGYHENPPQ-EAHDLWMRLLPRERTIAAFDGE---------------ELVGTGGEFAFRM
I0GZZ6_ACTM4      TVF----HEDVFPELEAEIYETERSLVADDGG---------------TVVGHADAFTRDL
A0LTW9_ACIC1      RAFG-TACRDEHVTRERLVFELDRTTGMFDGD---------------RLVGTGGIFSLQM
C6WQ48_ACTMD      AAF---LQDTTEPERWLPLFEAPRSTAVLDGD---------------ELIGGATICSRRL
D7B5L9_NOCDD      EALNLSAREILDNERDHPTTEHDRTLLAVDGD---------------RVVGTALSHGFEM
E3J0P1_FRAIE      FLGPLPTAESAERAGGDAFAELDRRFGAFADG---------------ELVGCVDSFASWL
V5XGG8_MYCNE      GFPPLN---EQQRVLIGKLLEPGRTLGVFVEG---------------RLAATADSTTSTL
A4FBZ7_SACEN      HRPDAD---DQWESVAGRYE-PGRVLGAFDEG---------------ELAGTTISLASSI
C6WIF3_ACTMD      NGPAND---EMWEVLLESYV-PGRALGVFDGD---------------EVIGSAQSFPSSL
EIS_MYCTU         ASFTDFIGPESATAWRTLVPTDGAVVVRDGAGPGS------------EVVGMALYMDLRL
EIS_MYCBO         ASFTDFIGPESATAWRTLVPTDGAVVVRDGAGPGS------------EVVGMALYMDLRL
A0QY29_MYCS2      FAFGDIEPEQTQAAWRSMVPEDATVVVPDET--DD------------AFVGQSLYLDMQL
A1THZ4_MYCVP      TGFGVWTQQETAEAWRSLIPAGGAVVACDGP----------------DVVGVAVFLDLEL
H6QY22_NOCCG      TCFATRTSAVENEQIPRIFPPEQALVAEVGG----------------RVVGHTQSTTMTL
Q73XI4_MYCPA      RTFGDPVGPQDLEAWKRRVRLDDILIAEDVSDPKNP-----------FLVGTSIIYPAQL
T2GVQ4_MYCHT      GAYGVSVDPADVEAWKRRVDLEDILVAEDVSDPARP-----------TVVGTSLCYKLRL
D5UTW6_TSUPD      RSFGSPFEAEAADILRRTLDLDRFVVARDTEDGA--------------LAGVAGSFALTL
E4N4T8_KITSK      AAWHGGPEPWPPRRRPATDEQLDEWARKDVGGGLFHP---VAAFADGVCVGGSAMLSYRV
D1BAK7_SANKS      LEYLVEQTVADDATLVAAYPDGEETLDGERRP-----------------VGTCTTMAGTI
E8NBL2_MICTS      RGFLGEEPSADEVESARRALTPRRLTGVFDRAGIDPD----------SPVATVDSWPTEL
                                                                              

B2GGW2_KOCRD      TLGEGRSIPAWLISEVTVRPTHARRGLLRRLMTQDLTEAHEA-GFPLAALTASEATIYGR
M7ML20_9MICC      NLG-AKLLPAHLITMVTVRPTHRRRGILRKLLSTDLSEAKDA-GFALAVLTATEATIYGR
A1R6E8_PAEAT      NIGFGRQLEAHLVTAVTVRGTHRRNGILRGMITADLEAAKDD-GLAMAALTASEASIYGR
Y4024_STRAW       TAVGGASVPADAISNVTVTATHRRRGLLTRMMAQDLAAAKER-GDVVATLIAAEYPIYGR
Y4186_STRCO       TAVGGGLVRADAVSNVTVTATHRRRGLLTRMMAQDLAAAKER-GDVVATLIAAEYRIYGR
Y3976_STRGG       TVVGGATVAADAISGVTVTPTHRRRGLLSRMMATDLAAAKER-GEPVASLIAAEYPIYGR
C7QCZ0_CATAD      AVPGGAAVPVGAVTAVTVAPTHRRRGILTAMAATAFRQSADA-GEPLSILIPAEWPIYGR
D5UCG0_CELFN      MPVPGGAVPCAGLTWVGVRPDHRRRGLLTSMIGTHVERSLGR-GEPVSALFAAEAGIYGR
F8A0K6_CELGA      LPVPGGEVACAGLTWVGVRPDERRRGLLTSMIDFHFARSLER-GEAVSALFAAEMPIYGR
D1BJV2_SANKS      FPVPGAEIPVSGLTWVGVHPQHRRRGILSAMIDQHFADCLER-GESVSALTAAEAGIYGR
C7R2Y3_JONDD      FPTPGGDIRAGGLTWVGVQPQYRRRGILRAMIAEHFRLSTQA-GEAISVLFAAEPTIYGR
A1SJ53_NOCSJ      PDAGARQVPCAGLTWVGVHPDHRRRGVLTAMLRHHFEQVRAE-GLHLSALHASEPAIYGR
Y5428_STRAW       TVPGGASVPAAGITMVSVAATHRRRGVLTAMMRRQLDDIRSW-GEPLAVLTASEPAIYGR
