CLUSTAL format seed alignment for MF_01813

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MENG_CHLCV        ------------------------------------------------------------
S7IKW4_CHLPS      ------------------------------------------------------------
MENG_CHLPN        ------------------------------------------------------------
MENG_CHLMU        ------------------------------------------------------------
MENG_CHLTR        ------------------------------------------------------------
MENG_DEIRA        ----------------------------------------------------MTAENRPP
MENG_THEMA        ------------------------------------------------------------
MENG_BACTN        -------------------------------------------------MDYPQQHIKPY
A8Z662_SULMW      -----------------------------------------------------MIYIKPF
UBIE_CAMJE        -----------------------------------------------------------M
A8Z6H0_CAMC1      -----------------------------------------------------------M
Q7MRM1_WOLSU      -----------------------------------------------------------M
D0K1F4_HELP5      -----------------------------------------------------------M
MENG_CHLTE        --------------------------------------------------MMSSSKETAK
MENG_RHOBA        -----------------------------------MSVPNVDPSHQSNASANEATRPSPA
Q1AUK8_RUBXD      ---------------------------------------------------MSGARGGRL
MENG_COREF        ----------------------------------------------------------MA
MENG_CORGL        ----------------------------------------------------------MA
MENG_MYCTU        ----------------------------------------------------------MS
MENG_MYCLE        ----------------------------------------------------------MS
MENG_STRAW        ----------------------------------------------------------MT
MENG_STRCO        ----------------------------------------------------------MT
MENG_TROWT        ----------------------------------------------------MGTNIHID
C5C7I7_MICLC      -----------------------------------------------MSQNPLPAPRGDA
UBIE_AGRFC        ----------------------------------------MMTDARTTAEGGMETSYGFH
UBIE_RHIME        -----------------------------------------MADERVSARGGMETSFGFR
UBIE_RHILO        -----------------------------------------MSVERTTAAGGMETSYGFK
UBIE_BRUME        ------------------------------MSQQNGNVNRVGAQDRVGASGGMEHSFGFK
UBIE_BRUSU        ------------------------------MSQQNGNVNRVGAQDRVGASGGMEHSFGFK
UBIE_BRADU        -----------------------------------------------MDRPGETTHFGFR
COQ5_HUMAN        ---MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFE
COQ5_PONAB        ---MAAPRSCALWSYCGRGWSWAMRGCQLLGLRSSWPGAPLSARLLPQEKRATETHFGSE
COQ5_BOVIN        ---MAAPRSWALWSFCGCGWSRAVSGCRLPGLRSSSPRGPLGARLLSQEKEATETHFGFE
COQ5_MOUSE        ---MAAPRCCVLWRVCGRGWWRATGHCRLPGCHRSWPWATLGTRSLSQEKRAAETHFGFE
COQ5_RAT          ---MAAPRSCVLWSYCGHGWSRLAGDCRLPGFRRSWLGATLSARSLSQEKRAAETHFGFE
COQ5_CHICK        ---MAA---------------GLCPGRALLSRRGGALWALLGTARGRAA--GPETHFGFQ
COQ5_XENLA        ---------------------MAHMRSVLRGRLCGMREILRCQKASYTEASRKETHFGFQ
COQ5_DANRE        ---MAAPIRAFVLRVLSDSTRNIHHVLRCRSKYLCRRAAITARRGYSDSTEGRSTHFGFQ
COQ5_ARATH        --------------------MALRSVSRRLGS----RILNQRS--FVASLHSHATSFGFQ
COQ5_ORYSJ        --------------------MALRSAAGRLASSSRRRLLSPPTSIHTAFLHSHATSFGYK
UBIE_ZYMMO        ---------------------------------------------------MEKVSFGFS
COQ5_DROME        ---------MQTTRSTRLLSLARRFVHTRTASQSAQNSKGMASGAESISGKEKTTHFGFQ
COQ5_DICDI        ---------MLQSLNRSVRYLSTSIGSRLYCSNTNQTTKNNTNASGVNDNQQ--THFGFK
COQ5_CAEEL        --------------MKGATNLFKSMRKPTNVGNFRQFSVNQVNSDNKRSEPGKKTHFGFT
UBIE_RICCN        ---------------------------------------------------MNQTNFGFK
UBIE_RICPR        ---------------------------------------------------MYNTNFGFK
COQ5_SCHPO        -----MSRLRAPVAKFLADGLKGIRSTALAGSRLSNCRYTSTSSKDTDTSSH-MTHFGFK
COQ5_YEAST        ----MLISSRIVRSSLVNVPLRLSRCFTQAHRACKEEEVNSPLSSAAEQPEQKYTHFGSK
UBIE_CAUVC        -------------------------------------------------MSNTSASFGFK
UBIE_RUBGI        ----------------------------------------------MNEPTPLSRSFGYQ
COQ5_LEIDO        -----------------------------------------------------MLHYTRL
UBIE_ECOLI        -----------------------------MVD---------KSQ--------ETTHFGFQ
UBIE_ECOL6        -----------------------------MVD---------KSQ--------ETTHFGFQ
UBIE_SALTY        -----------------------------MVE---------DSQ--------ETTHFGFQ
UBIE_YERPE        -----------------------------MVD---------QEK--------ETTHFGFR
UBIE_VIBPA        -----------------------------MTDTSLQSNTALEN---------ETTHFGFT
UBIE_VIBVU        -----------------------------MTDISVQSNTALESS--------ETTHFGFT
UBIE_VIBCH        -----------------------------MTDTNVLANSATDNQ--------ETTHFGFE
UBIE_HAEDU        ----------------------------MIKDTQSTAENQAN----------ETTHFGFK
UBIE_PASMU        -----------------------------MTDQHAFATEQVQLDPTLSPTTEETTHFGFK
UBIE_SHEON        -----------------------------MSE---------GES--------KSTHFGYK
UBIE_PSEPK        -----------------------------MNDQR----KGDHAE--------PTTHFGYQ
UBIE_PSEPU        -----------------------------MNDQR----KGDHAE--------PTTHFGYQ
UBIE_PSESM        -----------------------------MNDQR----KGSDAE--------PTTHFGYK
UBIE_PSEAE        -----------------------------MNDPR----KGADAE--------PTTHFGYQ
UBIE_COXBU        -----------------------------MNETE------------------KSTHFGYQ
UBIE_NEIMA        -----------------------------------------MGG--------QKTHFGFS
UBIE_NEIMB        -----------------------------------------MGG--------QKTHFGFS
UBIE_NITEU        ------------------------------------------MT--------NSTHFGFT
UBIE_RALSO        -------------------------------------------M--------SQTHFGFQ
UBIE_XANAC        -----------------------------MSESP-------YTS--------GTTHFGFR
UBIE_XANCP        -----------------------------MSESP-------YTS--------GTTHFGFR
UBIE_XYLFA        -----------------------------MSESS-------EKT--------GTTHFGFR
UBIE_XYLFT        -----------------------------MSESS-------EKT--------STTHFGFR
UBIE_WIGBR        -----------------------------MKIKE------------------KMTDFGFS
MENG_BACAN        ------------------------------------------------------------
MENG_BACCR        ------------------------------------------------------------
MENG_BACSU        ------------------------------------------------------------
MENG_GEOSE        ------------------------------------------------------------
MENG_BACHD        ------------------------------------------------------------
MENG_OCEIH        ------------------------------------------------------------
