CLUSTAL format seed alignment for MF_01815

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FABH1_BACAN      ----------MNVGILGIGRYVPEKVVTNHDLEKIMD-----TSDEWIRTRTGIAERRIA
FABH1_BACCR      ----------MNVGILGIGRYVPEKVVTNHDLEKIME-----TSDEWIRTRTGIAERRIA
FABH1_BACSU      ----------MKAGILGVGRYIPEKVLTNHDLEKMVE-----TSDEWIRTRTGIEERRIA
FABH_BACP2       ----------MNAGIIGLGRYIPEKVLTNLDLEKMVE-----TSDEWIRTRTGIEERRIA
FABH_GEOKA       ----------MGAGIIGVGRYVPEKVLTNFDLEKMMD-----TSDEWIRTRTGIEERRIA
FABH1_BACHD      ---------MTRAGILGIGSYVGEHVVTNKDFEKRID-----TSDEWIRTRTGIEERRFA
FABH_OCEIH       ----------MNIGILGTGHYLPTNVVTNNDLEKIVD-----TNDEWIRTRTGIRERRLA
FABH_LISIN       ----------MNAGILGVGKYVPEKILTNFDLEKMME-----TSDEWIRTRTGIEERRIA
FABH_LISW6       ----------MNAGILGVGKYVPERILTNFDLEKMME-----TSDEWIRTRTGIEERRIA
FABH_LISMF       ----------MNAGILGVGKYVPEKIVTNFDLEKIMD-----TSDEWIRTRTGIEERRIA
FABH_LISMO       ----------MNAGILGVGKYVPEKIVTNFDLEKIMD-----TSDEWIRTRTGIEERRIA
FABH1_STAES      ----------MNVGIKGFGAYAPKNIIDNAYFEQFLE-----TSDEWISKMTGIKERHWA
FABH_STAEQ       ----------MNVGIKGFGAYAPKNIIDNAYFEQFLE-----TSDEWISKMTGIKERHWA
FABH_STAAM       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAN       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAR       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAA9       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAB       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAA1       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAA2       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAA3       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAE       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAA8       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAC       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAW       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAS       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAAT       ----------MNVGIKGFGAYAPEKIIDNAYFEQFLD-----TSDEWISKMTGIKERHWA
FABH_STAHJ       ----------MNVGIKGFGAYAPEKVVDNAYFESFLE-----TSDEWISKMTGIKERRWA
FABH_STAS1       ----------MDVGIKGFGAYAPEKVVENTYFESFLE-----TSDEWISQMTGIKERRWA
FABH_DEIDV       --MTAPSASRLSLGIVALGAYTPERIVRNEDFEARMD-----TNAAWIESRTGIRERRFA
FABH_DEIGD       --MTTPSGSRPSIGITALGTYVPPRVVTNKDFEAHMD-----TSDEWIVSRTGIRERRFA
FABH1_DEIRA      ---------MKSIGITAIGMYVPERVVHNHEFESRMG-----IEDGWIESRSGIRERRFS
FABH2_DEIRA      ---MTASLSAPAIGILAVGAYAPAAVITNAHYATRLD-----TSDDWITSRTGIRERRHA
FABH2_BACAN      --------MNSKSRITAIGTHVPNQILSNNDLEKMID-----TNDEWIVQRTGMKERRIA
FABH2_BACCR      --------MHSKSRITAIGTYVPDQILSNNDLEKMVH-----TNDEWIVQRTGMRERRIA
FABH2_BACSU      ---------MSKAKITAIGTYAPSRRLTNADLEKIVD-----TSDEWIVQRTGMRERRIA
FABH2_BACHD      -------MNVSKARITAIGSYVPERRLTNDDLEKMVD-----TNDEWIVKRTGIRERRIA
FABH2_STAES      --------MQSFAKITAQGTYVPEKVMDNNDFEKIVE-----TSDEWIQQRTGIIERRIA
FABH_ACHLI       -------MKNLPIKIVSTGRYAPDNIMTNDDFSKILD-----TNDEWITTRTGIKRRHIA
FABH_FUSNN       ---------MQSIGIKGMGYYVPENVFTNFDFEKIID-----TSDEWIRTRTGIIERRFA
FABH_CLOAB       ---------MNSVEIIGTGSYVPEKIVTNEDMSKIVD-----TSDEWISSRTGIKERRIS
FABH_CLONN       ---------MYNVKIENTGRYVPDNIVTNEDISKIVD-----TNDKWIRERTGIKERRIS
FABH_CLOB1       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOBH       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOBJ       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOBL       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOBM       ---------MSNISVIGTGSYVPNDIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOB6       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOBK       ---------MSNISVIGTGSYVPNNIITNDFLSTIVD-----TSDEWIRTRTGILERRIS
FABH_CLOK1       ---------MNKVEIAGLGSYVPPKILDNNDLSLIVD-----TNDEWIRCRTGIRQRRIS
FABH_CLOK5       ---------MNKVEIAGLGSYVPPKILDNNDLSLIVD-----TNDEWIRCRTGIRQRRIS
FABH_CLOTE       -------MKNKEVRILSTGKYLPPISISNHDLSKIID-----TNDNWIKTRTGIEKRRIT
FABH_CLOB8       ---------MSNIKIAGIGAYLPSLVVTNDRISEFVE-----TSDEWIVQRTGMRERRIS
FABH_CLOP1       ---------MKNAKMIGFGLYTPKNLVENERLQEFLE-----TSDEWIRTRTGIERRYIS
FABH_CLOPE       ---------MKNAKMIGFGLYTPKNLVENERLQEFLE-----TSDEWIRTRTGIERRYIS
FABH_CLOPS       ---------MENAKIIGFGLYTPKNLVENERLQEFLE-----TSDEWIRSRTGIERRYIS
FABH_CLOD6       --------MNTKAGILGVGSYLPEQSYDNFHFEKIMD-----TSDEWISTRTGIKERRFA
FABH_CALS4       ------MCEKIAAGILGTGSYLPEKILTNFDLEKMVD-----TSDEWITTRTGIKERRIA
FABH_DESHD       ---------MVSVGIVGTGSYVPDKVLTNFDLEQMVD-----TNDQWIVSRTGIKERHIA
FABH_DESHY       ---------MVSVGIVGTGSYVPDKVLTNFDLEQMVD-----TNDQWIVSRTGIKERHIA
FABH_SYMTH       -------MKIRPVGITGLGMAVPERVLTNHDLERMVD-----TSDEWIRTRTGIRERRIA
FABH_NATTJ       ---------MSNAKILATGKSVPDSIFTNEDLEKMVE-----TSDSWITSRTGIKERRIA
FABH_SYNWW       ----------MKVQILGMGHSLPERILNNQELEQMVD-----TSNEWIVERTGILERRIA
FABH_CALS8       --------MAQNVKILSTGRYVPDRVLTNYDLEKMVD-----TSDEWITQRTGIKERRIV
FABH_CHLCV       ----MCVKKIRKASIWATGSYLPEKILSNSDLEQMVD-----TSDEWIVTRTGIKERR-I
FABH_CHLPN       --MWFSVNKNKKAAIWATGSYLPEKVLSNADLEKMVD-----TSDEWIVTRTGIKERR-I
FABH_CHLTA       ----------MRASIWGTGSYLPKKILTNADLEKIVE-----TSDEWISTRTGIKERR-I
FABH_CHLTR       ----------MRASIWGTGSYLPKKILTNADLEKIVE-----TSDEWISTRTGIKERR-I
FABH_CHLMU       ----------MRASIWGTGSYLPKKVLTNADLEKMVE-----TSDEWISTRTGIKERR-I
FABH_DESPS       ----------MSVVILGTGSCLPEKIVTNKDLEKIVE-----TNDEWIRTRTGICERR-I
FABH_DESVH       ----MTSP----SLLRGFGAYAPERILTNADIESMVE-----TTDEWITTRTGIRQRH-V
FABH_DESVV       ----MTSP----SLLRGFGAYAPERILTNADIESMVE-----TTDEWITTRTGIRQRH-V
FABH_DESVM       ----MTASRDIACRVRGFGAYTPVDVLTNFDLEKFVE-----TTDEWITTRTGIRQRH-R
FABH_DESAG       ----MTTK----SYILGFGSHAPERILTNTDMEAFVD-----TTDEWITTRTGIKQRH-I
FABH_ROSCS       -----MANF---AAITGWGMAVPERVLTNADLERMVE-----TSDEWIQTRTGIRERR-I
FABH_ROSS1       -----MANY---AAMTGWGMAVPERVLTNADLERIVE-----TSDEWIQTRTGIRERR-V
FABH_RUBXD       ----MNRAY---GKMLGVGRALGGRVVTNRDLEAVLD-----TSDEWISTRTGIRERR-F
FABH1_VIBVU      ----------MYSKILGTGSYLPSQIRTNADLEKMVE-----TSDEWIVARTGIKERR-I
FABH1_VIBVY      ----------MYSKILGTGSYLPSQIRTNADLEKMVE-----TSDEWIVARTGIKERR-I
FABH1_VIBPA      ----------MYSKILGTGSYLPSQVRTNADLEKMVD-----TSDEWIVARTGIKERR-I
FABH1_VIBCH      ----------MYSKILGTGSYLPSQVRTNADLEKMVE-----TSDEWIVARTGIRERR-I
FABH_ALIF1       ----------MYSKILGTGSYLPAQIRSNADLEKMVD-----TSDEWILARTGISERR-I
FABH_PSEA6       ----------MNSRIIGTGSYYPSDVRTNADLSLMVD-----TSDEWITDRTGIKERR-I
FABH_SHEON       ----------MHTKILGTGSYVPVQVRSNQDLEKMVE-----TSDQWIVERTGISERR-I
FABH_PSYIN       ----------MNSKIIGTGGYLPVTVRSNDDLEKMVD-----TSDEWITTRTGIKERR-I