Y2625_STRCO       TVPGGAQVRAAGVTMVSVAATHRRRGVLTSMMRRQLDDVRAW-GEPLAVLTASEPAIYGR
H2K8V1_STRHJ      TVPGGAVVPTAGMTMVSVSATHRRRGVLTSMMRRLLDDARAK-GEPLAALFASEPAIYGR
D7C3J1_STRBB      SVPGGAVVPAAGVTTVGVQPTHRRRGLLRAMMRRLLDDVRAA-GEPLAVLTASEPQIYGR
C7Q3R2_CATAD      TVPGGAAVDAAGVSVITVKATHRRRGILTAMMRHQMDGWHERRDASVAVLQASEPAIYGR
I0GZZ6_ACTM4      TVPGA-VVPAAHVSGVGVLPTHRRRGILTRLMQRQLREIAEAGREPIAVLWASETKIYPR
A0LTW9_ACIC1      SVPGR-VVPVAGVTFVSVAASHRRRGLLTRLMRHQLHGLHADGREPIAALWASESSIYRR
C6WQ48_ACTMD      TLPGAGQHPVAAVTGVAVKPGHRRRGVLTELMRVQLHGLREGGREAIAALWASEAGIYGR
D7B5L9_NOCDD      TMPGG-PRRVAGVSGVGVWPTYRRRGVLSALMRRQLAEVRDR-GENLAALWASEGGIYAR
E3J0P1_FRAIE      TVPGGRRVPHAAVTGVGVLATHTRRGLLTGLMRAQLEDAAGR-GDVVATLRASEATIYER
V5XGG8_MYCNE      TLPGGARVGHAAVTHVGVLPSYTRRGIATALLRHQLRDIADR-GEVLASLRASEATIYER
A4FBZ7_SACEN      AVPGGAVLPSAAVTGVGVRADRTRRGALRSLMRRQLADVRER-GEPLAMLHASEAVIYER
C6WIF3_ACTMD      VVPGGAVLPMGAVSRVGVRADWTRRGVVSALMRTQLRSLRDM-GDVAATLRATEGGIYGR
EIS_MYCTU         TVPGEVVLPTAGLSFVAVAPTHRRRGLLRAMCAELHRRIADS-GYPVAALHASEGGIYGR
EIS_MYCBO         AVPGEVVLPTAGLSFVAVAPTHRRRGLLRAMCAELHRRIADS-GYPVAALHASEGGIYGR
A0QY29_MYCS2      TVPGGEVLPVAGISFVAVAPTHRRRGVLRAMYTELHDRIARA-GYPLAVLTASEGGIYGR
A1THZ4_MYCVP      TVPGGAVLPMAGVSWVAVAPTHRRRGALSGMFAELHRRMDR---YPIAGLEASEAEIYGR
H6QY22_NOCCG      TVPGGREVDVTGIAGVAVAPTHRRRGILRAMYTEQHRRTEAA-GLPLTIFTASEGSIYGR
Q73XI4_MYCPA      TVPGGTNLRAAWLTMIAVASTHQGKGLWAQLSAKGLGILLDR-GYPIVCGVPTQTAMYDG
T2GVQ4_MYCHT      TVPGGATLKAAWLAMIAVAATHLGRGVWQQLSIRGFGILQER-NYPILCGVPTQPTVYEI
D5UTW6_TSUPD      TVPGGAQLAAPGVTWVSVAPSHRRLGVLRMMLDELHERYAAE-GAAVAILTASEGTIYER
E4N4T8_KITSK      TVPGGGTVGMGGVTSTAVVATHRRRGLLRRMMRAMFDAALER-GELLAMLSASEGGIYGR
D1BAK7_SANKS      NLGAG-LLPATLFTSATVRPTHRRRGLLRRMVEDALVRTSGA-GHSMVLLTATEGSIYER
E8NBL2_MICTS      TVSPGRTIPLWSISAVTVAPTHRRRGIARAMLTGELRTAAAA-GFALAGLTVTEATIYGR
                              .:   *       *    :                     ::  :*  

B2GGW2_KOCRD      FGFGAATFNAEITVDAHTRLQLKAPTV------------GSVEMADNLA----VARLAPE
M7ML20_9MICC      FGFGRATEQQVLELDVRGAVDFHAAAT------------GSVVQLVPAK----LADIAPE
A1R6E8_PAEAT      FGFGVATFERSIKVDTGPRFRLRGLPQ------------GTVEVADPSV----LLDVAPQ
Y4024_STRAW       YGFGAATHSTEWTIDVPRTGLDPRWSG--------PGDGGRIDLVDGED----VRKAGPE
Y4186_STRCO       YGFGPATSMTEWAVDVPRAGLDPRWAA--------PEDGGRIDLVDGAD----VRRLGPE
Y3976_STRGG       YGFGPAAWTSVWEVSVYRAGLDARRSGQ-------PADGGRIEMVDGAD----VRKLGPE
C7QCZ0_CATAD      FGYGHATDEACYTFQTDRCAPVRPLPG-------------TVELAPAEE----WIPEAEA
D5UCG0_CELFN      FGYGSASDEVRLTLRRRAALRPVAGS-------------DALTVRVRRATPE-DVALAAE
F8A0K6_CELGA      FGYGSVADDVRLKIPRGARLRDVPGS-------------AELTVRFDTADADRHTDLVHT
D1BJV2_SANKS      FGYGPAAHDLRLTVPRGAALRPVPGS-------------EDLTVRIETLDPAVHGDVVHD