MENG_LISMO        ------------------------------------------------------------
MENG_STAAM        ------------------------------------------------------------
MENG_STAES        ------------------------------------------------------------
MENG_MICLU        ---------------------------------------------------MRKWCLMSK
MENG_LACLA        --------------------------------------------------------MCYN
MENG_LACPL        ------------------------------------------------------------
MENG_NOSS1        ------------------------------------------------------------
MENG_SYNY3        ---------------------------------------------------------MSN
MENG_ARATH        ------------------------------------MAALLGIVSPVTFTGKHPVNSRSR
MENG_THEEB        ------------------------------------------------------------
A8G3E5_PROM2      ------------------------------------------------------------
A9BE48_PROM4      ------------------------------------------------------------
Q5FR54_GLUOX      MEATVHHPEITAVGLASPWTSDRKSLEAAPAMPHDKKHCELRMTDHRPEKIPPHPVLSAW
A1KCK9_AZOSB      ----------------------------------------MTDPAYSASPLQTDPQLRRY
C5BQ15_TERTT      ----------------MEDRPDRRVHLRVLRAIRAALLECSNMQDGKQSSVAPHPVLSDY
MENG_LEPIN        -------------------------------------------------------MSGFQ
E8T363_THEA1      ------------------------------------------------------------
Q979V1_THEVO      ------------------------------------------------------------
                                                                              

MENG_CHLCV        -MQLSTNKPDLQEMFDSLAPKYDRINSILSLGMHHLWNRKFSKMLGKSEC--------LL
S7IKW4_CHLPS      -------------MFDSLAPKYDKINSILSLGMHHLWNRTFSKMLGKSDH--------LI
MENG_CHLPN        -MEPSTNKPDCKKIFDSIASKYDRTNTILSLGMHHFWNRSLIQILGSGYS--------LL
MENG_CHLMU        -MTNFQDKPNIRIMFDSLAPTYDKINKILSLGLHLTWNHSFVSLLGRSDH--------LL
MENG_CHLTR        -MTDFHNKPNIQIMFDSLAPTYDKINGILSLGLHIAWNNALVSLLGETNH--------LL
MENG_DEIRA        VGDKQDKGQAVQEMFASIAPRYDLLNRVLSLGVDRGWRRAAAAEALAHSP------RRVL
MENG_THEMA        MGGKTKK--HAMRLFDRIAEKYDLLNRILSFGMDTKWRKRVVELILEVNP------EKVL
MENG_BACTN        NED-GKKTEQVERMFDNIAHAYDKLNHTLSLGIDRSWRRKAIAWLRPFRP------QHIM
A8Z662_SULMW      KNSSTSKTDQIEKMFDIISYKYDLINKFISLGNDIKWRKKFSDIIVNYNP------KNVL
UBIE_CAMJE        QK-----QEKIIEMFNQIAPTYDKANRILSFGADVAWRKKACQRVMSLYL---KKDLKIA
A8Z6H0_CAMC1      QK-----QEKIVDMFNQIAPTYDVANRVLSLGVDVSWRKFACRYMLEIFK---NKSINIV
Q7MRM1_WOLSU      NK-----QETIVKMFDEIAQSYDLANRVLSFGIDVSWRKKACSLSFEHLG---KKSVRIL
D0K1F4_HELP5      KKEKHFKQEKIINMFDDIASSYDQANRLMSFGLDVKWRERACEHAFLFLEN--KKALRLV
MENG_CHLTE        SLIQTKSRSSIRNMFDEVAPTYDFLNHLLSLGIDNYWRVVAAKKARKQLEG--EREPKIL
MENG_RHOBA        AEGLDKSGERVREMFRQIAPRYDVMNHLLSLNIDKWWRRKAVQTLKIKG------DDPIL
Q1AUK8_RUBXD      PAGEER-ARLVREMFDRIAGRYELLNALMTAGLYRRWNAAAVRASAVRP------GDRVI
MENG_COREF        KASLDKDPFDVASMFDDVGDKYDLTNTVLSFGQDRVWRRRTRERLDLKP------GEKVL
MENG_CORGL        KADLDKDPFDVASMFDDVGKNYDLTNTVLSFGQDRVWRKRTRQRLDLKP------GEKVL
MENG_MYCTU        RAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGP------GQKVL
MENG_MYCLE        RAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIGP------GQKVL
MENG_STRAW        RASLDKQPHEVASMFDDVAERYDLTNDLLSLGQDRVWRREVAKAVDARP------AQKIL
MENG_STRCO        RASLNKQPHEVASMFDHVAERYDLTNAVLSLGQDRAWRKAVARAVDARP------AQKVL
MENG_TROWT        MVIHGKHTAEIRKMFNRVAQAYDRTNLVLSFLQDAHWRRAACKMLGVTA------GEEVL
C5C7I7_MICLC      QRGAADHHDRVSAMFDAIAGRYDLMNAVMTWGQEPRLVRHTVARANIPA------QARVL
UBIE_AGRFC        KVDEGKKQGLVNEVFHKVAKRYDIMNDVMSAGLHRLWKDAMVSALSPRK----DPSYKIL
UBIE_RHIME        EVGTGEKQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAMIAALNPPG----REDYRVL
UBIE_RHILO        RVGEGEKQSLVNDVFHKVANRYDLMNDLMSAGLHRLWKDAMVTWLNPPK----RPGWKVL
UBIE_BRUME        AVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLAPSK----RPGWTSL
UBIE_BRUSU        AVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLTPSK----RPGWTSL
UBIE_BRADU        DVPLGDKQTLVNDVFHSVASRYDLMNDLMSGGLHRVWKDIMINALDPPRG---DRPFALL
COQ5_HUMAN        TVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLP------GTQLL
COQ5_PONAB        TVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPLP------GTQLL
COQ5_BOVIN        TVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPFP------GTQLL
COQ5_MOUSE        TVSEGEKGSKVYQVFENVAKKYDLMNDMMSLGIHRAWKDLLIRKMHPLP------GTQLL
COQ5_RAT          TVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGIHRAWKDLLIRKMHPLP------GTQLL
COQ5_CHICK        NVSEAERREKIYQVFENVAEKYDVMNDSMSLGIHRVWKDILVHKMNPSP------GTLLV
COQ5_XENLA        AVSEEEKRERVYKVFENVAHNYDIMNDAMSLGVHRFWKDWLLQLMKPTP------GMQLL
COQ5_DANRE        TVPEEEKAEKVYKVFESVAKKYDVMNDAMSLGIHRLWKDTLLHIMNPQP------GLRLL
COQ5_ARATH        EVKEEEKSKLVGNVFTNVASSYDIMNDVMSGGLHRLWKERLVGKLSPFA------GMKHL
COQ5_ORYSJ        QVAEEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFP------GMKHL
UBIE_ZYMMO        DVSPQEKTHLVGDVFRRVASRYDLMNDAMSGGLHRLWKDDFVRLVQPKA------SEHIL
COQ5_DROME        TVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTH------GMRLL
COQ5_DICDI        TVNKEDKESMVKDVFDSVSSSYDLMNDVMSMGIHRLWKDELINTLNPTP------GSHLL
COQ5_CAEEL        DVDEAEKEQKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQVPY------NAKCL
UBIE_RICCN        KVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNL-------NSHIL
UBIE_RICPR        KVDYTKKQWLINNIFSRVADKYDLMNDLMSIGLHRLWKDEFIMQIPNL-------NSNIL
COQ5_SCHPO        DVPEDEKEHLVKNVFSSVAKKYDEMNDAMSLGIHRLWKNIFVSRLNPG---NSTVPMKIL
COQ5_YEAST        TVLKSTKQKLVGDVFSSVANRYDLMNDVMSLGIHRLWKDHFINKLDAGKRPNSTTPLNFI
UBIE_CAUVC        DVDASLKAGLVRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQP------GEVII
UBIE_RUBGI        SVDEREREQRIRRVFSAVAARYDLMNDLMSFGIHRLWKRRFVRMAAPQA------GQHIV
COQ5_LEIDO        GRNMGLGDAYVKKVFDSVATKYDMMNDVLSLGIHRIWKKHFVEDCVCPLP-----GSKFL
UBIE_ECOLI        TVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR------GQTVL
UBIE_ECOL6        TVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR------GQTVL
UBIE_SALTY        TVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR------GQTVL
UBIE_YERPE        TVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRR------GQRVL
UBIE_VIBPA        TVAKEEKVTKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARP------GQRIL
UBIE_VIBVU        TVAKEEKVAKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARP------GQRVL
UBIE_VIBCH        TVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARP------GQRIL
UBIE_HAEDU        TVAKEEKQQLVANVFHSVAAKYDLMNDLLSFGIHRIWKRFTIDCSGVRK------GQKVL
UBIE_PASMU        TVAKSEKQKMVANVFHSVAGKYDLMNDLLSFGIHRVWKRFTIDCSGVRK------GHKVL
UBIE_SHEON        TVEADKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARP------GMKVL