FABH_ACTP2       ----------MYSKILATGSYLPAQIRTNADLEKMVD-----TSDEWIFTRSGMKERR-I
FABH_HAEDU       ----------MYSKILATGSYLPKQVRSNADLEKMVD-----TTDEWIFTRSGMKERR-I
FABH_HAEI8       ----------MNSRILSTGSYLPSHIRTNADLEKMVD-----TSDEWIVTRSGIRERR-I
FABH_HAEIG       ----------MNSRILSTGSYLPSHIRTNADLEKMVD-----TSDEWIVTRSGIRERR-I
FABH_HAEIN       ----------MNSRILSTGSYLPSHIRTNADLEKMVD-----TSDEWIVTRSGIRERR-I
FABH_ACTSZ       ----------MNSRILATGSYLPTRVRTNADLEKMVE-----TSDEWIVTRSGIRERR-L
FABH_HAES1       ----------MYSRILATGSYIPANIRTNADLEKMVE-----TSDEWITTRSGIKERR-I
FABH_HISS2       ----------MYSRILATGSYIPANIRTNADLEKMVE-----TSDEWITTRSGIKERR-I
FABH_PASMU       ----------MYSKILSTGSYLPKHIRTNADLEKMVD-----TSDEWISERTGIKERR-I
FABH_BAUCH       ----------MYTKILGTGSYLPTQIRSNTDLANMVD-----TSDEWIIARTGIRERR-I
FABH_SODGM       ----------MFTKILGTGSYLPAHIRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_BLOFL       ----------MFTKILGTGSYLPKYIRSNIILEKMVD-----TSNAWIIARTGIKERR-I
FABH_BLOPB       ----------MFTRILGTGSYLPKNIRSNIVLEKMVD-----TSHEWIVARTGIQERR-I
FABH_SALCH       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_SALPB       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_SALTY       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRKRH-I
FABH_SALTI       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_SALPA       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_SALAR       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_CITK8       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERH-I
FABH_ECO24       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_SHISS       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECO57       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOLI       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOUT       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOK1       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOL5       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOL6       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_SHIBS       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_SHIF8       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_SHIFL       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOHS       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_ECOLC       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_SHIDS       ----------MYTKIIGTGSYLPEQVRTNADLEKMVD-----TSDEWIVTRTGIRERH-I
FABH_KLEP7       ----------MYTKIIGTGSYLPEQVRTNADLEKMVE-----TSDEWIVTRTGIRERR-I
FABH_ENT38       ----------MYTKILGTGSFLPKQVRTNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_CROS8       ----------MYTKIIGTGSYLPEHVRTNADLEKMVE-----TSDEWIVTRTGIRERR-I
FABH_YERP3       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERPS       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERPA       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERPE       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERPN       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERPP       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_YERE8       ----------MYTKILGTGSYLPVQVRSNADLEKMVD-----TSDEWIVTRTGIRERR-I
FABH_SERP5       ----------MYTKILGTGSYLPVQVRTNADLEKMVD-----TSDEWIVSRTGIRERR-I
FABH_PECAS       ----------MYTKIIGTGSYLPEEIRTNADLEKMVE-----TTDEWIVTRTGIRERR-I
FABH_PHOLL       ----------MYTKILGTGSYLPAQVRTNADLEKMVD-----TSDEWIVTRTGVRERR-L
FABH_MARHV       ---------MTFARIAGTGSYLPDNIVTNRDLEQKVE-----TSDQWIRERTGIEQRH-I
FABH_THISH       ---------MTYARITGTGGCLPEKILTNHDLEKMVE-----TTDEWIQERTGIKKRH-V
FABH_ALKEH       ---------MSYARIIGTGSYLPDEVITNHDLERLID-----TSDEWIRERTGITERR-R
FABH_XANAC       ------MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVD-----TSDEWIFSRTGIRERH-I
FABH_XANC5       ------MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVD-----TSDEWIFSRTGIRERH-I
FABH_XANOM       ------MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVD-----TSDEWIFSRTGIRERH-I
FABH_XANC8       ------MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVD-----TSDEWIRSRTGIRERH-I
FABH_XANCP       ------MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVD-----TSDEWIRSRTGIRERH-I
FABH_XYLFA       ------MSKRIYARIAGTGGYLPEKVLTNDDLAHIVD-----TSDEWIRTRTGIRERH-I
FABH_XYLFT       ------MSKRIFARIAGTGGYLPEKVLTNNDLAHIVD-----TSDEWIRTRTGIRERH-I
FABH_METCA       --------MSRYSRIAGTGGYLPRQVVTNDDLAMRVE-----TSDEWIVERTGIRRRH-I
FABH_THIDA       ---------MTYSRILGTGGYLPARILTNADLEKLVD-----TNDQWIVDRTGIRERH-I
FABH_ACIET       --------MTRYSRITGTGSYLPPHRVTNDDLVAQLAQQGIETSDEWIVERTGIRARH-F
FABH_ACISJ       --------MTRYSRITGTGSYLPPHRVTNDDLVAQLAQQGIETSDEWIVERTGIRARH-F
FABH_DELAS       --------MRRYARITGTGSYLPPRRLTNHDLAAELAQRGIETSDEWIVERTGIHARH-F
FABH_ACIAC       --------MSRYSRITGTGSSLPPRRLTNADLVAELAGRGVETSDQWIVERTGIRARH-F
FABH_VEREI       --------MRRYSRIIGTGSYLPPRRLTNADLVAELGQRGIETSDEWIVERTGIRARH-F
FABH_POLNA       --------MTRYSRITGTGSYLPPNRLTNAQLAAELAVKGVETSDEWIVERTGIKARH-F
FABH_POLSJ       --------MTRYSRITGTGSYLPPRRLTNAELAAELATKGVETSDEWIVERTGIRARH-F
FABH_VARPS       --------MSSYSRITGTGSYLPPRRVTNDDLAKELATRGIETSDQWIVERTGIHARH-F
FABH_RHOFT       --------MKLYSRITGTGSYLPPRRLTNSDLAAELATQGVETSDDWIVERTGIRARH-F
FABH_BURCC       -----MAQSTLYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARH-F
FABH_BURCH       -----MAQSTLYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARH-F
FABH_BURCA       -----MAQSTLYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARH-F
FABH_BURL3       -----MAQSTLYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARH-F
FABH_BURVG       -----MAQSTLYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARH-F
FABH_BURM7       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURM9       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURMA       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURMS       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURP1       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURPS       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURP6       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURP0       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARH-F
FABH_BURTA       -----MAQSTLYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIHARH-F
FABH_PARP8       -----MAQSTTYSRVLGTGSYLPPNRVSNQDLAARLAKQGIETSDEWIVARTGIHARH-F
FABH_CUPNH       --------MTKYAKIIGTGSYLPPRRVTNHDLATQLAEKGIETSDDWIVSRSGISARH-W
FABH_CUPTR       --------MTKYAKIIGTGSYLPPRRVTNHELAAQLAEKGIETSDEWIVSRSGISARH-W