C7R2Y3_JONDD      FGYGAAAFDVRCTFGRGAALRPLTPTTPTSLQEHASSTHEPLTIRIETYDPTQHTQLIET
A1SJ53_NOCSJ      HGYGLASLELEVRLGRGTALSAPGLEAPA----------AALTTRMVPASEPDVPARLRA
Y5428_STRAW       FGYGIGTHQLTADVDTSRVRLSVPPGTD----------DVRLRYAVPAD----VLDVCEA
Y2625_STRCO       FGYGAATFSLSAEIDTSRVRLSVPAGTD----------DVRLRYAAPAD----VLDACEA
H2K8V1_STRHJ      FGYGAATLQLIAEIDTGRVTLAVPEGTD----------ERRVRYAAPAD----VLAECEA
D7C3J1_STRBB      FGFGAATRAALAEIDTARVGLTVPEGAD----------EVRLQAVDPEA----ALNTCEA
C7Q3R2_CATAD      FGYGLGTQQLALTIPRGAEALAAVPGSE----------KFRLRMTDPLQ----AYDRCQE
I0GZZ6_ACTM4      FGYGPACSRLTMSIMNREVRLPAPPAAP----------SGRLRMAEPKE----LLAVITK
A0LTW9_ACIC1      FGYGPASQTVSVEIRRDARAIDDDRVAQ----------RADFRLSLRDEPAETVLPEIAA
C6WQ48_ACTMD      FGYGHAADFQALSLPRGAAFAPHVGVGD----------ARVRELPRAEA-----MPFMVE
D7B5L9_NOCDD      FGYGLAFRETNATLQRAHARLRPDAPRDP---------SLTLELAETAE----IRQEVER
E3J0P1_FRAIE      FGYGVATQVGRLEVTRSRVRWRPSAPAG-----------GPVRLVDPLD----GWDLFAR
V5XGG8_MYCNE      FGYSVATTTATIEVRTARAALRPGVTVG-----------GPVRLVEPGR----EWDILPR
A4FBZ7_SACEN      FGYGVATRSRTVSLDRFRSVLRPEAPTG-----------GRVRMVDAES----AAKLLPE
C6WIF3_ACTMD      FGYGVATRGRDLRVSRVKAVPRARVEGR-----------VRVRPVSEVG----DGEELRA
EIS_MYCTU         FGYGPATTLHELTVDRRFARFHADAPGGGL-------GGSSVRLVRPTE----HRGEFEA
EIS_MYCBO         FGYGPATTLHELTVDRRFARFHADAPGGGL-------GGSSVRLVRPTE----HRGEFEA
A0QY29_MYCS2      FGYGVATIEQHVSVDRRLAQFHPAAPDP---------GG--VRMLVPAD----HRDGLAD
A1THZ4_MYCVP      FGYGPATIWQRLSVDRVAARFHPGVPDP---------GG--VRVVRAAE----HRGQIED
H6QY22_NOCCG      FGYGPTVVEKAIRVDRRRAAFLPMVPDP---------GG--VELIPLRA----AQERIRD
Q73XI4_MYCPA      FGAGVSSYSHTYAIDRRFAKLRDT-PGDD-----------RAREVNAAT----ARRHLPG
T2GVQ4_MYCHT      LGAGVASYARTYNIEPRFTDLRAK-PERN-----------RARVVEADE----ARGLLPD
D5UTW6_TSUPD      FGYGTASFVDEVTIDRRTARLRAPAPGPT-----------RTRALEAGA----AKARIED
E4N4T8_KITSK      FGFSPATHRTRWELARHQGGLRPAAPDP-----------GSLELVDAAG----AQAAWPI
D1BAK7_SANKS      FGFGAAVWRSTLTVDTRGGLPLRSRGSG------------QVQQVGTEW----LVGQAPA
E8NBL2_MICTS      WGFSPAVWASDVVVDTRRARWTGPVAPG------------RLDFVSPES----LPERLSR
                   * .         .                                              

B2GGW2_KOCRD      IFERFHRS------------------TAGSLTRTVKWWDYVSGQWNWHKGAAEPEVRTAV
M7ML20_9MICC      LFARFHES------------------QRGSIGRQESYTRMATGAWGDEQPEPDPKLRAAV
A1R6E8_PAEAT      VFERLQRL------------------SPGSIDRQEYYRLVASGSIGHD-GKPDTSVRCAL
Y4024_STRAW       LHERLRRT------------------QPGAVSRDERWWQVHTGVVRLDR-SPWTEPFYAV
Y4186_STRCO       LHERLRRA------------------QPGAVSRTELWWRYRTGVIDWNG-SPWTEPCYAL
Y3976_STRGG       VHGALAAR------------------QPGVVTRDERWWRQRTGAAPSSAHEKWTEPFYVV