UBIE_PSEPK        DVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRS------GNRVL
UBIE_PSEPU        DVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRA------GNRVL
UBIE_PSESM        NVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFAIELSGVRT------GNRVL
UBIE_PSEAE        NVPESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGVRS------GNRVL
UBIE_COXBU        TVPTDQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRT------GQRIL
UBIE_NEIMA        TVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKK------GDKVL
UBIE_NEIMB        TVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKK------GDKVL
UBIE_NITEU        TVSETEKARKVAEVFHSVAARYNLMNDLMSMGLHRLWKRFAIDVSGAKP------GDKVL
UBIE_RALSO        QVDEREKAGKVAGVFHSVASKYDVMNDLMSGGMHRLWKMFTIAQAAVRP------GYKVL
UBIE_XANAC        DVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKP------GDRVL
UBIE_XANCP        DVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKP------GDRVL
UBIE_XYLFA        QVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKS------GDRVL
UBIE_XYLFT        QVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKS------GDRVL
UBIE_WIGBR        YVKKSKKNSMIEDIFNNVSYKYDLMNDIMSFGVHRIWKNILVYCNSTNP------DQKIL
MENG_BACAN        MQQ--SKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKP------GSKAL
MENG_BACCR        MQQ--SKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVQP------GSQAL
MENG_BACSU        MQD--SKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKE------GAKAL
MENG_GEOSE        MRQ--SKEERVHRVFENISAHYDRMNSVISFRRHLKWRKDVMRRMNVQK------GKKAL
MENG_BACHD        MTE--TKEERVHQVFEKIYKRYDVMNSVISFQRHKAWRKDTMKRMNVQE------GQSAL
MENG_OCEIH        MGKPSSKEERVHHVFENIYSKYDSMNSIISFQRHKSWRKDTMKRMNVQA------GETAL
MENG_LISMO        MTE--TKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQK------GTNVL
MENG_STAAM        MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRK------GTKAL
MENG_STAES        MAENQAKKEQVHTVFQNISQKYDRLNNIISFEQHKVWRKHVMSTMNVQK------GSKAL
MENG_MICLU        QLNGQEKSELVHNVFQNVSTKYDRLNDIISFNQHKSWRKYTMKQMNVKK------GSKAL
MENG_LACLA        KSMTKVNEERVQEIFNSISSDYDKMNAIISFKQHDLWRAKTMKRMGDLT------GLSIL
MENG_LACPL        MAN--RYLHNVQGLFDTIAPNYDRMNNIISLGTHRHWRKQTMAQIHLAS------NAHVL
MENG_NOSS1        ------MTNKIRAIFDRIAPVYDQLNDWLSLGQHRIWKEMAIKWTGAKP------GDTCL
MENG_SYNY3        SLLTQPTQESVQQIFARIAPQYDDLNTFLSFGQHHIWKAMAVKWSGVSP------GDRLL
MENG_ARATH        RRTVVKCSNERRILFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKK------GDYVL
MENG_THEEB        -------MTNIQALFERIAPLYDRLNDQLSFGLHHVWKQMAVDWLELPQ------GATAL
A8G3E5_PROM2      --MKFTKTIEVKNIFNKISYKYDFLNNLLSFGLHKLWKRKLVNLLEPLN------GEDWA
A9BE48_PROM4      --MRPKDSLPIKELFDTVSPTYDFLNDLFSFGLHRLWKRQFLRWLNPTY------GENWA
Q5FR54_GLUOX      YDDSARRSGFVQSLFDRTAPYYDRINTIFSLGSGRWFRRRMLRQTGLQA------GDRVL
A1KCK9_AZOSB      FATEAERRHTTRALFDRAAAGYDRAERITAFGTGPWYRRYALQRSGLAA------GMTVL
C5BQ15_TERTT      YESGEARRKKVDAMFDSSAQHYDWITKMMSFGSGGWYRRQALLRVGVGA------GHQVL
MENG_LEPIN        MPQANFKAGFVRENFNKIAKKYDRFNDWNSFLLHRVWKNHLVREIENNFSG----HLHVL
E8T363_THEA1      ----MGKQPVGVEIFDRIARKYDSISGFLSLGIIKRWQRELVKGLNSPG--------VVL
Q979V1_THEVO      ---MISKHQAVKKIFDQISDKYDLIDTIISLGLDQRWRRSLISNLKLMP------GLQCL
                                *      *:      :                              

MENG_CHLCV        DLCSGTGKVAYRYIHDYPK-----------------------------------SQAILV
S7IKW4_CHLPS      DLCSGTGKVAYRYIRDYPG-----------------------------------SKATLV
MENG_CHLPN        DLCAGTGKVAKRYIAAHPQ-----------------------------------ASVTLV
MENG_CHLMU        DLCAGTGHVALSYIQKYPQ-----------------------------------ASATLV
MENG_CHLTR        DLCAGTGRVALSYVQNYPR-----------------------------------ASATLV
MENG_DEIRA        DVATGTGDFAIELKERAPQ-----------------------------------VEIVGS
MENG_THEMA        DLATGTGDVARLLKRKAPH-----------------------------------LEITGL
MENG_BACTN        DVATGTGDFAILACRELNP-----------------------------------DELIGT
A8Z662_SULMW      DLATGTGIIPIIIANKKN------------------------------------ISILGL
UBIE_CAMJE        DIACGTGDMIEIWQESALKMEKN------------------------------ILNIKGI
A8Z6H0_CAMC1      DVACGTGDMMGLWSEIAKEFGVE------------------------------VKSLTGI
Q7MRM1_WOLSU      DVACGTGDMILHWQKNAKEQGIE------------------------------IEKVIGI
D0K1F4_HELP5      DVACGTGDMLIAWQKSALNCAIE------------------------------FKECLGI
MENG_CHLTE        DVATGTGDLAASMAKIPGA------------------------------------KVTGY
MENG_RHOBA        DLCCGTGDLAIAIADSAG----------------------------------SDVQVIGS
Q1AUK8_RUBXD      DLACGTGSLTRALARRVG----------------------------------PQGYVLGV
MENG_COREF        DLAAGTAVSTVELAK-------------------------------------SGAWCVAC
MENG_CORGL        DLAAGTAVSTVELAK-------------------------------------SGAFCVAC
MENG_MYCTU        DLAAGTAVSTVELTK-------------------------------------SGAWCVAA
MENG_MYCLE        DLAAGTAVSTAELSK-------------------------------------SGAWCVAA
MENG_STRAW        DLAAGTATSSLPFAR-------------------------------------AGAYVVPC
MENG_STRCO        DLAAGTATSSLPFAR-------------------------------------TGAYVVPC
MENG_TROWT        DVGAGTGASTRTVAR-------------------------------------TGAAVTGI
C5C7I7_MICLC      DLATGTGDLAFEVLKQH-----------------------------------PDAQVVGA
UBIE_AGRFC        DVAGGTGDVAFRIIEASNR----------------------------------LAHATVL
UBIE_RHIME        DVAGGTGDIAFRIVERSGR----------------------------------KAHATVL
UBIE_RHILO        DVAGGTGDIAFRIVDASHG----------------------------------NAHATVL
UBIE_BRUME        DVAGGTGDIAFRIVEASGR----------------------------------QAHVTIL
UBIE_BRUSU        DVAGGTGDIAFRIVEVSGR----------------------------------QAHVTIL
UBIE_BRADU        DVAGGTGDISFRAAKAAGP----------------------------------GFHATVC
COQ5_HUMAN        DVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEE-DSLGGSRVVVC
COQ5_PONAB        DVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEE-DSLGGSRVVMC
COQ5_BOVIN        DVAGGTGDIAFRFLNYVQAQHQRKQKRQLRAQQNLSWEEIARKYQNEE-DSLGGSHVMVC
COQ5_MOUSE        DMAGGTGDIAFRFLSYVQAQHQRRQRRQLRTQQNLSWEEIAKKYQNEE-DSLGGSLATVC
COQ5_RAT          DVAGGTGDIAFRFLSYVQTQHERKQRRQLRTRQNLSWEEIARKYQSKE-DPLGGSLVMVC
COQ5_CHICK        DVAGGTGDIAFRFLNYVRSVRERQLQQKLRHHQNLSWQEISKSYQEEKSNPLGDSQVVVC
COQ5_XENLA        DMAGGTGDISFRFINYIRAQREKWIRQELKFQQDLSWPDISKTYQNKEEGSLMGSRAVIC
COQ5_DANRE        DTAGGTGDISFRFLEYTRSMYDRQQRLRAKSQQTPSWKDIAGHYVSDE-EGPPQSRAVVC
COQ5_ARATH        DVAGGTGDVAFRIYDAVYSVKRRALQKVDE-------------------ASLEETQIYVC
COQ5_ORYSJ        DVAGGTGDVAFRALERINSVSHRAMQGTLT-------------------DIEEETQIYVC
UBIE_ZYMMO        DMAGGTGDIAFRL-------------------------------------AKYGTNVTIA