FABH_CUPPJ       --------MTKYAKIIGTGSYLPPRRVTNQDLAAQLAEKGIETSDEWIFSRSGISARH-W
FABH_RALPJ       --------MTRFARIIGTGSYLPPKRVTNDELAAQLAEKGIETSDEWIVSRSGIRARH-F
FABH_RALSO       --------MTRYARIIGTGSYLPPKRVTNHELAAQLAEQGIETSDEWIVTRSGIRARH-Y
FABH_HERAR       --------MTLYSKIIGTGSYLPPNRVTNQDLIERLALDGIETSDEWIVSRSGISARH-Y
FABH_JANMA       --------MTIYSKIIGTGSYLPPNRVTNQELTAQLASNGIETSDEWIVSRSGISARH-Y
FABH_POLNS       --------MSIFARVAGTGSYLPELRLTNQDLVERLAKTGLETSDEWIKTRSGISARH-F
FABH_POLAQ       --------MSIFSRIAGTGSYLPELRLTNQDLVERLAKTGLETSDEWIATRSGISARH-F
FABH_AROAE       ---------MIYARIAGTGSFLPGEPITN----DDLVARGIDTSDQWIIERTGIRSRH-L
FABH_AZOSB       ---------MIHARIAGTGSYLPGNPVSN----DDLVARGIDTSDDWVVSRTGIRTRY-L
FABH_BORBR       ----MMEKAMKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRH-L
FABH_BORPA       ----MMEKAMKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRH-L
FABH_BORPE       -----MEKAMKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRH-L
FABH_BORPD       -----MGTAMTYAVIAGSGSFLPERVVSNDELAAELATRNISTSDEWIVERTGIRQRH-L
FABH_BORA1       -----MSMAIKYSVIAGSGSYLPERVVSNDELAVELAQRGIQTSDEWIVERTGIRQRH-L
FABH_CHRVO       ---------MGYSRILGTGSFLPSQVLTNAQLAERVE-----TSDEWIVSRTGIRARH-I
FABH_LARHH       ---------MPYARILGTGSYLPDTILTNTELAKRVE-----TTDEWIVSRTGIQERR-L
FABH_NEIG1       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NEIG2       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NEIM0       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NEIMF       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NEIMB       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NEIMA       ---------MQYAKISGTGSYLPANRVSNDDLAQKVD-----TSDEWITARTGIKFRH-I
FABH_NITEC       --------MAMYSRIIGTGSYLPEKILTNLELESMVD-----TSDEWIQARTGIKQRH-I
FABH_NITEU       ----------MYSRIIGTGSYLPEKVLTNQDLESMVD-----TSDEWIRTRTGIERRH-I
FABH_NITMU       ---------MKYARVIGTGSYLPEKILTNHDLERMVD-----TSDEWIRTRTGIAQRH-I
FABH_VESOH       --------MSKFARIIGTGSYLPPTVITNDDLSKTIN-----TTNEWIVARTGIKQRH-K
FABH_DICNV       ---------MMYSKIIGTGGYLPSRIVSNDELSQSMQ-----TSDEWIYSRTGIRQRH-L
FABH_COXB2       ---------MTYARIQGVGSYIPQQILSNADLEKMVN-----TTDEWIMQRVGVRERHVI
FABH_COXBU       ---------MTYARIQGVGSYIPQQILSNADLEKMVN-----TTDEWIMQRVGVRERHVI
FABH_COXBR       ---------MTYARIQGVGSYIPQQILSNADLEKMVN-----TTDEWIMQRVGVRERHVI
FABH_COXBN       ---------MTYARIQGVGSYIPQQILSNADLEKMVN-----TTDEWIMQRVGVRERHVI
FABH_COXB1       ---------MTYARIQGVGSYIPQQILSNADLEKMVN-----TTDEWIMQRVGVRERHVI
FABH_ACICJ       ---------MQRTVLEGVGSYLPERIVTNHELATR-----IDTSDAWIRERTGIGQRH-I
FABH_GRABC       ---------MKRSIIAGVGAYLPSTVVSNDELAKR-----VDTSDAWIRERTGIEQRY-L
FABH_AGRFC       ---------MIRSIVRGFGAALPKRVMTNSEIEGV-----VETSDEWIVQRTGIRQRY-I
FABH_RHIL3       ---------MIRSVVRGFGAALPKRVMTNRDMEAI-----VDTSDEWIVQRTGIRQRY-V
FABH_RHIME       ---------MIRSVVRGFGAALPKRVMTNKEIESR-----VDTSDEWIVQRTGIRQRY-I
FABH_SINMW       ---------MIRSVVRGFGAALPKRVMTNKEMESK-----VDTSDEWIVQRTGIRQRY-I
FABH_AGRRK       ---------MIRSVVRGFGAALPKRVMTNRDMEQV-----VDTSDDWIVQRTGIRQRY-I
FABH_AGRVS       ---------MIRSVVRGVGSALPKRLLSNREMETL-----VDTSDDWIVQRTGIKQRY-I
FABH_BRUA1       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUA2       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUAB       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUME       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUC2       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUSU       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUMB       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----IETSDEWIVQRTGIRERH-I
FABH_BRUO2       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_BRUSI       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----VETSDEWIVQRTGIRERH-I
FABH_OCHA4       ---------MIRSVVRGIGSALPKRVMKNTDFEGI-----IETSDEWIVQRTGIRERH-I
FABH_RHILO       ---------MIRSVVRGMGAALPRRIMKNADFEGM-----VETSDEWIVQRTGIRQRH-I
FABH_CHESB       ---------MIRSTVRGVGAALPRRVVTNKDLETR-----LETSDEWIVQRTGIRQRH-I
FABH_BARHE       ---------MIRSVVRGIGGALPKKSLSNDDIAKF-----VETSDSWIVQRTGIRQRY-I
FABH_BARQU       ---------MIRSVIRGVGSALPKKSLSNDEIAKF-----VETSDSWIVQRTGIRQRY-I
FABH_BART1       ---------MIRSIIRGVGSALPKRSLSNDELAKF-----VETSDAWIVQRTGIHQRY-I
FABH_BARBK       ---------MIRSVMCGVGSALPKKKLSNDEIAKF-----VETSDSWIVQRTGIHQRY-I
FABH_BRASB       --------MTIRSVVLGCGSYLPQRVVTNAELASR-----IETSDDWIVQRTGIRERH-V
FABH_BRASO       --------MTIRSVVLGCGSYLPQRVVTNAELASR-----IETSDEWIVQRTGIRERH-V
FABH_BRADU       -------MTKIRSVVLGCGSYLPEQVVTNAQLAAR-----IDTSDEWIVQRTGIRERH-I
FABH_ERYLH       ---------MIRAAIKGSGSALPRKVVTNEELAAR-----VDTSDEWIVERTGIRQRY-I
FABH_NOVAD       --------MSVRSVIRGSGSALPRRAVSNAEMTTM-----VDTTDEWIVERTGIRNRY-I
FABH_SPHAL       --------MTRRAILKGTGSALPRTRVSNAELAER-----VDTSDEWIVERTGIRFRH-I
FABH_SPHWW       ---------MRRAVVIGTGSALPRRQVSNAELART-----VDTSDEWIVERTGIRNRY-V
FABH_RHOCS       --------MPLRSVILGCGAYLPARVLTNEDLTRI-----VETSDEWIVERTGIKSRH-I
FABH_RHORT       ---------MWRSVIAGCGSYLPANKVTNANLAER-----VETTDAWIRERTGILVRH-F
FABH_MAGSA       --------MIVRSQIIGCGSYLPSRLVTNAELAAQ-----VDTSDEWIVERSGIRQRH-I
FABH_CAUVC       ----------MRSVVTGVGAYLPSKVVTNDDLAKF-----VDTSDEWIVERTGIRQRH-Q
FABH_HYPNA       --------MGRRSFIRGTGSYLPERVLTNDELSEM-----VETTDAWIQERTGIKKRH-V
FABH_RHOS1       --------MTIRAVVRGVGHYLPDRVVPNSELEAI-----VETTDEWIRTRSGIERRH-F
FABH_RHOS4       --------MTIRAVVRGVGHYLPDRVVPNSELEAI-----VETTDEWIRTRSGIERRH-F
FABH_RHOS5       --------MTIRAVVRGVGHYLPDRIVPNSELEAL-----VETTDEWIRTRSGIERRH-F
FABH_RUEPO       --------MAGRAVVKGVGHYLPERVVPNAAFEKT-----LDTTDEWIRSRSGIERRH-F
FABH_RUEST       --------MTRRAVVIGAGHYLPDRIVENAEFEAT-----LDTSDEWIRSRSGIERRH-F
FABH_ROSDO       --------MTLRAVVTGVGHYLPDRIVPNSEFEKT-----LDTNDEWIRARSGIERRH-F
FABH_DINSH       --------MGKRAVVTGVGHYLPSRVVPNSELETL-----VDTTDEWIRTRSGIERRH-F
FABH_JANSC       --------MIIRAVPVGIGHYLPERVVPNAEFEAMEG---LETSDEWIRARSGIERRH-F
FABH_PARDP       ---------MRRAIVRGTGHYLPERVVENSWFEDK-----LDTSDEWIRARTGIERRH-F
FABH_RHOCA       --------MTIRAVVRGVGHYLPARVVENAEFEGK-----LDTTDEWIRSRTGIERRH-F
FABH_EHRCJ       ---------MKRSLILGIGSYLPKKVVTNDELTLT-----IETSDEWIVKRTGIKQRH-I
FABH_EHRCR       ---------MKRSTILGIGSYLPKKIVTNDELALT-----VETSDEWIVKRTGIKQRH-I
FABH_EHRRG       ---------MRRSRILGIGSYLPKSLVTNDELACT-----VETSDEWIVKRTGIRQRY-I
FABH_EHRRW       ---------MRSSRILGIGSYLPKSLVTNDDLACT-----VATSDEWIVKRTGIRQRY-I
FABH_WOLPM       ---------MNKSFILSTGSYLPRKMLSNNEIASI-----VETSDEWIRQRTGIVQRH-I
FABH_WOLPP       ---------MSKSFILSTGSYLPKKILSNNEIALI-----VETNDEWIRQRTGIVQRH-I