C7QCZ0_CATAD      VYGRLRAT------------------TPGAIERSAMWWRRETGLETRDGKPTDKEWLYAL
D5UCG0_CELFN      LDARAAAG------------------RPGWMPRATPPLQARMVADPPAWRNGGEPLVIVT
F8A0K6_CELGA      IHTAGGAG------------------RPGWMPRSSDAMRRGRVVDPPAWRDGGESLRIVT
D1BJV2_SANKS      LHLQAGRQPTAAAGIN----------RPGWATRETDELKTVFLDDPEALRNGREARRIVI
C7R2Y3_JONDD      VHKAAGRNVGGTGLN-----------RPGWVTRDTPALVAAHH-HTISLTPGKEPQRIIV
A1SJ53_NOCSJ      CHLAHAEL--------------------GTVVGEPGYYHQVCLQLPEHLR-GKEPWRVLF
Y5428_STRAW       VYARLVPG------------------RPGMPAR-RPGWDRLMVLDPESRRDGASPLQCVV
Y2625_STRCO       VYARLVPG------------------RPGMLAR-RPGWERLALLDPESGRDGASPLQCVV
H2K8V1_STRHJ      VYAALVPR------------------RPGMLAR-QPGWERAALLDPESEREGASALQCVV
D7C3J1_STRBB      IYARRVTA------------------RPGMLER-RPGWERRPLLDPPSERGGASPLRCVL
C7Q3R2_CATAD      VHEAILLS------------------RPGMLPRVGDGWRDAALADHEFAREGAGPLRCVL
I0GZZ6_ACTM4      LYEQLRPA------------------KVGWSSRDDRWWRHVLSDLK-EKRDGATPLRAVV
A0LTW9_ACIC1      IHAAHLPD------------------APGEFARDNRWWQYRLSEATVERRSGWTPLSAVV
C6WQ48_ACTMD      LRQELAPR------------------RTGWLSRSAANWQIHFADEP-SDRDGLSAYRYAV
D7B5L9_NOCDD      VYREALPQ------------------RAGQLARDEHWWSLILQDKE---AGGPGRLRAAL
E3J0P1_FRAIE      IHEEAAHQ-------------------PGAIGRSRGWWNRRLRWAR-----EATTAQLAV
V5XGG8_MYCNE      IYAAHRGVR------------------PGSIDRDPHWWLNQQLRAE-----GTAGARFVA
A4FBZ7_SACEN      IYRRIGLC------------------RTGMISRSDGWWTSWLAALR-----DNT-VAAVH
C6WIF3_ACTMD      LFEEIRGGGRGGGSGEGRGEGRGEGGRPGVIGRWDGWWSMHLKREK-----EKD-PQVVV
EIS_MYCTU         IYERWRQQ------------------VPGGLLRPQVLWDELLAECKAAPGGDRESFALLH
EIS_MYCBO         IYERWRQQ------------------VPGGLLRPQVLWDELLAECKAAPGGDRESFALLH
A0QY29_MYCS2      IYDRWRRR------------------TPGGLVRPDALWDDLLADRPESRRGGGELFAFGH
A1THZ4_MYCVP      VYERWRLQ------------------TPGGLHTPQVLWDEVFADRESHRDGGSAQFCLLH
H6QY22_NOCCG      VYDRWRRL------------------VPGAQVRPDGAWAIRFADPERFRGGGTDLFSLVH
Q73XI4_MYCPA      LYERWCAV------------------TPGAVTRDKAWWADHLEDRTTQRGNGSALHYTIH
T2GVQ4_MYCHT      LYDRWCAV------------------TPGALSRSRAWWADVLEDRVTQRDNGSTLNYVVH
D5UTW6_TSUPD      LYRRWHAT------------------TPGSVS-AEQFWELFHADPEWARWGGSARRYLVH
E4N4T8_KITSK      VHALVRAGRAG---------------RAGELTPLPGHWERLSDEPN----GTDGPPRHLV
D1BAK7_SANKS      VFDRFHEG------------------ALGSVSRRAAYTDRVARENDSDR--FDRAVRGLA
E8NBL2_MICTS      VHERVRVE------------------RPGAVPGWEGRWRGVAGLTPDAK--DAKKVRAVS
                                              *                               

B2GGW2_KOCRD      HYDQQGEPDGYVSYK-----FLPTQGYEGTLEVVDLVGANPRARIALWEFLCNLDLVTEV
M7ML20_9MICC      YLDAHGVIQGYVTHA-----FAGWESTPPTLKVRDLVAATAQARRELLRFLANLDLVERV
A1R6E8_PAEAT      HYDLSGSLDGYVSYR-----FKGWDHKPYTMEIVDLVAASNAAYLDLWRFLGSIDLIDEV