COQ5_DROME        DMAGGTGDITFRYLRYLNNQPN---------------------------PQQRPSHVTVS
COQ5_DICDI        DVAGGTGDISFRFLDKIKTSPNYFPNINKSNNGGGEVLK----------SSSLPSSATVF
COQ5_CAEEL        DMAGGTGDIAFRILRHSPT-----------------------------------AKVTVS
UBIE_RICCN        DVASGSGDIALKLAKKARDR-------------------------------VNNISLTLS
UBIE_RICPR        DVASGSGDIALKLAKKAKDR-------------------------------GNNISLILS
COQ5_SCHPO        DVAGGTGDIAFRILNHATNHNG-----------------------------DRNTRVIVA
COQ5_YEAST        DVAGGSGDIAFGLLDHAESKFG-----------------------------DTESTMDIV
UBIE_CAUVC        DCAGGTGDMARRFAKMARKAQERR--------------------------GGPDATINIV
UBIE_RUBGI        DLAGGTGDVAALMAAADRRV-------------------------------------TVV
COQ5_LEIDO        DVAGGTGDIAFRITDSIRARGQS---------------------FGIVPKTLDGTKVVVC
UBIE_ECOLI        DLAGGTGDLTAKFSRLVGE----------------------------------TGKVVLA
UBIE_ECOL6        DLAGGTGDLTAKFSRLVGE----------------------------------TGKVVLA
UBIE_SALTY        DLAGGTGDLTAKFSRMVGE----------------------------------TGKVILA
UBIE_YERPE        DLAGGTGDLTAKFSRLVGE----------------------------------QGEVILA
UBIE_VIBPA        DLGGGTGDLTAKFSRIVGD----------------------------------QGHVVLA
UBIE_VIBVU        DLGGGTGDLTAKFSRIVGE----------------------------------KGHVILA
UBIE_VIBCH        DLGGGTGDLTAKFSRIVGE----------------------------------KGHVILA
UBIE_HAEDU        DLAGGTGDFSAKFSRIVGE----------------------------------TGQVVLA
UBIE_PASMU        DLAGGTGDFTAKFSRLVGP----------------------------------SGEVILA
UBIE_SHEON        DLAGGTGDLTAKFSHLVGD----------------------------------KGEVVLA
UBIE_PSEPK        DIAGGTGDLAAKFSRLVGP----------------------------------TGQVVLA
UBIE_PSEPU        DIAGGTGDLAAKFSRLVGP----------------------------------TGQVVLA
UBIE_PSESM        DIAGGTGDLTRKFSNLVGP----------------------------------TGQVVLA
UBIE_PSEAE        DIAGGTGDLTRQFSRLVGP----------------------------------TGEVVLA
UBIE_COXBU        DLAGGTGDLAKRISPLVGD----------------------------------EGEVVIA
UBIE_NEIMA        DIAGGTGDLSRGWAKRVGK----------------------------------EGEVWLT
UBIE_NEIMB        DIAGGTGDLSRGWAKRVGK----------------------------------EGEVWLT
UBIE_NITEU        DIAGGTADLTRLFLEKTGS----------------------------------TGEVWLT
UBIE_RALSO        DIAGGTGDLAKAFARQAGP----------------------------------TGEVWLT
UBIE_XANAC        DLAGGTGDIAVLLKERVGN----------------------------------EGAVVLG
UBIE_XANCP        DLAGGTGDIAVLLKERVGN----------------------------------EGAVVLG
UBIE_XYLFA        DLAGGTGDIAMLLKNRVGA----------------------------------EGSIVLG
UBIE_XYLFT        DLAGGTGDIAMLLKNRVGA----------------------------------EGSIVLG
UBIE_WIGBR        DLASGTGDITKRLSKLINK----------------------------------KGFIVSL
MENG_BACAN        DVCCGTADWTIALAGAVGE----------------------------------QGKVVGL
MENG_BACCR        DVCCGTADWTIALAGAVGE----------------------------------QGKVVGL
MENG_BACSU        DVCCGTADWTIALAKAAGK----------------------------------SGEIKGL
MENG_GEOSE        DVCCGTADWTIALAEAVGP----------------------------------EGKVYGL
MENG_BACHD        DVCCGTADWAIALGKAVGP----------------------------------TGHVEGL
MENG_OCEIH        DVCCGTGDWSISLSEAVGQ----------------------------------TGKVIGL
MENG_LISMO        DVCCGTADWSIMMAEEIGP----------------------------------EGHVTGL
MENG_STAAM        DVCCGTGDWTIALSKAVGP----------------------------------TGEVTGI
MENG_STAES        DVCCGTADWTIALSEAVGS----------------------------------KGQVTGL
MENG_MICLU        DVCCGTGDWTIQMAQAVGK----------------------------------NGHVIGL
MENG_LACLA        DLCCGTGDWTFDLSESVGP----------------------------------SGKVIGL
MENG_LACPL        DLCCGTGDWTIALAKELQA----------------------------------PGEVIGL
MENG_NOSS1        DLCCGSGDLALRLARRVGS----------------------------------TGQVSGV
MENG_SYNY3        DVCCGSGDLAFQGAKVVGT----------------------------------RGKVVGL
MENG_ARATH        DLCCGSGDLAFLLSEKVGS----------------------------------TGKVMGL
MENG_THEEB        DLCCGTGDLTRLLARRVGR----------------------------------QGRVVGL
A8G3E5_PROM2      DLCCGTGDLAFLISERVGP----------------------------------MGSITGI
A9BE48_PROM4      DLCCGTGDLSISLAKLLGP----------------------------------NGSVLGI
Q5FR54_GLUOX      DIATGTGLVAREAAGIAG-----------------------------------ASNVVGL
A1KCK9_AZOSB      DVAAGTGLVAREAHSIVGP----------------------------------AGRLVAL
C5BQ15_TERTT      DVGAGTGEVSLIEQELVGS----------------------------------DGFVVAL
MENG_LEPIN        DLCCGTGDISLRLENSSFV-----------------------------------DHVTCV
E8T363_THEA1      DLACGTGQVAALVAPKAEL-------------------------------------TVGL
Q979V1_THEVO      DCGAGSGKVTELIMESCDS-----------------------------------CSVTAL
                  *   *:.                                                     

MENG_CHLCV        DFSSNMLAIAKQRYPKAP-----------FTFIEGDIAQLP-IDQESHTLAAISYGLRNL
S7IKW4_CHLPS      DFSANMLHIAKQRYPSAP-----------FTFIEGDIAQLP-INEESQTLASMAYGLRNL
MENG_CHLPN        DFSSAMLDIAKQHLPQGS-----------CSFIHSDINQLP-LENHSYPLAAMAYGLRNL
MENG_CHLMU        DFSTKMLENVQECHPLAP-----------FSYVISDVTSMP-LPNDTFHLASMAYGLRNL
MENG_CHLTR        DFSTKMLENVQKRHPSAP-----------FSYITSDVTHLP-LPDNTFRLASMAYGLRNL
MENG_DEIRA        DFVPQMLDLARQKAGAKQL---------SIRFEEGDALRLP-YPDASFDAVTCAFGFRNF
MENG_THEMA        DSSSKMLEIAEKRLKDGE-------------FIVGDAHNLP-FYDRSFDAITVAFGFRNF
MENG_BACTN        DISEGMMNVGREKVKKEGLSD-------KISFAREDCTSLSFAD-NRFDAITVAFGIRNF
A8Z662_SULMW      DISKYMINICYKKITNKILYR-------NIKFIKADCQKIFFIKKNKFDIVTIVFGIRNI
UBIE_CAMJE        DPSSGMLNVAKEKFPNVE-------------FIKAGAQNLP-LESQSLDILSISYGIRNV
A8Z6H0_CAMC1      DPSSGMLKEARAKFPNFK-------------FIEAYADNTT-LASGEAQILSISYGIRNV
Q7MRM1_WOLSU      DPSSGMLKVAKEKLPEIE-------------FIQAEAKALP-LEEESVDIISIAYGIRNV
D0K1F4_HELP5      DPSNNMLELAIKKFEKLEN---------KASFIQAQAKDLKGVENNSVDILSIAYGLRNV
MENG_CHLTE        DLSPEMLAIARKKYPNIE-------------FLEGFAEKMP-FDDRSFHVVSAGFGVRNF
MENG_RHOBA        DFCHAMLEIARVKESKRTRDTAGGSGRHTIPFLEADSMALPFD-DDAFQCVTVAFGLRNI
Q1AUK8_RUBXD      DFSPGMLRRARG-------------GPNIEYRIGDATDLGWVE-TASFDAATIAYGARNI
MENG_COREF        DFSQGMLAAGKHRN-------------VPMVVGDGMT--LPFA-DNSFDAVTISYGLRNI
MENG_CORGL        DFSQGMLAAGKDRD-------------VSKVVGDGMQ--LPFA-DNSFDAVTISYGLRNI
MENG_MYCTU        DFSVGMLAAGAARK-------------VPKVAGDATR--LPFG-DDVFDAVTISFGLRNV
MENG_MYCLE        DFSVRMLATGGARK-------------VPKVAADATQ--LPFS-DGVFDAVTISFGLRNI
MENG_STRAW        DFSLGMLRVGKKNHP-----------WLPLTAGDATK--LPFK-DDTFDAVTISFGLRNV
MENG_STRCO        DFSQGMLQVGKERHS-----------WLPFTAGDATR--LPFK-DDVFDAVTISFGLRNV
MENG_TROWT        DISPRMLQIARNRCK-----------RFQNITWRLTNGDLPFP-DKSFDAILMVFCLRNV