FABH_WOLTR       ---------MNKSFILSTGSYLPKKKLGNDEIALM-----VETSDEWIRQRTGITQRY-I
FABH_ANAMM       ---------MRRSVFCGVGAFLPAKVITNDDLSLM-----VDTTDEWVFRRTGIKRRH-V
FABH_RICRO       ----------MTCKIIGCGGYLPSKIVSNDELAKF-----VDTNDEWIRTRTGITQRH-I
FABH_RICRS       ----------MTCKIIGCGGYLPSKIVSNDELAKF-----VDTNDEWIRTRTGITQRH-I
FABH_RICCN       ----------MTCKIIGCGGYLPSKIVSNDELAKF-----VDTNDEWIRTRTGITQRH-I
FABH_RICM5       ----------MTCKIIGCGGYLPSKIVSNDELAKF-----VDTNDAWIRTRTGITQRH-I
FABH_RICFE       ----------MTCKIIGSGGYLPSKIVSNDELAKF-----VDTNDEWIRTRTGITQRH-I
FABH_RICAH       ----------MTCKIIGCGGYLPSKIVSNDELAKF-----VETNDEWIRTRSGISQRH-I
FABH_RICCK       ----------MTCKIIGCGQYLPSKIVSNDELTKF-----VDTNDEWIRTRTGITQRH-I
FABH_RICPR       ----------MTCKIIGSGGYLPPKIISNDELTKF-----VDTNDKWIRTRTGILQRH-I
FABH_RICTY       ----------MTCKIIGSGGYLPQKIISNDELTKF-----VDTNDKWIRTRTGIFQRH-I
FABH_RICB8       ----------MTCKIIGCGGYLPPKVVSNDELAKF-----VDTNDEWIRTRTGISQRH-I
FABH_RICBR       ----------MTCKIIGCGGYLPPKVVSNDELAKF-----VDTNDEWIRTRTGISQRH-I
FABH_NEOSM       ---------MKKTNFLSFGCYLPKKVLTNFDLEELVD-----TSDEWILRRTGIKTRY--
FABH_AQUAE       ----------MGTKIIGTGVYLPKNVLTNFDLEKIVD-----TSDEWITTRTGIKERR-I
FABH_PERMH       -------MGDIKAEIKGIGINIPERILTNFDLEKFLD-----TSDEWITTRTGIKERR-I
FABH_SULDN       ---------MAYAAFRSIGAYVPSKILSNEDLSKMVD-----TTDEWITKRTGIKERH-I
FABH_SULNB       ----MSQTKPVYASFRSIGAYVPSKILSNADLEKMVD-----TTDEWIVKRTGIKERH-I
FABH_ARCB4       ---------MIYAAFRSIGAYIPPKIMSNADFEKIID-----TSDEWITKRTGIKERR-I
FABH_HELP2       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELPG       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELPY       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELPS       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELPJ       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELPH       --------MEFYASLKSIAMHVPSERVKNAEFQQFLD-----TSDEWIEKRTGIKERR-F
FABH_HELAH       --------MEFYASLKSIAMHAPSECIKNVAFQEFLD-----TSDEWIEKRTGIKERR-F
FABH_HELHP       -------MGKIYASLKSIASYIPPTCISNVDFEKTLD-----TNDEWITKRTGIKTRY-F
FABH_CAMC1       ---------MPKASLISIASYVPEKILTNFDFEKMVD-----TSDEWIVKRTGIEQRH-I
FABH_CAMC5       ---------MLKASLISIASYVPEKILTNFDLEKMVD-----TSDEWIVKRTGIKERH-I
FABH_CAMFF       ---------MKKASIISVGAYIPKDILTNFDLEKMVD-----TSDEWIVKRTGIKTRH-L
FABH_CAMHC       ---------MKNAAMLSIGAYVPPYELSNFDLEKMVE-----TSDEWIVKRTGIHTRH-I
FABH_CAMJE       ---------MLKASLKSIASYIPEKILSNADLEKMVD-----TTDEWITRRTGIKERR-I
FABH_CAMJJ       ---------MLKASLKSIASYIPEKILSNADLEKMVD-----TTDEWITRRTGIKERR-I
FABH_CAMJ8       ---------MLKASLKSIASYIPEKILSNADLEKMVD-----TTDEWITRRTGIKERR-I
FABH_CAMJR       ---------MLKAGLKSIASYIPEKILSNADLEKIVD-----TTDEWITRRTGIKERR-I
FABH_CAMJD       ---------MLKASLKSIASYIPEKILSNTDLEKMVD-----TTDEWIARRTGIKERR-I
FABH2_BACTN      -------MEKINAVITGVGGYVPDYILTNEEISKMVD-----TNDEWIMTRIGVKERH-I
FABH_BACV8       -------MEKINAVITGVGGYVPDYVLTNEEISRMVD-----TNDEWIMTRIGVKERR-I
FABH1_BACTN      -------MDKINAVITGVGGYVPDYVLTNDEISKMVD-----TTDEWIMGRIGIKERH-I
FABH_PARD8       -------MDKINAVITGVGGYVPEDVLTNEDISKMVD-----TTDEWIMTRVGIKERR-I
FABH_PORG3       -------MNKINAAITAVGAYLPEDVITNDDLEKMVD-----TNDEWIMTRVGIKERR-I
FABH_PORGI       -------MNKINAAITAVGAYLPEDVITNDDLEKMVD-----TNDEWIMTRVGIKERR-I
FABH_AZOPC       -------MNKIHAVITGIGGYVPEYKLTNEEISTMVD-----TSDEWILKRIGIKERR-I
FABH_PELLD       ----------MNAAISATARYLPEGVLSNLDLERMLD-----TNDEWIRSRTGISERR-I
FABH_CHLPM       ----------MNAAITATAKYLPDGILSNLDLERMLD-----TNDEWIRTRTGISERR-I
FABH_CHLCH       ----------MKAAITATANYLPPDILSNHDLELMLD-----TNDEWIRSRTGIGERR-I
FABH_CHLPD       ----------MKAAITATAKYLPQSVLSNHDLEQMLE-----TNDEWIRSRTGIGERR-I
FABH_CHLTE       ----------MKAAITTTAKYLPEEIMSNQDLERILD-----TNDEWITTRTGIKERR-I
FABH_KORVE       ------MTSVRRAKITALGTYVPPRVLSNFDLEKMVD-----TTNQWILERTGIRERH-L
FABH_SOLUE       ---------MPKAKISALGCYTPPRVLTNQDLEKLVD-----TNDQWIMERTGIRERH-I
FABH2_VIBVU      -------MTNYYAEITGWGKCLPPAVLSNDDLSTFLD-----TSDEWIRTRTGIENRR-I
FABH2_VIBVY      -------MTNYYAEITGWGKCLPPAVLSNDDLSTFLD-----TSDEWIRTRTGIENRR-I
FABH2_VIBPA      -------MTNYYAEITGWGKCVPPTVLSNDDLSTFLD-----TSDEWIRTRTGIENRR-I
FABH2_VIBCH      -------MTQCYAEITGWGKCLPPATLSNHDLSTFLD-----TSDEWIQSRTGIEQRR-I
FABH_PSET1       ---------MPYAHITGWGKCIPPASISNDEISKIVD-----TTDEWITSRTGIKSRR-V
FABH_TRIV2       -------MQNLGIAITGSGSAAPETSLHNEELSQLVE-----TSDEWISTRTGIRQRRLA
FABH_NOSS1       -------MQNLGIAITGSGSAVPETSLHNEELSQLVE-----TSDEWISTRTGIRQRRLA
FABH_TRIEI       -------MTNIGVSIIGSGSAIPKTSLDNQQLSQIVE-----TSDEWIISRTGINKRQLV
FABH_ACAM1       -----MQQMATGLAVTGCGSAAPETSLDNHGLSQIVD-----TSDEWIASRTGIRSRHLA
FABH_SYNE7       -----MTRPGVGVAITGSGSAVPSTTLSNDQLSQLVE-----TSDEWIRSRTGIGQRRVA
FABH_SYNP6       -----MTRPGVGVAITGSGSAVPSTTLSNDQLSQLVE-----TSDEWIRSRTGIGQRRVA
FABH_MICAN       -----MNGFGAAVVITGCGSATPAQFLSNEELSQIVE-----TSDEWIKSRTGIGKRHLA
FABH_SYNY3       -----MNTLGSGLKIIGSGTAIADQSLTNQDLSNIVE-----TSDEWIQSRTGMRQRYIC
FABH_THEEB       -------MTVQGVKFSGVGAATPRQCLTNAHLSALVD-----TSDEWIQSRTGIQERHVA
FABH_GLOVI       ---------MPAVQMTGVGGAVPAQVLTNYHLSELVT-----TSDEWIASRTGIRSRRIL
FABH_PROM0       --MEGIDFNQIGVSFKGSGSYVPDQILTNQKISQKVD-----TSNEWIKSRTGISERRIS
FABH_PROM9       --MEGIKFNQIGVSFKGSGSYVPDQILTNETISQKVD-----TSDEWIKSRTGISERRIS
FABH_PROM2       --MEEIKFNQIGVSFKGSGSYVPDQILTNEEISQKVD-----TSDEWIKSRTGISERRIS
FABH_PROM5       --MEVINSNQIGVSFKGSGSYVPHQILTNHEISKKVD-----TSDEWIKSRTGISQRRIS
FABH_PROMP       --MEGINLNQIGVSFKGSGSYVPNQILTNQEISKKVE-----TSDEWIKSRTGISQRRIS
FABH_PROMA       --MTGNSSNGYGVSLVGSGSATPSQIVSNDQLALRVD-----TNDEWVKTRTGIRERRII
FABH_PROMT       --MISNSQLDLGISFVGSGSATPQKIIKNDQLGQRVD-----TNDEWIQTRTGIGQRRVI
FABH_PROMM       --MAETSTIGSGVALVGCGSATPSQRISNDQLGQRVD-----TSDAWIRSRTGISARRVI
FABH_SYNR3       ---------MKGIRLCGSGAAVPRLRISNDDLSGRVE-----TSDEWIRTRTGIAARRVA
FABH_SYNPW       --MAGQSPPVLGVGLIGSGSAQAAQVISNDQLSQRVD-----TNDEWIRTRTGIGRRRVS
FABH_PORPU       ----------MGVHILSTGSSVPNFSVENQQFEDIIE-----TSDHWISTRTGIK-KRHL
FABH_PORUM       ----------MGVHILSTGSSVPNFSVENQQFEDIIE-----TSDHWISTRTGIK-KSIL
FABH_PYRYE       ----------MGVHILSTGSSVPNFSVENQQFEDMIE-----TSDHWISTRTGIK-KRHL
FABH_GRATL       ---------MQGAQIISIGSAVPDLCINNKEISQIVE-----TSDEWIVTRTGIQERRVL
FABH_RHOBA       ------MGNLKGVRIAGTGSYVPERIVTNEDLAALGC-----DSD-WIVRRTGILQRRHA
FABH1_STRCO      MSKIKPSKGAPYARILGVGGYRPTRVVPNEVILEKID-----SSDEWIRSRSGIETRHWA
FABH_STRGA       MSKIKPAKGAPYARILGVGGYRPTRVVPNEVILETID-----SSDEWIRSRSGIQTRHWA
FABH_KOCRD       MATIKQNIPHAHTRILGIGAYRPSEIVTNDDVCQWIE-----SSDEWIVKRTGIHTRHRA
FABH_MYCA1       MKQISATSGPTNIGLLSVGSYRPQRAVTNDELCQNID-----SSDEWIYSRTGIKTRRFA