Y4024_STRAW       YRSASGEVEGLVSYECDDH-WGDAKQPQNTAKVNWLIATTPAAERALWHYLCSIDWITKV
Y4186_STRCO       YRSADGEVEGMASYRTDDR-WGDAKQPLNTATVDWLLAVTPAAERALWHYLCSIDWVQTV
Y3976_STRGG       HRAADGTVDGLMTYGTDDT-WGDAKQPLNTASVRDMIALNPAAERALWHYLCSIDWITTI
C7QCZ0_CATAD      YRDDAGTARGAAYYKPEEG-TWEGLVPDDTAEA-YMIAEDYVARVRLLQFLWEQDWLATF
D5UCG0_CELFN      VHDGD-DVRGLALFRRKEA-WGDGG-AEYTAAVRQASAVDAAATHRLWSFLLDLDLTTSV
F8A0K6_CELGA      VHDAAGEPRAYALLRRKET-WADPG-ARYPVHVREAVALDAAAAHRLWSFVLDLDLTVEV
D1BJV2_SANKS      VESDG-EPRGYTTFRRKVD-WSHTG-PRGTVSTGEVVALDPAATHRLWSTILDLDLTHEV
C7R2Y3_JONDD      VERNG-TPVGYTRFRRTMS-WQNTG-PQGRVDAGEVVALDPAASHTLWTTLLDLDLTSEV
A1SJ53_NOCSJ      ALRDG-VDVGFAAFRRTEK-WEKAR-PAGEVEVWTVVG-EPAARLALLRRLVDLDLIATV
Y5428_STRAW       AE-RDGETVGYTRFRVKPD-WEPSG-PKGTVVLQDLEALDPAAHAALWRFLFDIDLTSHL
Y2625_STRCO       AR-RGGEVTGFARFRVRPA-WGPEG-AGGTVVLDDLAGLDPATEAALWRFLYDVDLTSRL
H2K8V1_STRHJ      AE-QDGEITGYARFRTKMG-WGRSG-HDGTVTLEDLAALDPASEAALWHFLFGIDLMTTL
D7C3J1_STRBB      AE-RDGEVTGYVRFAVNPE-WDLAV-PKGVVIVRDLEALDPASCGALWRFLFDIDLTCKI
C7Q3R2_CATAD      AEDASGTTVGFARYRVKDD-HDIPGRPSGKVRVQEVYGRDLASYAAMWRFLLEIDLVSEV
I0GZZ6_ACTM4      HEGPGGP-TGYALWRVKDD-WNAYG-PNGDVQVREVVAEDPETYQALWRFLLGVDLSRTV
A0LTW9_ACIC1      IPD-----TGYALYRTKSE-WSDGV-AAGEVEILEIVAAEPTAQLVLWDYLLRRDLMATW
C6WQ48_ACTMD      HPD------GYAVYRVKHD-WGHSG-PRHEAHVRELVARTDEAYAALYRYLLDLDMVGSV
D7B5L9_NOCDD      VRGPDGP-LGYALYRVVNR-WEDGL-ASGRVVVRELASVSTAARVALYEHLLDRDLTSEA
E3J0P1_FRAIE      VHGEPGAEDGFALYEPVRT-PDWHVDGHRVVQVTDFVAGTPAARAGLLRHLTGLDFVDRI
V5XGG8_MYCNE      VHGPAGEETGFVRYHPVGT-DTWFTSDQRTVVVDDLFAPTEQAYVGLVRFLLDLDLVDRL
A4FBZ7_SACEN      SDD-DGVDDGFVLYEAKVN-DHRFDDGVITLQVLDLHGAEPAAVAGLWGFLLGLDLSNRI
C6WIF3_ACTMD      ATGPDGVDDGFAMYRVERS-HTEKSE----LTVLDLWAGTPRAWADLWRYLLGVDLVDEV
EIS_MYCTU         PD-------GYALYRVDR-------TDLKLARVSELRAVTADAHCALWRALIGLDSMERI
EIS_MYCBO         PD-------GYALYRVDR-------TDLKLARVSELRAVTADAHCALWRALIGLDSMERI
A0QY29_MYCS2      QD-------GYALYRVDRGP-----DGRRSAHVVELTAVTADAHAALWRALLGLDLIDRV
A1THZ4_MYCVP      AD-------GFAMYRVHSA------DKKDRVEVSKLAAVTPHAYIALWRALLGLDLMATV
H6QY22_NOCCG      PD-------GYALYRYRHG------ADGSVVEVSELRAITTDAHAALWRVLLGLDLIDRI
Q73XI4_MYCPA      PD-------GFLTYRVVGSRQHAFRPPLGTVVVEDFCPITDEAHTELLQTLLVLEMFYRV
T2GVQ4_MYCHT      PD-------GFMTYRVIGASPHAFRRPFGNLIVQDFCPITPEAHTDLLATLLSLKMFDNS
D5UTW6_TSUPD      PD-------GFVTYRVDEK---------DRAELRDVKALTDAAAADLWQTVLGLDIFDHV
E4N4T8_KITSK      HRDRHGAVDGAARFRLPWS---PTAAHAGTLVVEALEAANPAAYRALWALLLDFDLTRTV
D1BAK7_SANKS      HVGDSGEVDGFAFYRSLEG--------TATVEVLDLVAATDDAYLALWSTLGGLDLVDTV
E8NBL2_MICTS      YRDTAGEERGILVYTLDSG--PHGDFSPHVLTVRALFADGDEATAALWRFAIEHDLVGEV
                           .                                :   :       .     