C5C7I7_MICLC      DIAAEMMEVGRARAGG---------DRIEWVVADATD--LPFE-ADSFDAVTHGYLLRNV
UBIE_AGRFC        DINGSMLAVGEERAAK-KKLSDN------LTFVEANAEELPFE-ANTFDAYTVAFGIRNV
UBIE_RHIME        DINGSMLSVGAERARK-KGIEAN------LDFVEANAEDLPFA-ANSFDAYTIAFGIRNV
UBIE_RHILO        DINGSMLGVGRDRAQK-KGLSGN------TDFVEANAEELPFA-DATFDAYTIAFGIRNV
UBIE_BRUME        DINGSMLGVGRERAIK-KGLIDN------LEFVEANAEELPFE-DNSFDAYTIAFGIRNV
UBIE_BRUSU        DINGSMLGVGRERAIK-KGLIDN------LEFVEANAEELPFE-DNSFDAYTIAFGIRNV
UBIE_BRADU        DINSDMLAVGRERAAK-RHLETQ------VDFVEGNAEALAFA-DRSFDAYTIAFGIRNV
COQ5_HUMAN        DINKEMLKVGKQKALA-QGYRAG------LAWVLGDAEELPFD-DDKFDIYTIAFGIRNV
COQ5_PONAB        DINKEMLKVGKQKALA-QGYRAG------LAWVLGDAEELPFD-DDKFDIYTIAFGIRNV
COQ5_BOVIN        DINKEMLKIGKQKARA-QGYKAG------LAWILGDAEELPFD-DNKFDVYTIAFGIRNV
COQ5_MOUSE        DINREMLKVGKQKALD-QGHTAG------LAWVLGDAEELPFD-DDSFDVYTIAFGIRNV
COQ5_RAT          DINREMLKVGKQKALA-RGHTAG------LAWVLGDAEELPFD-DDRFDVYTIAFGIRNV
COQ5_CHICK        DINKEMLKAGKQKAQH-LGYSEG------LSWVLGNAEELHFD-DDKFDVYTIAFGIRNV
COQ5_XENLA        DINKEMLKVGLQKSLR-LGYSEG------LSWVAGDAEELPFG-DDKFDVYTIAFGIRNV
COQ5_DANRE        DINKEMLKVGKQRAED-AGITTG------LSWVAGDAEELPFD-DDQFDMYTIAFGIRNV
COQ5_ARATH        DINPNMLNVGKQRAAE-RGLRDNK----SLVWVEGDAEALSFD-DNSMDGYTIAFGIRNV
COQ5_ORYSJ        DINPNMLNVGKKRASE-RGYKEGH----CLSWIQGDAEALSFE-DGSMDGYTIAFGIRNV
UBIE_ZYMMO        DINPAMLEVGKKRAIA-RSIEN-------LTWKEENAEALSFN-DNVFDAYTIAFGIRNV
COQ5_DROME        DINQHMLNVGEERAKR-LGLTTDQLSNCTVAWQCADAEKLPFP-DASFTAYTIAFGIRNC
COQ5_DICDI        DINQSMLNEGKKRGLN-KGYTDQ--SDPSIDWVQGNSEQLPFK-DNTFNCYTVSFGIRNC
COQ5_CAEEL        DINQPMLDVGKKRAEKERDIQPSR-----AEWVCANAEQMPFE-SNTYDLFTMSFGIRNC
UBIE_RICCN        DINEEMLKQAKKKAIDLNLFQN-------LKFTVASAEELPFP-DDSFDYYTIAFGIRNV
UBIE_RICPR        DINEEMLNNAKKKSIDLNLFQN-------IKFIVANAEELPFS-DNSFDYYTIAFGIRNV
COQ5_SCHPO        DINPDMLSVGLRRSK-KTPYYDSG----RVEFIEQNAEILDKIPDNSIDMYTIAFGIRNC
COQ5_YEAST        DINPDMLKEGEKRAMEQGKYFKDP----RVRFLVSNGEKLEEIDSDSKDIYTVSFGIRNF
UBIE_CAUVC        DYNAEMIMAGIERGG-----EPE------ITWTVGDAQRLPLP-DAYADAYVISFGIRNV
UBIE_RUBGI        DPSAEMMAVGQARG------HAH------VDWQVGSAEQLPLA-DASVDTLTISFGIRNA
COQ5_LEIDO        DINAMMLKEGQKRAER-EGYMD-------IDWVCASGEELPFE-DGAFDSYTVSFGIRNF
UBIE_ECOLI        DINESMLKMGREKLRN-IGVIGN------VEYVQANAEALPFP-DNTFDCITISFGLRNV
UBIE_ECOL6        DINESMLKMGREKLRN-IGVIGN------VEYVQANAEALPFP-DNTFDCITISFGLRNV
UBIE_SALTY        DINDSMLKMGREKLRN-IGVIGN------VEYVQANAEALPFP-DNTFDCITISFGLRNV
UBIE_YERPE        DINESMLRMGREKLRD-KGIVGN------VSYVQANAEALPFP-DNYFDCITISFGLRNV
UBIE_VIBPA        DINNSMLNVGRDKLRD-NGIVGN------VHYVQANAEELPFP-DDYFDVITISFCLRNV
UBIE_VIBVU        DINNSMLNVGRDKLRD-SGIVGN------VHYVQANAEELPFP-DDYFDIITISFCLRNV
UBIE_VIBCH        DINNSMLNVGRDKLRD-SGVVGN------VHYVQANAEELPFP-DNYFDCITISFCLRNV
UBIE_HAEDU        DINSSMLEVGRDKLRN-LGVVGN------INYVQANAEHLPFA-DNTFDCVVISFGLRNV
UBIE_PASMU        DINDSMLRVGREKLRN-LGVVGN------VNYVQANAEALPFP-DNTFDCVIISFGLRNV
UBIE_SHEON        DINDSMLKVGRTKLRD-RGIVSN------VSYVQANAEALPFP-DNHFDIITIAFGLRNV
UBIE_PSEPK        DINDSMLKVGRDRLLD-RGVAGN------IEFVQADAEKLPFP-DNHFDCVTIAFGLRNV
UBIE_PSEPU        DINESMLKVGRDRLLD-RGVAGN------IEFVQADAEKLPFP-DNHFDCVTIAFGLRNV
UBIE_PSESM        DINASMLKVGRDRLLD-LGVSGN------VEFVQADAEKLPFP-DNHFDCVTIAFGLRNV
UBIE_PSEAE        DINASMLKVGRDKLLD-KGVSGN------VSFVQADAEKLPFP-DNHFDCVTIAFGLRNV
UBIE_COXBU        DINAAMLNVGRRRLLD-QGIFRN------IQFIQADAEKLPFP-NNFFDRIVIGFGLRNV
UBIE_NEIMA        DINSSMLTVGRDRLLN-EGMI--------LPVSLADAEKLPFP-DNYFNLVSVAFGLRNM
UBIE_NEIMB        DINSSMLTVGRDRLLN-EGMI--------LPVSLADAEKLPFP-DNYFNLVSVAFGLRNM
UBIE_NITEU        DINNSMLSIGRDRMLN-DGKS--------VPVAQCDAEKLPFP-DNYFDRVCVAFGLRNM
UBIE_RALSO        DINESMLRVGRDRLLD-AGVL--------TPTCLCDAEHIPFP-NAYFDVVTVAFGLRNM
UBIE_XANAC        DINAGMLSVGRDRLTN-RGLVSG------FDYVQCNAEALPFP-DQSFDLLTISFGLRNV
UBIE_XANCP        DINAGMLSVGRDRLTN-RGLVAG------FDYVQCNAEALPFP-DQSFDLVTISFGLRNV
UBIE_XYLFA        DINASMLSVGRDRLID-RGVVAH------LDYVQCNAEALPFQ-DKCFDLVTMSFGLRNV
UBIE_XYLFT        DINASMLSVGRDRLID-RGVVAR------LDYVQCNAEALPFQ-DKCFDLVTMSFGLRNV
UBIE_WIGBR        DINRKMLKICRKKIRN-SGTIRN------IFYIQANSEYLPFK-KNIFDSVIVSFGFRNF
MENG_BACAN        DFSENMLSVGKQKVEALQLKQ--------VELLHGNAMELPFE-DNTFDYVTIGFGLRNV
MENG_BACCR        DFSENMLSVGKQKVEALQLKQ--------VELLHGNAMELPFE-DNTFDYVTIGFGLRNV
MENG_BACSU        DFSENMLSVGEQKVKDGGFSQ--------IELLHGNAMELPFD-DDTFDYVTIGFGLRNV
MENG_GEOSE        DFSENMLKVGEQKVKARGLHN--------VKLIHGNAMQLPFP-DNSFDYVTIGFGLRNV
MENG_BACHD        DFSENMLSIGKKKIADERLDH--------VFLRHGNAMELPYA-DDTFDFVTIGFGLRNV
MENG_OCEIH        DFSKNMLSIAKQKKQDLQLNQ--------LELVHGNAMELPYE-ENSFDYVTIGFGLRNV
MENG_LISMO        DFSENMLKVGREKVKEADLHN--------VELIHGNAMELPFP-DNSFDYVTIGFGLRNV
MENG_STAAM        DFSENMLEVGKEK--TASMEN--------VKLVHGDAMELPFE-DNSFDYVTIGFGLRNV
MENG_STAES        DFSENMLEVGKQK--TASLEN--------IQLVHGDAMNLPFD-DNSFDYVTIGFGLRNV
MENG_MICLU        DFSENMLSVAQGK--TNHIQN--------IELIHGNAMELPFE-DNIFDYTTIGFGLRNL
MENG_LACLA        DFSENMLEIAKAKLKEEAKKN--------IEFLQGNAMALPFE-KGSFDVVTIGYGLRNT
MENG_LACPL        DFSAPMLKLAQQKVTQQQVADR-------VWLRRGNAMHLPFK-DNTFDLVTIGFGLRNL
MENG_NOSS1        DFSANLLETAKQRA--QSQYPQPN-----ISWVEANVLDLPFK-DNQFDAATMGYGLRNV
MENG_SYNY3        DFCAELLAIAAGKH--KSKYAHLP-----MQWLQGDALALPFS-DNEFDGATMGYGLRNV
MENG_ARATH        DFSSEQLAVAATRQSLKARSCYKC-----IEWIEGDAIDLPFD-DCEFDAVTMGYGLRNV
MENG_THEEB        DFAAAPLAIARQRS-----DHYPQ-----IEWLQGDALAVPFA-PQTFQGITIGYGLRNV
A8G3E5_PROM2      DSAEDILNIAKKKS---ELKKNKF-----IKWEIQDVLEINVY-SKKFDGICMSYGLRNL
A9BE48_PROM4      DFSSSQIALAKKRA---FKASIQS-----VSWLEADVLDNQLQ-SSSFDGVVMAYGLRNL
Q5FR54_GLUOX      DMSAGMLAECRRNVP-------------GVSLVQADAQRLPFS-DGQFDLLSMGYALRHV
A1KCK9_AZOSB      DPSPGMLEELRKKL--------------DVQTLEAYAESIPLD-DGEVDFVSMGYALRHV
C5BQ15_TERTT      DPSKGMLSVAVENG--------------VQRATMGLGEALPFP-DNTFDFVTMSYALRHV
MENG_LEPIN        DFSENMLEIAKTRLKKQAQKGR-------VHFELGDATKLIQFQNSQFDVVSIGFGLRNV
E8T363_THEA1      DYSLPMLQVAKEKHPE-------------LLWVRGDALKTPFK-SAVFDTVLVSLGLRHF
Q979V1_THEVO      DITDSMFNPELTKRCK---------------FVVSPAESLPFS-DETFDRVSSAFLTRNL
                  *     :                                                  *: 

MENG_CHLCV        PDRKNALNEIHRILKPNGCLGILELTSPSDNHPMYLAHRLYLKFLVPLIGRLCS---KNK
S7IKW4_CHLPS      PKPKDILENIHRMLKPQGTLGILELTSPPHSHPLYLVHRLYLKSIVPWVGKLYS---KHT
MENG_CHLPN        SDPHKALQEISRVLMPSGKLGILELTPPKKTHPTYSAHKLYLRAVVPWIGKSVS---KDP
MENG_CHLMU        SSPLEALKEVHRVLKPKGRLGILELTRPATYNPVHLLHKLYLNLVVPSVGRFYS---GNS
MENG_CHLTR        SYPLEALREVYRVLQPGGHLGILELTRPATYNPVYLLHKLYLNLVVPSVGRFYS---GNS
MENG_DEIRA        ADYTQGLAEMWRVLTPGGRLVLLEFPPPASGLF-GAVFRLYFQHVLPRIGALVS---GNA