FABH_MYCPA       MKQIAATSGPTNIGLLSVGSYRPQRVVTNDELCQNID-----SSDEWIYSRTGIKTRRFA
FABH_MYCMM       MTEIATTSGISSVGLLSVGAYRPTRVVTNDEICENID-----SSDEWIYSRTGIKTRRFA
FABH_MYCUA       MTEIATTSGISSVGLLSVGAYRPTRVVTNDEICENID-----SSDEWIYSRTGIKTRRFA
FABH_MYCTA       MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHID-----SSDEWIYTRTGIKTRRFA
FABH_MYCTU       MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHID-----SSDEWIYTRTGIKTRRFA
FABH_MYCBO       MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHID-----SSDEWIYTRTGIKTRRFA
FABH_MYCBP       MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHID-----SSDEWIYTRTGIKTRRFA
FABH_MYCBT       MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHID-----SSDEWIYTRTGIKTRRFA
FABH_MYCA9       MTDIAEITGINKIGLLSLGAYRPERVVTNDEICERIE-----SSDEWIYTRTGIKTRRFA
FABH_STRLI       MPGLRVPE-RRFSRVLGVGSYRPRREVSNKEVCTWID-----STEEWIETRTGIRSRRIA
FABH2_STRAW      --------MN-GSRIAAVGHYQPAKVLTNEDLASLVD-----TSDEWIRSRVGIRTRHFA
FABH4_STRCO      --------MHQGSRITAVGHYQPARILTNEDLAGMVD-----TSDEWIRSRVGIRTRRIA
FABH2_STRCO      --MSAARGGRAGAVVTGVGTCLPETVVDNDEVSRHLD-----TDHAWIHSRTGIERRRRV
FABH5_STRCO      --MSGA------GVLAGLGTALPARLVTNEELSRHLD-----TDDEWIRSRTGI-GQRYW
FABH3_STRCO      --MTRA------SVLTGLGSCLPSRCVTNAELERTMD-----TSDEWIRARTGIAQRYVA
FABH_PSEA8       --MPRA------AVVCGLGSYLPEAVLSNDMLAAELD-----TSDAWISSRTGV-RQRHI
FABH_PSEAB       --MPRA------AVVCGLGSYLPEAVLSNDMLAAELD-----TSDAWISSRTGV-RQRHI
FABH_PSEAE       --MPRA------AVVCGLGSYLPEAVLSNDMLAAELD-----TSDAWISSRTGV-RQRHI
FABH_LACBA       -------MKFENFNILATAGYTPERVVPNSELTTMMT-----TSDEWIVQRTGIHQRHVV
FABH_LACH4       -------MKFEDFKIMATASSAPDHVVTNDELATMMD-----TSDEWITQRTGIKRRRIA
FABH2_LACPL      --------MTTNFSILASAKALPTTKVTNQELTQLMA-----TSDDWIKQRTGIRSRHVA
FABH_OENOB       ---------MRTIKIIQTASQLPEKIVSNDDLAGMMD-----TSDEWIRSRTGIFKRHIA
FABH_LACDA       ---------MTYARIAKSSRYLSEFAVSNDDLSQIME-----TSDEWIKTRTGISSRRIS
FABH_LACDB       ---------MTYARIAKSSRYLPEFAVSNDDLSQIME-----TSDEWIKTRTGISSRRIS
FABH_LACRD       ---------MQNLRITSTASYHPPLNITNQQLSTIMD-----TSDEWIKTRTGIHQRYIS
FABH_LACRJ       ---------MQNLRITSTASYHPPLNITNQQLSTIMD-----TSDEWIKTRTGIHQRYIS
FABH_LACSS       ----------MAFKIIETASALPANIVTNDDLTAIME-----TSNEWIESRTGILERRIS
FABH_LACLM       ---------MTFAKITQAAHYVPENVVSNDDLSKIMD-----TNDEWIYSRTGIKNRHIS
FABH_LACLS       ---------MTFAKITQAAHYVPENVVSNDDLSKIMD-----TNDEWIYSRTGIKNRHIS
FABH_LACLA       ---------MTFAKITQVAHYVPENVVSNDDLSKIMD-----TNDEWIYSRTGIKNRHIS
FABH_STRA1       ---------MVFAKISQLAHYAPSQIIKNEDLSLIMD-----TSDDWISSRTGIKQRHIS
FABH_STRA3       ---------MVFAKISQLAHYAPSQIIKNEDLSLIMD-----TSDDWISSRTGIKQRHIS
FABH_STRA5       ---------MVFAKISQLAHYAPSQIIKNEDLSLIMD-----TSDDWISSRTGIKQRHIS
FABH_STRE4       ---------MVFSKISQVAHYTPKQVISNDDLSQIMD-----TSHEWISSRTGIEKRHIS
FABH_STRS7       ---------MVFSKISQVAHYTPKQVISNDDLSQIMD-----TSHEWISSRTGIEKRHIS
FABH_STREM       ---------MVFSKISQVAHYTPKQVISNDDLSQIMD-----TSHEWISSRTGIEKRHIS
FABH_STRP1       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPG       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRP3       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPM       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRP8       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPQ       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPB       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPC       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPD       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRP6       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPZ       ---------MIFSKISQVAHYVPQQLVTNNDLASIMD-----TSHEWIFSRTGIAERHIS
FABH_STRPF       ---------MIFSKISQVAHYVPQQLVTNNDLANIMD-----TSHEWIFSRTGIAERHIS
FABH_STRU0       ---------MTYSKISQAAHHLPEQVISNDDLSLILE-----TNDQWISSRTGIKERRIS
FABH_STRGC       ---------MKFAKISQVAHYAPEQVVTNDDLAQIMD-----TSDEWISSRTGIKKRHIS
FABH_STRSV       ---------MNYAKISQVAHYAPRQVVSNDDLAEIMD-----TSDEWISSRTGIKNRHLS
FABH_STRP7       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRPS       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRP2       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRPI       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRR6       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRPJ       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRPN       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRZJ       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRZT       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRP4       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRZP       ---------MAFAKISQVAHYVPEQVVTNHDLAQIMD-----TNDEWISSRTGIRQRHIS
FABH_STRMU       ---------MTFAKISQAAYYVPSQVVTNDDLSKIMD-----TSDEWITSRTGIRERRIS
FABH_STRT1       ---------MAFAKISQVAHYAPAQVVTNDDLSKIMD-----TSDEWIRSRTGIQERRIS
FABH_STRTD       ---------MAFAKISQVAHYAPAQVVTNDDLSKIMD-----TSDEWIRSRTGIQERRIS
FABH_STRT2       ---------MAFAKISQVAHYAPAQVVTDDDLSKIMD-----TSDEWIRSRTGIQERRIS
FABH_STRS2       --------MRNHAKISQVAHYLPKKIVTNDDLAQRME-----TSDEWIRSRTGIGQRHIV
FABH_STRSY       --------MRNHAKISQVAHYLPKKIVTNDDLAQRME-----TSDEWIRSRTGIGQRHIV
FABH_ENTFA       --------MKNYARISCTSRYVPENCVTNHQLSEMMD-----TSDEWIHSRTGISERRIV
FABH1_LACPL      --------MPTYTKLTAMGQYVPGRVVDNDELAAIMD-----TSDEWIQAHTGIKTRHYA
                                   .         :                 *:    *:  :   

FABH1_BACAN      D----DTIDTSYMAVEASKKALEDA----GISGEDIDLILVATVTPDRA--FPAVACVIQ
FABH1_BACCR      D----DTIDTSYMAVEASKKALEDA----GISGEDIDLILVATVTPDRA--FPAVACVIQ
FABH1_BACSU      A----DDVFSSHMAVAAAKNALEQA----EVAAEDLDMILVATVTPDQS--FPTVSCMIQ
FABH_BACP2       S----DDVNTSHMALAAAKKALADA----DVAAEDIDMILVATVTPDQA--FPTVACMIQ
FABH_GEOKA       A----DDIDTSDMAYFAAKRALQDA----GMEAKDIDLILVATVTPDRP--FPSVACMLQ
FABH1_BACHD      P----DNVDTSDMAYEASVKALKAA----GVSAEEIDLILVATVTPDMP--FPTVSTLVQ
FABH_OCEIH       T----EEVDTSDMAFHAALGALEEA----NLAAEDIDLILVATVTPNTS--FPSVACIIQ
FABH_LISIN       R----DDEYTHDLAYEAAKVAIENA----GLTPDDIDLFIVATVTQEAT--FPSVANIIQ
FABH_LISW6       R----DDEYTHDLAYEAAKVAIENA----GLTPNDIDLFIVATVTQEAT--FPSVANIIQ
FABH_LISMF       R----DDEYTHDLAYEAAKVAIKNA----GLTPDDIDLFIVATVTQEAT--FPSVANIIQ
FABH_LISMO       R----DDEYTHDLAYEAAKVAIKNA----GLTPDDIDLFIVATVTQEAT--FPSVANIIQ
FABH1_STAES      D----EDQDTSDLAYNASIKAIEDA----GIQPVDIDMIIVATATGDMP--FPSVANILQ
FABH_STAEQ       D----EDQDTSDLAYNASIKAIEDA----GIQPVDIDMIIVATATGDMP--FPSVANILQ