B2GGW2_KOCRD      RYGSAPIEDPLMWGMVDMSAYTVHKRSDRVWLRILDPVAALSARGYT-----------AH
M7ML20_9MICC      TVPMVAANDPLTWALVDPSRISYTQRQHGLWVRVLDVVAAFEAREYR-----------GS
A1R6E8_PAEAT      TWVEAPVDDPLAWALEDPRCIEASEIRDMLWLRILDTPAALQARSFP-----------VA
Y4024_STRAW       RTGWRAPDDLLPHFLPDPRAARVTTHADWLWVRILDVVRALEARTYD-----------GS
Y4186_STRCO       KSGWRSPDDLLPHLLPDPRAARITTQADWLWVRILDVARALEARTYE-----------GQ
Y3976_STRGG       RSGYRAPDDLLPLLLPDPRAARMITNADWLWLRMLDVPRALEARTYG-----------TE
C7QCZ0_CATAD      TVDKCPVDDTWRHLMADPRRARQKQRYDVLWVRVLDTVAALQARTYE-----------GE
D5UCG0_CELFN      ETPALPVDDALLQLLVDLR-PTRRRVGDNLWVRVLDLPAALTARRYA-----------RP
F8A0K6_CELGA      NTGMLPADDELLHLLVDAR-GAVPRFSDNLWVRLLDVPTALEARRYS-----------SA
D1BJV2_SANKS      EPLMIPVDDAITSLLVDPR-AAAPRIADNVWVRLVDVPGALAARRYT-----------SD
C7R2Y3_JONDD      TAFMLPTDDPIITQLNNNR-SIGMTVVDNVWVRILDLPAALSARQYS-----------GS
A1SJ53_NOCSJ      KVGSVGVEDPLLSWLGGPRSAADVGTYDGLWVRLVDLPAALQARGWS-----------AA
Y5428_STRAW       NARNRPLDEAWLHLVSDIR-RCNLRKRDSLHVRLVDVGAALEARTYQ-----------AP
Y2625_STRCO       AVRGRPVDEAWQYQVSDIR-RCRPESRDALYVRLVDVGAALAARTYQ-----------AP
H2K8V1_STRHJ      KVRARPVDDAWQYLVSDIR-RCLPQTRDAGYVRLVDVGAALSARTYL-----------TP
D7C3J1_STRBB      RIGRRPVDDPWQHMVSDIR-RCQILLRDELYVRPVDVGAALEARTYA-----------LP
C7Q3R2_CATAD      RA-AVPTDDPLMFLLADTR-QVVPRLEDSMYVRLVDVDRALAARRYA-----------TA
I0GZZ6_ACTM4      TYRLGALDEPLQYLVDEPR-RLGASVGDGLWIRLVDLPAALAARRYA-----------AD
A0LTW9_ACIC1      RAWL-AIDDPILLAAADSR-RLHARLADNLWVRIVDVDRALAARRYS-----------VD
C6WQ48_ACTMD      EQYA-GSGEPVTRLLADPR-AASRRLVDSLWVRLVDVERALPLRRYA-----------VD
D7B5L9_NOCDD      VFEKLPGDDPLTVLLADPR-RLVRRDFDALWMRLVDLPGSLSDRPYA-----------TP
E3J0P1_FRAIE      EFLEMSLDDPLPAALTDARAVRLTSAEDETWLRLLDVPVALAARTYS-----------GP
V5XGG8_MYCNE      VFTQAPVDSPLPWLLRDRRAARITGVHDETWLRVVDVAQALSRRTYA-----------GT
A4FBZ7_SACEN      VAINRPVDELLEWWLTDRRQCRVTSVGDDLWLRLVDVPAALSARTY-----------GQA
C6WIF3_ACTMD      VAHLRPLDEPVELLLVDPRGCRWESTSDETWLRLIDVEEALGRREYAAGVGVGVGGGGDE
EIS_MYCTU         SIITHPQDP-LPHLLTDTRLARTTWRQDGLWLRIMNVPAALEARGYA-----------HE
EIS_MYCBO         SIITHPQDP-LPHLLTDTRLARTTWRQDGLWLRIMNVPAALEARGYA-----------HE
A0QY29_MYCS2      SIGTHPHDP-LPYLLTDPRQAQVTASADDLWIRIMNVPAALEARRYQ-----------AD
A1THZ4_MYCVP      DIDTHPDNT-LPYLLTDPRLVRHPGRQDGLWLRMLDIPAVLQARSYA-----------AD
H6QY22_NOCCG      EAVVTDDDP-LPYLLTDPRQVRTTGRFDGLWLRLMDIPAALTARAYA-----------AD
Q73XI4_MYCPA      EIDVPPDDP-LPLKLVDQRAAETKGISDFLWVRINDVPEVLGARGYA-----------AD
T2GVQ4_MYCHT      VIETPVDDP-LPLKLKDQLAAQTTKVNDFLWMRIMNVPEVLPKRAYR-----------AD
D5UTW6_TSUPD      TADLPADHP-LREMLVDSRSVKTTARKDELWLKFIDLPAALEARTYD-----------RD
E4N4T8_KITSK      VAPGRPRDEPLRWMLADPRAMRVTRQSDNLWARLLDVPAALSRRAYG-----------GA
D1BAK7_SANKS      TFPRASADEVLRHAVSDPRRVSTTLVQDELWVRVVDPAAALAQRAYMP---------GLD
E8NBL2_MICTS      KASLQPTTPPVQWMIADRRAVTVTPT-DHHWLRVLDVPAALSARRYA-----------RA