MENG_THEMA        SDRRRVLRECRRVLKRKGRLVILELLPPNTKRFTGKIYSFYLKTWVPFVGGLFS---GDF
MENG_BACTN        EDLDKGLSEMCRVLKPGGHLVILELTTPDR-FPMKQLFAIYSKVVIPLLGKLLS---KDN
A8Z662_SULMW      ENINNLLKEVYRVLNYNGILMILEFSNPNK-DFFNKIYKFYSKYILLNIVKVFT---KNL
UBIE_CAMJE        VERQKALSEFARVLQKDGILVVLEFTKREKGGFIAACRDFYLKNILPSIGGIIS---KNK
A8Z6H0_CAMC1      VERKAALREFNRVLADGGYVVVLEFTKRQKKGFITALRDFYLSKILPSIGGFIS---KNK
Q7MRM1_WOLSU      IERDKALAEFHRVLKPGGILAILEFTKSENDSILDSLASFYTKKILPSIGGIIS---KNY
D0K1F4_HELP5      VERQEALKEFFRVLKPRGVLVILEFLKKDNPTWLDKISGFYTNKVLPLVGGAIS---KNY
MENG_CHLTE        EDLAQGMKEFHRVLKPGGCAYIIEPMIPRN-AVMKKLYLIYFKNVLPKIAGMFS---KST
MENG_RHOBA        ADTDQGLSEMARVCKPGGQVLVLEFSQPTL-PVLKQAYNFYFRHVLPRIGQWMAR--NDK
Q1AUK8_RUBXD      PDLDALFSEMARVVRPGGAVVCLEIARPQG-RLFAAFYGLWFDRIVPRLGAAVS---GDP
MENG_COREF        HDFRAGLREMARVTKPGGRLTVAEFSTPVI-PVFGTLYKEYLMRLLPKVARVVS---SNP
MENG_CORGL        HDFRAGLKEMARVTKPGGRLTVAEFSTPVI-PVFGTVYKEYLMRLLPQAARAVS---SNP
MENG_MYCTU        ANQQAALREMARVTRPGGRLLVCEFSTPTN-ALFATAYKEYLMRALPRVARAVS---SNP
MENG_MYCLE        ADYQAALREMARVTRPGGQLVVCEFSTPTN-ALVANVYTEYLMRALPQVARLVS---SNP
MENG_STRAW        QDTDTALSELYRVTKPGGRVVICEFSHPTW-APFRTVYTEYLMRALPPVARAVS---SNP
MENG_STRCO        QDTDAALREMYRVTRPGGRVVICEFSHPTW-APFRTVYTEYLMRALPPVARAVS---SNP
MENG_TROWT        SNIQGFLCDAARVLKPGGRLVVCEFSHPR--RFVAPFYRLYLRYVLPRLAKLIS---SDP
C5C7I7_MICLC      ADIPATLAEQFRVLRPGGWVAALETSPAPD-NVLKPFSSFYIHRVMPQLAKLMA---DRP
UBIE_AGRFC        PRIDVALKEAYRVLKRGGRLLVLEFSEVDM-PLLDRVYDAWSFNAIPQFGKMIT---GDA
UBIE_RHIME        PRIEVALKEAYRVLKRGGRLLVLEFSEVEM-PLLDRFYDAWSFNAIPKFGKLIT---GDD
UBIE_RHILO        PRIDVALSEAFRVLKPGGRFLCLEFSEVEM-PLLDKAYEAWSFNAIPKIGKMVT---GDG
UBIE_BRUME        PHIDKALSEAYRVLKPGGRFLCLEFSEVEL-PVLDKVYDEWSFRAIPRIGKMIT---GDA
UBIE_BRUSU        PHIDKALSEAYRVLKPGGRFLCLEFSEVEL-PVLDKVYDEWSFRAIPRIGKMIT---GDA
UBIE_BRADU        PQIDLALREAYRVLRPGSRFLCLEFSTVEM-PGLDKLYDLFSFKVIPPLGRMIT---GDA
COQ5_HUMAN        THIDQALQEAHRVLKPGGRFLCLEFSQVNN-PLISRLYDLYSFQVIPVLGEVIA---GDW
COQ5_PONAB        THIDQALQEAHRVLKPGGRFLCLEFSQVNN-PLISRLYDLYSFQVIPVLGEVIA---GDW
COQ5_BOVIN        THIDQALQEAHRVLKPGGRFLCLEFSQVNN-PLLSRLYDVYSFQVIPVLGEVIA---GDW
COQ5_MOUSE        THIDQALQEAHRVLKPGGRFLCLEFGQVND-PLISRLYDLYSFQVIPVIGEVIA---GDW
COQ5_RAT          THIDRALQEAHRVLKPGGRFLCLEFSQVND-PLISRLYDLYSFQVIPVIGEVIA---GDW
COQ5_CHICK        TRIDLALQEAYRVLKPGGRFLCLEFSHVSN-PLLSRLYDLYSFQVIPVLGEVIA---GDW
COQ5_XENLA        THIEQALQEAYRVLKPGGRFLCLEFSHVNN-PLLSKIYDVYSFQVIPVLGEVIA---KDW
COQ5_DANRE        THIEQALQEAFRVLKPGGRFMCLEFSKVTN-PLLARLYDAYSFQMIPVLGEVIA---GDW
COQ5_ARATH        THIEKALAEAYRVLKRGGRFLCLELSHVEI-PVFKNLYDLYSFQVIPNLGELIA---GDR
COQ5_ORYSJ        THIEKALSEAYRVLKRGGRFLCLELSHVDV-PLFKEIYDVYSFSVIPAVGELVA---GDR
UBIE_ZYMMO        THIQKALDEAWRVLKVGGRFFCMEFSQTKW-SGFSNLYKMYSTHIVPKIGQLLA---NDE
COQ5_DROME        THVDKVLSEAYRVLQPGGRFMCLEFSHLTN-ETMQWLYDQYSFQVIPPMGQLLA---GQW
COQ5_DICDI        TNIDQVLREAYRVLKPGGRFLCLEFSQVPN-PLLRFAYDQYSFNVIPIMGQLIS---GDR
COQ5_CAEEL        THPEKVVREAFRVLKPGGQLAILEFSEVN--SALKPIYDAYSFNVIPVLGEILA---SDR
UBIE_RICCN        PDINKALKEACRVLKPMGKFICLEFSKVKE-GYIKDFYKFYSFNIIPSIGQMIA---GNK
UBIE_RICPR        PDINKALKEAYRVLKPMGKFVCLEFSKVKE-GILKDFYKFYSFNIIPSIGQIIA---GNK
COQ5_SCHPO        THIPKVLEQAYRVLKPGGVFSCLEFSKVYP-APLAELYRQYSFKILPLLGTIIA---GDS
COQ5_YEAST        TDIQKGLNTAYRVLKPGGIFYCLEFSKI-E-NPLMDFAYQQWAKVLPVMGSMIA---NDY
UBIE_CAUVC        TDINAALREARRVLKPGGRFLCLEFSRPVT-EPLAKAYDAYSFKVIPQVGEWVA---KDR
UBIE_RUBGI        TRIDVALREIHRVLKPGGRFLCLEFSTPAW-W-LRPFYNLFSFTVIPRLGAWIA---NSP
COQ5_LEIDO        SDRPKALREAFRVLKVGGALHVLEFSRVTC-PLLSVPYELWSYGFMPQAGRMLA---DE-
UBIE_ECOLI        TDKDKALRSMYRVLKPGGRLLVLEFSKPII-EPLSKAYDAYSFHVLPRIGSLVA---NDA
UBIE_ECOL6        TDKDKALRSMYRVLKPGGRLLVLEFSKPII-EPLSKAYDAYSFHVLPRIGSLVA---NDA
UBIE_SALTY        TEKEKALRSMFRVLKPGGRLLVLEFSKPII-EPLSKAYDAYSFHILPRIGSMVA---NDA
UBIE_YERPE        TEKEKALRSMFRVLKPGGRLLVLEFSKPLL-EPLSKAYDAYSFHILPKIGELVA---QDA
UBIE_VIBPA        TDKDKALRSMFRVLKPGGRLLVLEFSKPVL-EPLSKVYDAYSFHLLPKMGELVA---NDA
UBIE_VIBVU        TDKDKALRSMFRVLKPGGRLLVLEFSKPVF-DPLSKVYDAYSFHLLPKMGELVA---NDA
UBIE_VIBCH        TDKDKALRSMFRVLKPGGRLLVLEFSKPIL-EPLSKLYDTYSFHILPKMGQLIA---NDA
UBIE_HAEDU        TDKDKALKSMYRVLKPGGRLLVLEFSKPIF-DPISQLYNFYSFNILPKVGGIVV---NDA
UBIE_PASMU        TDKDKALRSMFRVLKPGGRLLVLEFSKPIL-DPLSKIYNFYSFNILPKIGEVVV---NDS
UBIE_SHEON        TDKDAALRSMNRVLKPGGKLLVLEFSKPQH-EVMRKVYDLYSFKVLPKMGQLIT---KDA
UBIE_PSEPK        THKDAAIRSMLRVLKPGGRLLILEFSKPTN-KLMSKAYDAYSFAFMPLAGKLIT---NDA
UBIE_PSEPU        THKDEAIRSMLRVLKPGGRLLVLEFSKPTN-KLMSKAYDAYSFAFMPLAGKLIT---NDS
UBIE_PSESM        THKEDALRSMLRVLKPGGRLLVLEFSKPTN-KLMSKAYDAYSFAFMPLMGKLVT---NDS
UBIE_PSEAE        THKDEAIRSMLRVLKPGGRLLVLEFSKPSS-NLLSKAYDAYSFSLLPLMGKLVT---NDS
UBIE_COXBU        TNQLAALQSMHRVIKPGGFVVILEFSKPTL-APLKAVYDAYSFQLLPRLGKLVA---KDE
UBIE_NEIMA        THKDAALKEMYRVLKPGGTLLVLEFSK-IY-KPLEGAYDFYSFKLLPAMGRLIA---KDA
UBIE_NEIMB        THKDAALKEMYRVLKPGGTLLVLEFSK-IY-KPLEGAYDFYSFKLLPVMGRLIA---KDA
UBIE_NITEU        THKDAALREMWRVLSPGGSLIVLEFSK-VW-KPLQPLYDTYSFKALPFMGKIVA---RDD
UBIE_RALSO        THKDRALAEMRRVVKPGGKVMVLEFSK-VW-QPLEKAYDVYSFKVLPWLGSKVA---GDA
UBIE_XANAC        TDKDAALREMYRVLKVGGQARVLEFSEVTA-DWFKPIYDFHSFKILPRLGQLFA---RDA
UBIE_XANCP        TDKDAALREMYRVLKVGGQARVLEFSEVTA-DWFKPIYDFHSFKILPKLGQLFA---RDA
UBIE_XYLFA        TDKDTALCEMFRVLKVGGQARVLEFSTVTA-EWFKPIYDFHSFQVLPRLGRLFA---RDA
UBIE_XYLFT        TDKDAALREMFRVLKVGGQARVLEFSAVTA-EWFKPIYDFHSFQVLPRLGRLFA---RDA
UBIE_WIGBR        TEKKKQLSSIFNVLKPGGKLLILEFSKPLF-EFLKKIYDIYSFYCIPKMGNIIS---GNY
MENG_BACAN        PDYMHVLKEMTRVVKPGGKVICLETSQPTM-IGFRQGYILYFKYIMPLFGKLFA---KSY
MENG_BACCR        PDYMHVLKEMTRVVKPGGKVICLETSQPTM-IGFRQGYILYFKYIMPLFGKMFA---KSY
MENG_BACSU        PDYLTVLKEMRRVVKPGGQVVCLETSQPEM-FGFRQAYFMYFKYIMPFFGKLFA---KSY
MENG_GEOSE        PDYMTVLKEMHRVTKPGGITVCLETSQPTL-FGFRQLYYFYFRFIMPLFGKLLA---KSY
MENG_BACHD        PDYMQVLREMARVTKPGGKVVCLETSQPTI-PVFKQLYFFYFRHVMPLFGKMFA---KSY
MENG_OCEIH        PDYMTVLEEMYRVVKPGGKVVCIETSQPTL-IGYRQAYYFYFKFIMPILGKLIA---KSY
MENG_LISMO        PDYMQVLREMYRVLKPGGQLACIDTSQPNI-PGWKQVFNAYFRYVMPVFGKFFA---KSY
MENG_STAAM        PDYLVALKEMNRVLKPGGMVVCLETSQPTL-PVFKQMYALYFKFVMPIFGKLFA---KSK
MENG_STAES        PDYLSALKEMHRVLKPGGMVVCLETSQPTL-PLFKQIYSLYFKFVMPIFGKMFA---KSK
MENG_MICLU        PDYKKGLEEMYRVLKPGGMIVVLETSHPTM-PVFKQGYKLYFKYVMPLFGKVFA---KSM
MENG_LACLA        PDYLTVLKEIFRVLKPGGRVVCIETSHPTL-PIYKQAFELYFKNVMPFLGKVFA---KSL
MENG_LACPL        PDKAQALTEIYRVLKPGARLVCLETSQPDQ-PLIKPVWQWYFTKVVPLFGRLFA---HQY
MENG_NOSS1        TDIPRSLQELHRVLKPNAKAAILDFHRPNN--QQFRTFQQWYLDSIVVPLADRL---GVK
MENG_SYNY3        GNIPQALTELQRVLKPGKKVAILDFHQPGN--ALAANFQRWYLANVVVPMAKQW---RLT