FABH_STAAM       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAN       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAR       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAA9       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAB       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAA1       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAA2       D----DDQDTSDLAYEASVKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAA3       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAE       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAA8       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAC       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAW       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAS       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAAT       D----DDQDTSDLAYEASLKAIADA----GIQPEDIDMIIVATATGDMP--FPTVANMLQ
FABH_STAHJ       S----ENQDTSDLAFEASKKAIKDA----GITPADIDMIIVATATGDMP--FPSVANILQ
FABH_STAS1       G----EDEETSDMAYQASLKAIEDA----GIEASEIDMIIVATSTGDFP--FPTVANILQ
FABH_DEIDV       A----EHEYTSDMGVRAVQDMLRRD----PQALTDVDAIICATVSPDAL--MPSTAALIG
FABH_DEIGD       A----ENEFTSDLGVRAVQDLLARD----PDGLRDVDVVICATATPDAL--FPSTAALIA
FABH1_DEIRA      A----PGEFASHIGAKAVQDMLARD----PDALKDVDLVIYATCTPDAM--FPSTAALVA
FABH2_DEIRA      A----PDESSSVLGIRATQDLAGRF----PGALDGVNLVICATSSPDAM--FPSTAALIA
FABH2_BACAN      S----EDEYSSNLAIKAVENLCTTY----KKNLEDVDCIIVATTTADYV--FPSVACQIQ
FABH2_BACCR      S----EEEYSSNLAIKAIENLCTTY----KKNLEDVDCIIVATTTADYV--FPSVACQIQ
FABH2_BACSU      D----EHQFTSDLCIEAVKNLKSRY----KGTLDDVDMILVATTTSDYA--FPSTACRVQ
FABH2_BACHD      A----DDEFTSDIGYKAVQDLIARY----EKSVDDVDMIIVCTFTPDFK--TPSAASLIQ
FABH2_STAES      D----ENEYTSDLSYKAVLDLQEKY----QVDLTDVDMIINTTLTPDYK--TPSVASYVQ
FABH_ACHLI       -----QGETAIDMAYKAALKAVENK----NYDKEKIDLIIVASITSPVK--TPSIANLIQ
FABH_FUSNN       S----KDQATSDLATEASLKAIKNA----KISKEDVDMIILATTTADYI--AQGAACIVQ
FABH_CLOAB       -----INENTSDLGAKAALRAIEDS----NIKPEEIDLIIVATTSPDSY--TPSVACIVQ
FABH_CLONN       -----KGENTSHMAIKSAKDVLRKS----SIKADELDLIIVATCTPDCF--VPSTACIVQ
FABH_CLOB1       -----KGENTIYMATESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOBH       -----KGENTIYMATESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOBJ       -----KGENTIYMATESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOBL       -----KGENTIYMATESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOBM       -----KEENTIYMATESAKEAIKNA----NIDANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOB6       -----KEENTIYMAIESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOBK       -----KGENTIYMATESAKEAIKNA----NIEANDLDLIIVATLTPDNF--MPSTACSVQ
FABH_CLOK1       -----QGENTSEMATKAAINAMKSA----NIKAEDIDLIVVATITPDNF--IPSTACIVQ
FABH_CLOK5       -----QGENTSEMATKAAINAMKSA----NIKAEDIDLIVVATITPDNF--IPSTACIVQ
FABH_CLOTE       -----KGENTSDLGTKAALDALRKG----GISPEELDLIIVATITPDYF--TPSTACIIQ
FABH_CLOB8       -----EGENTSDISTKAAKLALERA----GIDAKDLELIIVATISPDMF--IPSVACLVQ
FABH_CLOP1       -----LDENTSDLAVEASKKALNQA----GLSAEDIDLIILATVTPDNF--TPSTACIVQ
FABH_CLOPE       -----LDENTSDLAVEASKKALSQA----RLSAEEIDLIIVATVTPDNF--TPSTACIVQ
FABH_CLOPS       -----LDENTSDLAVEASKKALNQA----GLSAEEIDLIIVATVTPDNF--TPSTACIVQ
FABH_CLOD6       K----ESEATSDLASKAALKAIECA----KLNVEDIELIILATITPDMS--LPSTACIVQ
FABH_CALS4       D----PSQATSDLATEASKRALEDA----NLKPEDLDMIIVATVTPDMN--FPSTACIVQ
FABH_DESHD       A----PETPVSELCYQAALRALEDA----KLAPEELDLVIVATITPDFV--FPATACLVA
FABH_DESHY       E----PETPVSELCYQAAVRALEDA----KLAPEELDLVIVATITPDFV--FPATACLVA
FABH_SYMTH       A----PHEASSDYALRAAREAMAQA----GVTPEQIDLIICATVTPDMP--MPATAALVQ
FABH_NATTJ       D----ENTATSHLSVQAAEIALNKS----GIEPADLDMIIVATVTPDMA--FPSTACLVQ
FABH_SYNWW       D----KDTATSDLCWQAAKMALERS----ATEAKELDLIIVGTSSPDML--FPSTACIVQ
FABH_CALS8       D----GTTSTTDLAVRAAKNAMDKA----GILPDDIDLVIVATVTPEMF--FPSTACLVQ
FABH_CHLCV       AA---PGEYASIMGAKAAEKAIEKA----GLTKDQIECIIFSTSAPDYI--FPSSAALAQ
FABH_CHLPN       AG---PQEYTSLMGAIAAEKAIANA----GLSKDQIDCIIFSTAAPDYI--FPSSGALAQ
FABH_CHLTA       AS---AEEFSSFMGAKAAEKAIEAA----KISKSQVDCIVFSTAAPDYI--FPSSAALAQ
FABH_CHLTR       AS---AEEFSSFMGAKAAEKAIEAA----KISKSQVDCIVFSTAAPDYI--FPSSAALAQ
FABH_CHLMU       AS---AEEFSSFMGAKAAEKAIEAA----KISKSQIDCIVFATAAPDYI--FPSSAALAQ
FABH_DESPS       AG---PGEQAYILASRAAKNALDAA----GLVAEDLDMIVVGTISAHMV--MPSCACMIQ
FABH_DESVH       VA---PGQTTSDLAVEAARAALADA----ALDTADITHVLVATCTPDAS--CPNTACIVA
FABH_DESVV       VA---PGQTTSDLAVEAARAALADA----ALDTADITHVLVATCTPDAS--CPNTACIVA
FABH_DESVM       LA---EGQNASDAATEAARLALADA----GMEPGEITHVINATCTPDYL--CPNTACLVE
FABH_DESAG       AA---EGETTSDLGAKAALQALANA----GLHADALTHILVATCTPDAM--CPSTACLIE
FABH_ROSCS       AG---PGEHTSALSIAAGRAALARA----GLDAAQIDTVILATCTPDRP--FPATACTVQ
FABH_ROSS1       AG---PGEYTSTLSIAAGRAALERA----GLDAAQIDTVILATCTPDRP--FPATACTIQ
FABH_RUBXD       VA---EGQSCVTLAVEAARRALEHA----GVPGASVDLVVCATSTNPES--MPSVACLVG
FABH1_VIBVU      AA---ENETVADMGFYAAQNAIEMA----GIDKNDIDLIIVATTSGSHT--FPSSACQVQ
FABH1_VIBVY      AA---ENETVADMGFYAAQNAIEMA----GIDKNDIDLIIVATTSGSHT--FPSSACQVQ
FABH1_VIBPA      AA---EDETVADMAFYAAENAIDMA----GIDKNDIDLIIVATTSSSHT--FPSSACQVQ
FABH1_VIBCH      AA---DNETVADMAFFAAQNAINMA----GIDKHDIDMIIVATTSASHT--FPSAACQVQ
FABH_ALIF1       AG---EDESVATMAHLASVNAIEMA----GIDKNDIDLIILATSTPTYS--FPSAACEVQ
FABH_PSEA6       IG---EHETAATMGFEASKKALEAA----GIDAKSLDMIVCATTSGRYS--LPSTACEIQ
FABH_SHEON       AA---QDETVSTMGYLAALNALEMA----GIEASDLDMIICGTTSAANA--FPAAACEIQ
FABH_PSYIN       AN---QQETIAFMGKEAALQALEAA----NLTAEDLDLIIVGTTSNHNA--FPSAACEIQ
FABH_ACTP2       AA---ADETVATMGAQAAKNALEIA----NIDHNEIDLIVVGTTTNSHA--YPSAACQIQ
FABH_HAEDU       AA---ADETVATMGAAAAHKACEMA----AIDVNEIELIVVATTTHSHA--YPSAACQIQ
FABH_HAEI8       AA---EDETVATMGFEAAKNAIEAA----QINPQDIELIIVATTSHSHA--YPSAACQVQ
FABH_HAEIG       AA---EDETVATMGFEAAKNAIEAA----QINPQDIELIIVATTSHSHA--YPSAACQVQ
FABH_HAEIN       AA---EDETVATMGFEAAKNAIEAA----QINPQDIELIIVATTSHSHA--YPSAACQVQ
FABH_ACTSZ       AA---EHETVATMGFEAAKKALETA----KIDPNEIELIIVGTTSNSHA--YPSAACQIQ
FABH_HAES1       AG---ENETVATMGFKAAKNALQLA----NICPNDIDLVLVATTSHSYA--YPSAACQIQ
FABH_HISS2       AG---ENETVATMGFEAAKNALQLA----NICPNDIDLVLVATTSHSYA--YPSAACQIQ
FABH_PASMU       AE---ASETVATMGFEAAQNCLAVS----PMDVNEIDLIVVATTSATHA--FPSTACQIQ
FABH_BAUCH       AS---ANETVFSMGSSAAEQALHMA----GISANKVGMIIVATTSSSHA--FPSSACQIQ
FABH_SODGM       AR---ADETVSSMGRDAAEQALTMA----GIAVQKVGMIIVATTSSSHA--FPSSACQIQ
FABH_BLOFL       SN---SSETVAKMGYFASKKALDMS----CIEANEIGIIIVATTSSSHA--FPSSACQIQ
FABH_BLOPB       ST---SDETVAKMGYFAAKRALDMS----CVHSDKVGIIIVATTSSSHA--FPSSACQIQ