                                             .    :  :    :  * :              

B2GGW2_KOCRD      RRMTLSVVDSLG-FADGIYAIDTTGAQPRVERVADRPRTDDYRADSSLPAVELPEGVDAA
M7ML20_9MICC      GTFTLQVQDPLS-LVAGTYRFTLTEGTASIGLLEN------------------PEPADAS
A1R6E8_PAEAT      GRLVLEVTDSLG-LAGGTWVLESDGGAAAVVKEAA------------------GETPDLS
Y4024_STRAW       GTLVLDVVDRHG-LAGGRYRLTVGPDGAVCEPTTR--------------------DAGLT
Y4186_STRCO       GSVVLEVVDRGG-LTGGRWRLEAGPDGASCAPTTE--------------------SAHFV
Y3976_STRGG       ASLVLEVRDDAG-LAGGRFLLDASTGGARCVSTTR--------------------SADLV
C7QCZ0_CATAD      GRLVLAVTDPAG-YAEGVYALEGGPAGASVRRTTQ--------------------TPDLT
D5UCG0_CELFN      ADLVLDVTDALLPANAGRWRLT---VDATG----------------TAEVSRTDAAADVA
F8A0K6_CELGA      LDVVLEVTDARLPQNAGRWRLTTGDADASGF---------------TARVTSTDDEPDLR
D1BJV2_SANKS      LDVVLHVTDARLPANQGSWRLT---ATAFG----------------KATVTRTDDAPDLS
C7R2Y3_JONDD      IDLVLEVTDDMLPHNAGCWRVR---AQPFGGPHGHD----------APRVERTDAPADVT
A1SJ53_NOCSJ      CDVVVEVTDTAAPWNEGRWRIR---ADASG----------------EAVVERASGDPDLR
Y5428_STRAW       VDVVFEVEDAFCPWNEGRWRLTG---DGKG-----------------ATCVRTRDSVDLA
Y2625_STRCO       VDVVFEVEDAFCPWNAGRWRLSG---DAKG-----------------ASCERTSDGADLA
H2K8V1_STRHJ      VDVVFEVEDAFCPWNAGRWRLTG---DPKG-----------------ASCERTADAADLA
D7C3J1_STRBB      VDVVLEVTDAFCPWNEGRWRLTG---DAKG-----------------ASCERTSDEPGLR
C7Q3R2_CATAD      VDVVFEVSDAFCPWNTGRWRLSG---DADG-----------------AVCERTTAPADLV
I0GZZ6_ACTM4      VDVVIEVADPLLEQNTGRWRLVG---GPTG-----------------AICSRTTDPADLS
A0LTW9_ACIC1      IDLVLEVADEFCPWNNGRWRLIG---GPDG-----------------ASCEPTRQSAHLA
C6WQ48_ACTMD      VDVVLEVVDGFCPWNAGRWRFAV---RDGV-----------------ASVARTEADAEVV
D7B5L9_NOCDD      VDTVLEVADRYAPWNAGRWRLEA---DTGG-----------------ARVRPTDAAPDLA
E3J0P1_FRAIE      GRVTVEVDDPLLPANSGVYEISA---AGAAR-------------------VSTSAPADLR
V5XGG8_MYCNE      RPVTLRVEDPLLTENCATYAISA---DGVQ---------------------TTSAPAQLV
A4FBZ7_SACEN      DPVVLEVRDAFLPENSGQYRIAP---GEVR---------------------LCGDRPQLS
C6WIF3_ACTMD      LAVVLGVRDSLLPENAGSYRVSR---GGVE---------------------RVEDAPEVV
EIS_MYCTU         VGEFSTVLE--V-SDGGRFALKIGDGRARCT--------------------PTDAAAEIE
EIS_MYCBO         VGEFSTVLE--V-SDGGRFALKIGDGRARCT--------------------PTDAAAEIE
A0QY29_MYCS2      LDVVLDVADGFR-SDGGRFALQISGGRARCT--------------------TTDAPADIE
A1THZ4_MYCVP      LSVVLEVSDDIL-GGGGRFALQVRDGRARCA--------------------PTDAEADVH
H6QY22_NOCCG      LDVVLAVHDPFR-EAGGTFALRVRDGVAECA--------------------PTDRDADLE
Q73XI4_MYCPA      TDIVLDVTDPLG-LAGGRFQLQTRDGAGKCT--------------------PHDGPADLE
T2GVQ4_MYCHT      ADLVLDVTDPLG-VAGGRFLLRIRDGVGTCT--------------------PHDGPADIK
D5UTW6_TSUPD      GDLVLAVD-------GAGYRLRIADGVARCS--------------------PSDAEPVAR
E4N4T8_KITSK      DELVFGIDDDLMCPANNRTWLLRTDGVETVC-------------------VATDRAAELT
D1BAK7_SANKS      ESLVLRVYDPLG-HAAGDLRLRVADGVAVVEPVVVDG------AENRAEDGHVDEDWDLS
E8NBL2_MICTS      LDVVLRVEDPLG-FADGAWNVRIDVDGSAVVERAP-----------------EDRAVDLE