MENG_ARATH        VDRLRAMKEMYRVLKPGSRVSILDFNKSNQ--SVTTFMQGWMIDNVVVPVATVY---DLA
MENG_THEEB        VDIPQALREMFRLLVPGGRAAILDFSHPQT--SALEQFQQWYLQQWVVPTARHY---GLA
A8G3E5_PROM2      TNVKEGIKKVFYLLKDKGRAGFLDFNHSRK-SSLSNIFQKIYLRFIVVTISRLF---NLG
A9BE48_PROM4      SDPASGLHHMQRLLKPGGRAGVLDFNHTRE-GSLSSVFQKCYLRKFVVPLASTM---GLR
Q5FR54_GLUOX      ADLRETFSVWRHALRPGGHVLILEIGRARS-VMIQKILRLYLGRIVPFLSGVT-ATRDSR
A1KCK9_AZOSB      ADLDQAFGEYLRVLRPGGTACIMEITRPRS-LFGRLALRCYIRAVVPVLARLARCTPDVT
C5BQ15_TERTT      ADLQAAFEEYRRVLKPGGKMLLLEITRPEG-ALTTAALKVYMKGIIPTVTRVFRGSKEAE
MENG_LEPIN        DNLSKAIGEIFRVLKPGGMFLNLDVGKVKN-PWIRWIADFYFFKIVPILGYILWG--GKN
E8T363_THEA1      EDPEGGLREIRRVLKPGGVARILEVSIPRN-PVAGKLFTSFLKYVMLPLGRLRS----KA
Q979V1_THEVO      ADVDKYFSEVYRVLKPGGIFVNLDIFNPTK-PVFSQFFSLYFYRMVPFFGNHAT----HS
                        .                :                                    

MENG_CHLCV        QAYHYLAESIKNLPKDDYLEQLFKDAQFQISK---KRKFAFGAATIWILQKI--------
S7IKW4_CHLPS      QAYAYLAESIRKLPSDHDLEQLFSGAKFQIRK---KRKLAFGAATIWILKKI--------
MENG_CHLPN        DAYSYLSKSIQQLPKDHDLEDLFSKSGFYIAK---KKKLFLGAATIWLLEKQ--------
MENG_CHLMU        YAYSYLKESIRNLPCDTSLERVFHKSGLHIIR---KRKLLFGTATIWILEK---------
MENG_CHLTR        YAYSYLKESIRDLPRDAALEAIFHAAHLRPIR---KRKLLFGTATIWILEK---------
MENG_DEIRA        GAYTYLPESVLAFPEPERLAQMMRATGFR-TR---YRALTFGIAGMWVGDKR--------
MENG_THEMA        HAYRYLSTSVLNFLTPDQIVEMMKEEGFE-VS---FEPLFFSVAGIFIGDLIW-------
MENG_BACTN        SAYHYLPDTIKVFPQGEVMKGVISKTGFGEVH---FRRLTFGICTLYTATK---------
A8Z662_SULMW      YAYKYLLKSIDFFTKNVSIKNLLKKFNFKNFK---LLKLNHGIVSIYIANK---------
UBIE_CAMJE        SAYEYLPNSIEGFLSKKEFILELKNAGFEMLD---YKSFSFGVSSMFIAKKL--------
A8Z6H0_CAMC1      EAYEYLPSSIENFLDAKSFCDELVDAGFEIEL---CKGFSMDISTLFIARKVKEINA---
Q7MRM1_WOLSU      AAYKYLPDSIEEFLTKSMLNRELEAIGLEPLY---SRSYSANISTLFIAKKR--------
D0K1F4_HELP5      GAYSYLPQSIEGFLSLEGLKHELKNAGFEILR---TEDSIAQISTTMLVRKS--------
MENG_CHLTE        FAYDYLPNSVEQFPQAEAFTKILKNAGFKKAE---YFPMTFETSILYVAMK---------
MENG_RHOBA        SAYEYLPESVGKFPCGDALAGRMRDVGLQHVT---FRPLTLGVATIYVGEKPGGKTDHAE
Q1AUK8_RUBXD      GAYSYLPESVREFVAPGVLAGIMERNGLQDVT---WRRLAGGIITLHRGIRGFVEGGG--
MENG_COREF        EAYIYLAESIRAWPDQEDLAREINANGWSDCG---WQNLTFGIVAMHSAIKPGN------
MENG_CORGL        EAYIYLADSIRAWPSQAELAREINQNGWSDCG---WQNLTFGIVALHSAIKPEN------
MENG_MYCTU        EAYEYLAESIRAWPDQAVLAHQISRAGWSGVR---WRNLTGGIVALHAGYKPGKQTPQ--
MENG_MYCLE        DAYIYLAESIRAWPDQVTLACQLSRTGWASPR---WRNLTGGIVALHAADKPVR------
MENG_STRAW        DAYVYLAESIRAWPTQPELAERLRKAGWSKVA---WRNLTGGVVALHRGFKAV-------
MENG_STRCO        DAYVYLAESIRAWPDQPALAGRLGRAGWSRVA---WRNLTGGVVTLHRGFKAS-------
MENG_TROWT        AAYEYLTESIEDWYEVDELAFMLEQCGFQNTS---WKRLSFGAVALHRALRGPE------
C5C7I7_MICLC      EAYAYLSSSTKAFHTPDEVADLFADAGFVNIG---HETHMFGTLATHWAMKPVD------
UBIE_AGRFC        EPYQYLVESIRKFPNQEDFATMIRTAGFSRVT---YTNYTGGIAALHSGWKL--------
UBIE_RHIME        APYQYLVESIRKFPNQRDFAAMIRDAGFARVS---FTNYTGGIAALHSGWKI--------
UBIE_RHILO        EPYSYLVESIAKFPNQQNFAAMISRAGFDRVS---FRNYSGGIAALHSGWKL--------
UBIE_BRUME        DSYSYLVESIRKFPKQQDFAAMIEKAGFERVS---YRNFTGGIAALHSGWKL--------
UBIE_BRUSU        DSYSYLVESIRKFPKQQDFAAMIEKAGFERVS---YRNFTGGIAALHSGWKL--------
UBIE_BRADU        ESYQYLVESIRKFPKPNAFADMIRDAGFARVN---WQTLSGGIVALHSGWRL--------
COQ5_HUMAN        KSYQYLVESIRRFPSQEEFKDMIEDAGFHKVT---YESLTSGIVAIHSGFKL--------
COQ5_PONAB        KSYQYLVESIRRFPSQEEFKEMIEDAGFHKVT---YESLTSGIVAIHSGFKL--------
COQ5_BOVIN        KSYQYLVESIRQFPSQEEFKEMIEDAGFQKVT---YENLTSGIVAIHSGFKLYLR-----
COQ5_MOUSE        KSYQYLVESIRKFPNQEDFKDMIEDAGFQRVT---YENLTTGIVAIHSGFKL--------
COQ5_RAT          KSYQYLVESIRKFPNQEEFKDMIEDAGFQKVT---YESLTSGIVAIHSGFKL--------
COQ5_CHICK        KSYQYLVESIRRFPPQEELKAMIEDAGFLKVD---YQNLNSGIVAIHSGFKL--------
COQ5_XENLA        KSYQYLVESIRRFPSQEEFKAMIEDAGFSKVN---YHNLTSGVVAVHSGFKL--------
COQ5_DANRE        KSYQYLVESIRKFPDQEIFKEMIEDAGFFRVQ---YFNLTGGIVAIHSGFKL--------
COQ5_ARATH        ESYQYLVESVRRFPPQERFASMIADAGFEKVE---YENLVGGVVAIHSAIKL--------
COQ5_ORYSJ        QSYQYLVESIRRFPNQEKFAQMIQEAGFERVE---YENLVGGVVAIHSGLKL--------
UBIE_ZYMMO        DSYRYLIESIERFPNIEKFSDMIKSAGFVQIR---ARPILGGLVAIHSGWKV--------
COQ5_DROME        QAYQYLVESIRRFPKQEQFKQMIEQAGFDQVS---YENLTFGVVSIHSGFKL--------
COQ5_DICDI        DSYSYLVESIRKFPDQETFVQMIQDAGFKQVT---YKNLTFGICSIHSGFKL--------
COQ5_CAEEL        ASYQYLVESIRKFPNQDEFARIIREEGFSNVR---YENLTFGVCSIHKGMKPRK------
UBIE_RICCN        EAYEYLVESIDLFPSQDEFRIMIKDAGFEEVG---YKNLSGGIVAIHSAYIQ--------
UBIE_RICPR        EAYEYLVESIALFPSQDDFRIMIKESGFEEVH---YKNLSGGIVAIHSAYKI--------
COQ5_SCHPO        QSYEYLVESIERFPDAKTFAKMIEDAGFTLAGETGYETLSFGIAAIHTGIKL--------
COQ5_YEAST        DSYQYLVESIERFPDQETFKSMIEKAGFKSAG---YESLTFGICAIHWGIKV--------
UBIE_CAUVC        DAYQYLVESIRRFPDQRTFAGMIEAAGFKRVT---FTNFTGGVAALHQGWAI--------
UBIE_RUBGI        EAYTYLVESIRRFPDQRGFAAMISAAGFESVR---WHDLSFGIACVHVGTRAAAATPAGT
COQ5_LEIDO        ESYRYLVDSIRAFPDQETFAQMIRDAGFGYVR---YENLTGGIACIHTGVKTTPTPITPT
UBIE_ECOLI        DSYRYLAESIRMHPDQDTLKAMMQDAGFESVD---YYNLTAGVVALHRGYKF--------
UBIE_ECOL6        DSYRYLAESIRMHPDQDTLKTMMQDAGFESVD---YYNLTAGVVALHRGYKF--------
UBIE_SALTY        DSYRYLAESIRMHPDQDTLKAMMQDAGFESVD---YYNLTAGVVALHRGYKF--------
UBIE_YERPE        ESYRYLAESIRMHPDQETLKGMMADAGFENVT---YSNLTGGIVALHRGFKF--------
UBIE_VIBPA        ESYRYLAESIRMHPDQETLEGMMQDAGFENTK---YYNLTGGIVALHRGYKF--------
UBIE_VIBVU        DSYRYLAESIRMHPDQETLKGMMQEAGFENTS---YYNLTGGIVALHRGYKF--------
UBIE_VIBCH        DSYRYLAESIRMHPDQETLKGMMEEAGFEQTT---YYNLTGGIVALHRGYKF--------
UBIE_HAEDU        ESYRYLAESIRMHPKQDELKTMMEHAGFESVN---YYNLSAGIVALHRGYKF--------
UBIE_PASMU        ESYRYLAESIRMHPAQDVLKQMMIDAGFEQVN---YYNLSAGIVALHRGYKF--------
UBIE_SHEON        DSYEYLAESIRMHPDQDTLKQMMVDAGFEQVD---YTNMTDGIVALHRGYKF--------
UBIE_PSEPK        ESYRYLAESIRMHPDQETLKSMMVEAGFDRVT---YHNMTSGIVAVHRGIKP--------
UBIE_PSEPU        ESYRYLAESIRMHPDQETLKAMMVEAGFDRVT---YHNMTSGIVAVHRGIKP--------
UBIE_PSESM        ESYRYLAESIRMHPNQETLKSMMVDAGFDRVT---YHNMTAGVVALHRGIKP--------
UBIE_PSEAE        ESYRYLAESIRMHPDQETLKAMMVEAGFDRVT---YHNMTGGIVALHRGIKP--------
UBIE_COXBU        ESYRYLVESIRMHPDQEALLSKMTDAGFEDCD---YHNLSGGIVAVHRGYKF--------
UBIE_NEIMA        ESYQYLAESIRMHPDQETLKQMMLDAGFDSVD---YHNMSAGIVALHKGVKF--------
UBIE_NEIMB        ESYQYLAESIRMHPDQETLKQMMLDAGFDSVD---YHNMSAGIVALHKGVKF--------
UBIE_NITEU        TSYRYLAESIRMHPSQEELKQLMQQAGFERVE---YFNLTAGVVALHRGYKF--------
UBIE_RALSO        ESYRYLAESIRMHPDQETLKQMMEQAGLDSVE---YFNLTAGVVALHVGRRL--------
UBIE_XANAC        DSYQYLAESIRKHPPQESLKGMMGEAGFARCH---FKNLTGGIVAIHSGYKI--------