FABH_SALCH       AA---PNETVATMGFTAANRAIEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SALPB       AA---PNETVATMGFTAANRAIEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SALTY       AA---PNETVATMGFTAANRAIEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SALTI       AA---PNETVATMGFTAANRAIEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SALPA       AA---PDETVATMGFTAANRAIEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SALAR       AA---PNETVATMGFTAANRALEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_CITK8       AA---PNETVATMGYTAANRALEMA----GIDKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECO24       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SHISS       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECO57       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOLI       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOUT       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOK1       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOL5       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOL6       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SHIBS       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SHIF8       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SHIFL       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOHS       AA---QNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_ECOLC       AA---QNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_SHIDS       AA---PNETVSTMGFEAATRAIEMA----GIEKDQIGLIVVATTSATHA--FPSAACQIQ
FABH_KLEP7       AA---AHETVATMGFEAAKQALAMA----GVSAEQIGLIIVATTSGTHA--FPSSACQIQ
FABH_ENT38       AA---PDETVSTMGYEAGLRALEMA----GVDKEEIGLIVVATTSSTHA--FPSAACQIQ
FABH_CROS8       AA---PGETVATMGYEAALRAIDMA----GIDKGQIGLIIVATTSATHA--FPSAACQVQ
FABH_YERP3       AG---LDETVATMGFQAAEKALEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERPS       AG---LDETVATMGFQAAEKALEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERPA       AG---LDETVATMGFQAAEKALEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERPE       AG---LDETVATMGFQAAEKALEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERPN       AG---LDETVATMGFQAAEKALEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERPP       AG---LDETVATMGFQAAEKTLEMA----GIDKDDIGLIIVATTSSSHA--FPSSACQVQ
FABH_YERE8       AG---PDETVASMGFQAAKKALEMAVIDEGIDKKDIGLIIVATTSSSHA--FPSSACQVQ
FABH_SERP5       AA---ADETVATMGFHAAEKALEMA----GVAKEDIGLIVVATTTSTHA--FPSSACQVQ
FABH_PECAS       AA---PDENVATMGYRAAQKALEMA----NVDASEVGLLIVATTSSSHA--FPSSACQVQ
FABH_PHOLL       AT---DDETVAVMGFRAAKKAIEMS----GIDKEQIDLIIVATASSTHA--FPSSACQIQ
FABH_MARHV       AL---PGQSTVDLAEQAALNAIEAA----GIEATDIDLIVFATTTPDKV--FPSCACILQ
FABH_THISH       AG---PEETTCDLAERAARRAMEMA----GRSSADIDLIIVATTTPDRV--FPSTACLLQ
FABH_ALKEH       VA---PDQTCGDLAEEAARRALEAA----DVSLSSIDLVIVGTCTPDRV--FPSTACLLQ
FABH_XANAC       VA---DDQTTSDLAYFASLRAMEAA----GVTADEIDLIVIGTTTPDLI--FPSTACLLQ
FABH_XANC5       VA---DDQTTSDLAYFASLKAMEAA----GVTAEEIDLIVIGTTTPDLI--FPSTACLLQ
FABH_XANOM       AA---DDQATSDLAYFASLKAMEAA----GVTADEIDLIVIGTTTPDLI--FPSTACLLQ
FABH_XANC8       VA---DDQTTSDLAYFASLKAMEAA----GVTADEIDLIVVGTTTPDLI--FPSTACLLQ
FABH_XANCP       VA---DDQTTSDLAYFASLKAMEAA----GVTADEIDLIVVGTTTPDLI--FPSTACLLQ
FABH_XYLFA       AA---EGETTSDLAYEAAICALEAA----EVRSADLDLIVVGTTTPDLI--FPSTACLLQ
FABH_XYLFT       AA---EGETTSDLAYEAAIRALEAA----EVRSADLDLIVVGTTTPDLI--FPSTACLLQ
FABH_METCA       AA---ADETASSMAEIASRQALEAA----AIDPHDLDLIILATSSPDRV--FPSTACLLQ
FABH_THIDA       AA---DGEFTSDLATAAARAALEAA----NLAADDIDLLLVATTTPDLV--FPSTACIVQ
FABH_ACIET       AD---RDVTSSDLALEASRRALEAA----GCQAQDLDLIIVATSTPDMV--FPSTACILQ
FABH_ACISJ       AD---RDVTSSDLALEASRRALEAA----GCQAQDLDLIIVATSTPDMV--FPSTACILQ
FABH_DELAS       AA---PDVASSDLALEASKKALEAA----GCQPQDIDLIIVATSTPDMV--FPSTACILQ
FABH_ACIAC       AE---RDVCSSDLGLEAARQALDAA----GVQPADIDLIIVATSTPDMV--FPSTACILQ
FABH_VEREI       AA---PDVSSSDLALQAARLALQAA----GLQATDIDLIIVATSTPDMV--FPAAACILQ
FABH_POLNA       AA---PDVTSSDLGLEAAKRAIEAA----GLQAADIDLIIVATSTPDMV--FPSVACILQ
FABH_POLSJ       AA---PDVSSSDLAVKAARHALEAA----GRQASDIDLIIVATSTPDMV--FPSAACIVQ
FABH_VARPS       AA---PEVTSSDLALEAARHALEAA----GRKAEDIDLIIVATSTPDMV--FPSSAAILQ
FABH_RHOFT       AA---PEVCSSDLGLEAARRALQAA----GAKAQDIDLIIVATSTPDMV--FPSTACILQ
FABH_BURCC       AA---PDVTTSDLALEASRRAIEAA----GVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURCH       AA---PDVTTSDLALEASRRAIEAA----GVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURCA       AA---PDVTTSDLALEASRRAIEAA----GVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURL3       AA---PDVTTSDLALEASRRAIEAA----GIDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURVG       AA---PDVTTSDLAYQAARRAIEAA----DIDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURM7       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURM9       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURMA       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURMS       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURP1       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURPS       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURP6       AA---PDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURP0       AA---SDVTTSDLALVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_BURTA       AA---PDVTTSDLAFVAAQRAIEAA----DVDPQSIDLIIVATSTPDFV--FPSTACLLQ
FABH_PARP8       AE---PDVTTSDLALIASQRAIEAA----DVDPQAIDLIIVATSTPDFV--FPSTACLLQ
FABH_CUPNH       AE---PDVTSSDLAVKAAEQAIEAA----GIDRQSIDLIIVATSTPDFV--FPSTACIVQ
FABH_CUPTR       AE---PDVTSSTLAVKAAEQAIEAA----GIDRQDIDLIIVATSTPDFV--FPSTACIVQ
FABH_CUPPJ       AD---PDVASSDLAVKAAEQAIEAA----GIDRQSIDLILVATSTPDFV--FPSTACIIQ
FABH_RALPJ       AE---PDVTCSDLAVRAAERAIEAA----GIDRSELDLILVATSTPDFV--FPSTACLVQ
FABH_RALSO       AE---PDVTCSDLAAKAAERAIEAA----GIDRAEIDLILVATSTPDFV--FPSAACLVQ
FABH_HERAR       AD---ADMQSSDLAVEAAKRALDMA----KLAANDIDLIILATSTPDFFGGFPSTACVVQ
FABH_JANMA       AD---AGVQSSDLAVEAAKRALEMA----KLGVDDVDLIILATSTPDFFGGFPSTACVVQ
FABH_POLNS       AA---ENELTSDLAVRAAEAALSST----GINSADLDLIILATSTPDHLGGFPSTACVVQ
FABH_POLAQ       AA---ENELTSDLALKAAQAALSSA----GITSSDLDLIILATSTPDHLGGFPSTACVVQ
FABH_AROAE       AS---AEMSSSDLAKTASERALDAA----GVRPDDIDLIIVATSTPDCI--FPSTAALLQ
FABH_AZOSB       AP---PDVGSSDLALVAAQRAIEAA----GCAANDIDLIIVATSTPDYI--FPSTATLLQ
FABH_BORBR       AE---RGVTTSQLATEAARRAMDDA----GVQADEIDMIIVATSTPDYV--FPSTACLVQ
FABH_BORPA       AE---RGVTTSQLATEAARRAMDDA----GVQADEIDMIIVATSTPDYV--FPSTACLVQ
FABH_BORPE       AE---RGVTTSQLATEAARRAMDDA----GVQADEIDMIIVATSTPDYV--FPSTACLVQ