                        :             .                                       

B2GGW2_KOCRD      LTVDLLGSLYLGAVKASTLHDAGLLRVRDEAA-----LRDLQDLMSTPAEPYCISPF
M7ML20_9MICC      CEVTALGPLLLGACTVRDLVVAGLLKPASPAA-----SATLGSLLDLPGLPHAINGF
A1R6E8_PAEAT      LDAADLGSIYLGAVSPVTLAAAGRIQEKTPGA-----ALLAQQLFAVERSAHCLTHF
Y4024_STRAW       LDVGELAALWLGDASAVRLAALGRVREQQEGA-----ASVADALLRTSGRPWCPDMF
Y4186_STRCO       LDVGDLAALWLGDESAVRLAALGRVREERAGA-----ARVVDALLRTSRRPWCPDMF
Y3976_STRGG       LGVAELATLYLGDESVRRLVDLGRAEESRAGA-----ATTADAVFRTGRRPWCPDVF
C7QCZ0_CATAD      LPVQTLGALYLGNHAATALSRVGEVTEERPGA-----LALADRMFKTAIPPYCVTWF
D5UCG0_CELFN      LDVRELGALYLGGRSARALATAGLAAG-APAE-----LDRLTATFVSPLAPVCPWIF
F8A0K6_CELGA      LDVRELAAAYLGGRSLAAYARAGLVTEVAPGT-----LLRAATAFSWPVAPVCSWVF
D1BJV2_SANKS      LSVAELGTAYLGGTSLAALATAGRVEEHTDGA-----LLRTASAFGWPVAPVCSWIF
C7R2Y3_JONDD      LDIRELSALYLGGVSAASLAAGGLVTADTPQA-----LAQLSSAMAWPLAPCSSWVF
A1SJ53_NOCSJ      LDVAALGSAYLGGGNLLARHRAGLVQEQRPGA-----VRELWRAMRTDLAPTAAVGF
Y5428_STRAW       LSVRDLGAAYLGGVSLVSLGAAGRVRELRPGA-----LTEATSAFSSAIAPWLPHGF
Y2625_STRCO       LSVRELGAAYLGGVRLSSLGAAGRVREVRAGA-----LAEASVGFGSDVAPWLPHGF
H2K8V1_STRHJ      LSVRELGAAYLGGVTLLSLAAAGRVRELRPGA-----LTEASVAFGSPVAPWLPHGF
D7C3J1_STRBB      LDVRELGAAYLGGISLSALAGAGLVQELRQGA-----LAEASAAFRSDVAPWLPHNF
C7Q3R2_CATAD      LGPRELGAAYLGGFSLGALGRAGRIEELRPGA-----LAEASRALVSDVAPWLPFGF
I0GZZ6_ACTM4      CTVTDLGAAYLGATSLASLTAAGRVRQLTGN--------DPSIAFGWHRKPSPTEIF
A0LTW9_ACIC1      VPAWALGAAYLGTTSLYQLARGGWVSASSSAA-----LAQAASAFRWPAAAHCSLVF
C6WQ48_ACTMD      ASARALGAAFLGGVRLSALGAAQEVREVTPGA-----LSRLTLAFLGVEEPHCAEVF
D7B5L9_NOCDD      LDASHLGAAYLGGRTLTAFADAGLLTEHVPGA-----AARLDTALHAPRASFCGTDF
E3J0P1_FRAIE      TGIAELGAVYLGGTRWWQLASAGRVESRDPA-----AVATADTLFATAALPYAATGF
V5XGG8_MYCNE      ADVAGLGAALLGGTSWRDLASAGLVGVHDPV-----ALAAADELFAVPQAPYAGFIF
A4FBZ7_SACEN      IGVDALASLYLGDVAVSDLVAAGRVAVHDPS-----AVAAADRLFATAETPWCGTSF
C6WIF3_ACTMD      LDVAELAAVYLGDVSFAALAAAGRVEVVGAGVGAVGAVERADRLFAVGEVAWAGTYF
EIS_MYCTU         MDRDVLGSLYLGAHRASTLAAANRLRTKDSQ-----LLRRLDAAFASDVPVQTAFEF
EIS_MYCBO         MDRDVLGSLYLGAHRASTLAAANRLRTKDSQ-----LLRRLDAAFASDVPVQTAFEF
A0QY29_MYCS2      IDLDVLGGLYLGAHRVDGFAAANRLRSKDSE-----LLQQFGAAFAGDMPAELGYGF
A1THZ4_MYCVP      LDLSVLGSLYLGAHRASPFAAAHRLRC-SAE-----RARQLDAAFATDGPAELGYGF
H6QY22_NOCCG      LGIDVLGSMYLGAHPARAFAAANRLRAKDSG-----LVRAMEQAFSADRDAEVGWFF
Q73XI4_MYCPA      IGLADLATVYMGAHRGAQLARAKRITELRQG-----ALGRLDAAFGAERAPFCGTVL
T2GVQ4_MYCHT      IGLGDLGSIYMGAHRAWELHQADRITELRSG-----ALLDLDAAFTTQRAPYCGTLF
D5UTW6_TSUPD      LSGATLAGLYLGATAPSTMAAAGRID----------GDFRALSVFRTERQPELGTSF
E4N4T8_KITSK      LTTPALGSLYFGGASVHDLAYAGRATPHTADA-----LARTARLFRTDTEPHNSFGF
D1BAK7_SANKS      LDVSTLGTLLVGGLSATQLARSARLVARDGAA-----LAQADRVFSIADTLRFYSHF
E8NBL2_MICTS      MTVGALGSLLLGGVRVRDLAAAGLVRGPRESQ------AAVDAAFTPEVTPLLDIWY
                       *.   .*                                :