UBIE_XANCP        DSYQYLAESIRKHPPQDSLKGMMGEAGFARCH---YKNLTGGIVAIHSGYKI--------
UBIE_XYLFA        ASYRYLAESIRKHPPQEELQAMMGAAGFERCR---YRNLTGGIVAIHSGYKY--------
UBIE_XYLFT        ASYRYLAESIRKHPPQEELQAMMGSAGFERCG---YRNLTGGIVAIHSGYKY--------
UBIE_WIGBR        YSYKYLVESIKIHPSQKKLNKILSESEFCNSE---YINISGGIVAIHRCYKF--------
MENG_BACAN        KEYSWLQESASTFPGMKELANMFEKAGLERVQ---VKPFTFGVAAMHLGMKPESK-----
MENG_BACCR        KEYSWLQESASTFPGMKELAQMFEQAGLERVQ---VKPFTFGVAAMHLGIKPESK-----
MENG_BACSU        KEYSWLQESARDFPGMKELAGLFEEAGLKNVK---YHSFTGGVAATHIGWK---------
MENG_GEOSE        EEYSWLQESAREFPGRDELAEMFRAAGFVDVE---VKPYTFGVAAMHLGYKR--------
MENG_BACHD        DEYSWLQESTLSFPGRDRLAQMFKEVGLTDVQ---VKPYSGGAAAMHLGVKESYDEESRN
MENG_OCEIH        KEYSWLQESAKDFPGKKELKEMFLNAGFDKVE---MKSYTGGVAAMHMGFKASQ------
MENG_LISMO        KEYSWLQESTREFPGMARLAEMFQEAGFSYVR---YISHSGGASATHFGFKKKEQ-----
MENG_STAAM        EEYEWLQQSTFNFPGKEELKRMFEEAGFINVR---VRSFTGGVAAMHLGYKEKDNTKGD-
MENG_STAES        EEYEWLQQSTFNFPDKQTLKGLFFEAGFNDII---VRSFTGGVAAMHLGYKENSSSKGD-
MENG_MICLU        KEYSWLQQSAFEFPDKYTLALLMAETGFTHIK---FKGFTGGVSAMHLAYKPKEK-----
MENG_LACLA        KEYQWLQKSAEDFPDAKTLEELFRKAGFVAVE---YQKHGGGAIASHFATKSQKPKSNIR
MENG_LACPL        QEYSYLQETTRHFASYQQLATMFQQAGFQNVH---FQRFNFGAAAAHFGTKEAK------
MENG_NOSS1        EEYAYISPSLDRFPIGKEQVEIALKVGFTSAT---HYPIANGMMGVLIISK---------
MENG_SYNY3        EEYAYLQPSLDRFPTGPKQVQFALEVGFAKAV---HYPIAAGLMGVLVAEK---------
MENG_ARATH        KEYEYLKYSINGYLTGEELETLALEAGFSSAC---HYEISGGFMGNLVAMR---------
MENG_THEEB        AEYDYLWPSIQAFPTPPTLCALIQQAGFERVK---HYPLLGGLMAITVAQK---------
A8G3E5_PROM2      PEYEYIEKSITNFPKKNELINIAEDVGFKKAE---YRTILGGQMGILILTK---------
A9BE48_PROM4      EEYSYLEESLKSFPTGSLQKDMAISVGFKKAS---YRLIAGAQMGALLLQA---------
Q5FR54_GLUOX      TLMEYYWDTIAQCVSPEEIRKALSDAGFENVQ----QQTYFGVFHAYTGRRPKY------
A1KCK9_AZOSB      MLWEYYWDTIQASVEPERVMEAMRVAGFEDVR----CMLTMGVFREYIGRKPAA------
C5BQ15_TERTT      ELMRYYWDTIDQCVPPAKILDAMASAGVSNPQ----RNKVMGIFSEYIGSK---------
MENG_LEPIN        EMFDYLPVSSLSYPDQETLQLILEKEGFQRVQ---YKNFVFGNVVLHVAKKPSEKT----
E8T363_THEA1      DVTRHLFTTIVEFPHYDSLIELAVSVGFKGGS---YRPLMGGMATVYHLNG---------
Q979V1_THEVO      RNYSYLANSVKFFYSPFILSKKLESKGFIVEP----KDLFFGSVFMHIAQKK--------
                          :                                                   

MENG_CHLCV        ------------------------
S7IKW4_CHLPS      ------------------------
MENG_CHLPN        ------------------------
MENG_CHLMU        ------------------------
MENG_CHLTR        ------------------------
MENG_DEIRA        ------------------------
MENG_THEMA        ------------------------
MENG_BACTN        ------------------------
A8Z662_SULMW      ------------------------
UBIE_CAMJE        ------------------------
A8Z6H0_CAMC1      ------------------------
Q7MRM1_WOLSU      ------------------------
D0K1F4_HELP5      ------------------------
MENG_CHLTE        ------------------------
MENG_RHOBA        MAAHREREALVAT-----------
Q1AUK8_RUBXD      ------------------------
MENG_COREF        ------------------------
MENG_CORGL        ------------------------
MENG_MYCTU        ------------------------
MENG_MYCLE        ------------------------
MENG_STRAW        ------------------------
MENG_STRCO        ------------------------
MENG_TROWT        ------------------------
C5C7I7_MICLC      ------------------------
UBIE_AGRFC        ------------------------
UBIE_RHIME        ------------------------
UBIE_RHILO        ------------------------
UBIE_BRUME        ------------------------
UBIE_BRUSU        ------------------------
UBIE_BRADU        ------------------------
COQ5_HUMAN        ------------------------
COQ5_PONAB        ------------------------
COQ5_BOVIN        ------------------------
COQ5_MOUSE        ------------------------
COQ5_RAT          ------------------------
COQ5_CHICK        ------------------------
COQ5_XENLA        ------------------------
COQ5_DANRE        ------------------------
COQ5_ARATH        ------------------------
COQ5_ORYSJ        ------------------------
UBIE_ZYMMO        ------------------------
COQ5_DROME        ------------------------
COQ5_DICDI        ------------------------
COQ5_CAEEL        ------------------------
UBIE_RICCN        ------------------------
UBIE_RICPR        ------------------------
COQ5_SCHPO        ------------------------
COQ5_YEAST        ------------------------
UBIE_CAUVC        ------------------------
UBIE_RUBGI        A-----------------------
COQ5_LEIDO        TSSDIPAQNTSEATCEVKPEPNSA
UBIE_ECOLI        ------------------------
UBIE_ECOL6        ------------------------
UBIE_SALTY        ------------------------
UBIE_YERPE        ------------------------
UBIE_VIBPA        ------------------------
UBIE_VIBVU        ------------------------
UBIE_VIBCH        ------------------------
UBIE_HAEDU        ------------------------
UBIE_PASMU        ------------------------
UBIE_SHEON        ------------------------
UBIE_PSEPK        ------------------------
UBIE_PSEPU        ------------------------
UBIE_PSESM        ------------------------
UBIE_PSEAE        ------------------------
UBIE_COXBU        ------------------------
UBIE_NEIMA        ------------------------
UBIE_NEIMB        ------------------------
UBIE_NITEU        ------------------------
UBIE_RALSO        ------------------------
UBIE_XANAC        ------------------------
UBIE_XANCP        ------------------------
UBIE_XYLFA        ------------------------
UBIE_XYLFT        ------------------------
UBIE_WIGBR        ------------------------
MENG_BACAN        ------------------------
MENG_BACCR        ------------------------
MENG_BACSU        ------------------------
MENG_GEOSE        ------------------------
MENG_BACHD        VTC---------------------
MENG_OCEIH        ------------------------
MENG_LISMO        ------------------------
MENG_STAAM        ------------------------
MENG_STAES        ------------------------
MENG_MICLU        ------------------------
MENG_LACLA        IGKK--------------------
MENG_LACPL        ------------------------
MENG_NOSS1        ------------------------
MENG_SYNY3        ------------------------
MENG_ARATH        ------------------------
MENG_THEEB        ------------------------
A8G3E5_PROM2      ------------------------
A9BE48_PROM4      ------------------------
Q5FR54_GLUOX      ------------------------
A1KCK9_AZOSB      ------------------------
C5BQ15_TERTT      ------------------------
MENG_LEPIN        ------------------------
E8T363_THEA1      ------------------------
Q979V1_THEVO      ------------------------