FABH_BORPD       AE---RGVTTSFLATEAARRALADA----GVSAAEVDLIIVATSTPDYV--FPSTACLVQ
FABH_BORA1       AE---RGVTTSVLATEAARRAMADA----GVGPADLDLIIVATSTPDFV--FPSTACLVQ
FABH_CHRVO       AD---EGHKTSDLALRAAQAAIASA----GIDKGEIDLIIVATTTPDMV--FPSTACILQ
FABH_LARHH       AA---EGQLTSDLAYRAALRAIEAA----GIEAASIEMIIVATTTPDMV--FPSTAVVVQ
FABH_NEIG1       AA---ENEKTSDLAAEAARRALADA----KLNINDIDLIIVATATPDMQ--FPSTATIVQ
FABH_NEIG2       AA---ENEKTSDLAAEAARRALADA----KLNINDIDLIIVATATPDMQ--FPSTATIVQ
FABH_NEIM0       AA---ENEKTSDLAAEAARRALDAA----GLDSGEIDLIIVATATPDMQ--FPSTATIVQ
FABH_NEIMF       AA---ENEKTSDLAAEAARRALDAA----GLDSGEIDLIIVATATPDMQ--FPSTATIVQ
FABH_NEIMB       AA---ENEKTSDLAAEAAHRALDAA----GLDSGEIDLIIVATATPDMQ--FPSTATIVQ
FABH_NEIMA       AA---ENEKTSDLAAEAARRALDAA----GLNGNEIDLIIVATATPDMQ--FPSTATIVQ
FABH_NITEC       AA---PGQMASDLALEASRNAIEAA----GIQASDIDLVIVATTTPDMI--FPSTACILQ
FABH_NITEU       AA---EGQMASDLALEASRNAIEAA----DIQAKDIDLIIVATTTPDMI--FPSTACILQ
FABH_NITMU       AA---DSEMASDLALNASREAIKAG----GIDAREIELVIVATTTPDMI--FPSTACILQ
FABH_VESOH       VT----NETTCDLAEKAANRALEMA----GINVKDLDLIILATTTADKI--FPATATILQ
FABH_DICNV       AS---PDESCSDMAFYAAKRALENA----HIEADAIDLIIVATSTPEHI--FPSTATVVQ
FABH_COXB2       AN---SPDNTTTMAVDAAKRAIEMA----EIDPAVIDMIIVGTATAEYY--FPSTACLVQ
FABH_COXBU       AN---SPDNTTTMAVDAAKRAIEMA----GIDPAVIDMIIVGTATAEYY--FPSTACLVQ
FABH_COXBR       AN---SPDNTTTMAVDAAKRAIEMA----GIDPAVIDMIIVGTATAEYY--FPSTACLVQ
FABH_COXBN       AN---SPDNTTTMAVDAAKRAIEMA----GIDPAVIDMIIVGTATAEYY--FPSTACLVQ
FABH_COXB1       AN---SPDNTTTMAVDAAKRAIEMA----GIDSAVIDMIIVGTATAEYY--FPSTACLVQ
FABH_ACICJ       AA---AHETATFMGAEAARRALAAA----GASADSVDAVIVATSTPDQG--FPATAVSIQ
FABH_GRABC       AT---ADESCAFMAARAAERALAHA----GMTADDVDAILVATSTPDQV--FPAVAVRVQ
FABH_AGRFC       AG---EGETTASLGEAAARAALDNA----GLTPADIDLIILATSTPDNT--FPATAVNIQ
FABH_RHIL3       AG---DDETTASLGEAAARAALANG----GLTPADIDLVICATSTPDNT--FPATSVNIQ
FABH_RHIME       AG---EGETSASLGEAAARAALERA----GLTPDDVDLIIVATSTPDNT--FPATAVNIQ
FABH_SINMW       AG---DGETTASLGEAAARAALERA----GLTPDDIDLIIVATSTPDNT--FPATAVNIQ
FABH_AGRRK       AG---EGETTASLGEQAARAALANA----GLTADDLDMIIVATSTPDNT--FPATAVNIQ
FABH_AGRVS       AG---EGETTASLGAEAALKALEAA----GLAPADIDMIICATSTPDNT--FPSAAVNIQ
FABH_BRUA1       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUA2       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUAB       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUME       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUC2       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUSU       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUMB       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUO2       AG---KGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_BRUSI       AG---EGETTVSLGAAAARAAIENA----GLQPSDIDLVLLATSTPNNT--FPASAVAIQ
FABH_OCHA4       AG---DDETTVSLGTAAARAAIENA----GLQPTDIDLVLLATSTPNHT--FPASAVEIQ
FABH_RHILO       AA---DDETTASLGEAAARAALANA----GLTPGDIDLIVLATSTPNNT--FPATAVEIQ
FABH_CHESB       AS---DDETTASLGEAAALRALDAA----GLAPADIDLIVVATSTPNNT--FPATAVEIQ
FABH_BARHE       AN---EKETTVSLGVEAAQAALINA----GLTIKDIDCIILATSTPNHT--FPASAVEIQ
FABH_BARQU       AN---ENETTVSLGVEAARVALINA----NLTIKDIDCIILATSTPNHT--FPASAVEIQ
FABH_BART1       AN---ENETTVSLGVKAAQAALINA----GLTIKDIDCIILATSTPNRT--FPASAVEIQ
FABH_BARBK       AS---ENETTVSLGIEAAQVALTNA----GMTIKDIDCIILATSTPNRT--FPSSAVEIQ
FABH_BRASB       AA---EGEFTSHLAINAARAALAAA----DVDPQSIDLIVLGTSTPDNT--FPATAVAVQ
FABH_BRASO       AA---DGEFTSHLAINAARAALANA----DVDPQSIDLIVLGTSTPDNT--FPATAVAVQ
FABH_BRADU       AA---EGEFTSHLAIKAAQAALTDA----GVDAQSIDLIVLATSTPDNT--FPATAVAVQ
FABH_ERYLH       AG---ADEFTSTLAMEASRKALEAA----GITPETIDLIVLATATPDNT--FPATATKVQ
FABH_NOVAD       AG---EGETTSTLATEAARKALEAA----GVDASRIDLIVLATATPDQT--FPATATIVQ
FABH_SPHAL       AE---PDETTATLGADAARRALEAA----GLQPADIGLIIVATATPDNT--FPASATKVQ
FABH_SPHWW       AG---EGETTSTLATEAARKAIEAA----GIAPSDIGLIILATATPDQT--FPASATMVQ
FABH_RHOCS       AA---DGENTSDLAEAAARAALAHA----GVAAEEVDLIVLATATPDQT--FPATATKVQ
FABH_RHORT       AA---EGEKTSDLAMAAARAALADA----GVDAAEVDLIVLATATPDQT--FPATATRVQ
FABH_MAGSA       AA---EGETTSDLATNAALRALEAA----GISGSAVDLVIVATATPDNT--FPATATKVQ
FABH_CAUVC       AA---DDQPVSDLAFEAAKEALAAA----GKTAADVDLIIVATTTGDLT--FPATATIVQ
FABH_HYPNA       AA---DGELTSDIAVHAARRALEAA----GMQASEIDLIVLATTTPDQT--FPATATAVQ
FABH_RHOS1       AA---EGQTTSDLAARAARAALDDA----GLQPDDIDTLIVATSTADLT--FPSAATMVQ
FABH_RHOS4       AA---EGQTTSDLAARAARAALEDA----GLQPDDIDTLIVATSTADLT--FPSAATMVQ
FABH_RHOS5       AA---EGQTTSDLAARAARAALADA----GLQPDDIDTLIVATSTADLT--FPSAATMVQ
FABH_RUEPO       AA---EGETTSDLATRAAEAALADA----GISAEQIDAIVLATSTADLT--FPSAATMVQ
FABH_RUEST       AA---EGETTSHMATRAAEAALKSA----GRSADDVDAIVLATSTADLT--FPSAATMVQ
FABH_ROSDO       AA---EGETTASMAAAASRAALSMA----GAEAQDVDAIIVATSTADLT--FPSAATMVQ
FABH_DINSH       AA---DGEQTSDLATAAAQAALDHA----ELTAQDVDAVIVATSTPDLT--FPAVATMVQ
FABH_JANSC       AA---EGETTSQMAVTAARKALDHA----ALNPDDIDAVIVATSTPDLT--FPSVATMVQ
FABH_PARDP       AA---EDQRTSDLGILAAQAALADA----GLEAAQIDAVIVATSTPDLT--FPSVATMVQ
FABH_RHOCA       AA---EGETTSQLAIKAAAAALADA----GLSAADIDAIVVATSTPDFT--FPSVATMVQ
FABH_EHRCJ       AE---DNEMTSDMATSAAKLALDNA----GIDKNEIDLIIVATTTPDRT--FPSCATIVQ
FABH_EHRCR       AE---NNEMTSDMAANAARLALTDA----CVHKDDIGLIIVATTTPDRT--FPSCATIVQ
FABH_EHRRG       AA---DDQMTSDMAVEAAKLALNDS----GINKQDVDLIVVATTTPDRT--FPSCATIVQ
FABH_EHRRW       AA---DDQMTSDMAVEAAKLALNDS----GINKQDVDLIVVATTTPDRT--FPSCATIVQ
FABH_WOLPM       AD---EGELTSDLAVNAAKSAIEKA----KISVDEIDLIIVATTTPDKT--FPSCATIVQ
FABH_WOLPP       AD---EGELTSDLAVNAAKNAIEKA----KISIDEIGLIIVATTTPDKT--LPSCATIVQ
FABH_WOLTR       AD---EAELTSDLAVNSAKNAIEKA----QISVDEIGLIIVATTTPDKT--LPSCATIAQ
FABH_ANAMM       VE---EGDTVSCMATEAAKIALEDA----GVSATEVDLIIVATATPDKT--MPSCATMVQ
FABH_RICRO       AG---DTEYTSHLALKSAEKAIADA----GISVNDIDLIITCTTTPDNS--FPSVASKLQ
FABH_RICRS       AG---DTEYTSHLALKSAEKAIADA----GISVNDIDLIITCTTTPDNS--FPSVASKLQ
FABH_RICCN       AG---DTEYTSHLALKSAEKAIADA----GISVNDIDLIITCTTTPDNS--FPSVASKLQ
FABH_RICM5       AG---DTEYTSHLALESAEKAIADA----GISVNDIDLIITCTTTPDNS--FPSVASKLQ
FABH_RICFE       AG---DTEYTSHLALKSAEKAIADA----RVSVNDIDLIITCTTTPDNS--FPSVASKLQ
FABH_RICAH       AD---DNEYTSHLALKSAEQAIADA----RVSANDVDLIITCTTTSDNS--FPSVATKLH
FABH_RICCK       AD---DTEYTSHLALKSAEKAIEDA----GISANDIDLIIICTTTPDHS--FPSVATKLQ
FABH_RICPR       AG---DAEYTSHLAFKSAQKAIEDA----MISVDDIDLIIICTTTPDNS--FPSVATKLH
FABH_RICTY       AG---DTEYTSHLALKSAQKAIEDA----MISVDDIDLIITCTTTPDNS--FPSVATKLH
FABH_RICB8       AG---DTEYTSHIALKAAEKAIADA----DISVNEIDLIITCTTTPDNS--FPSVATKLQ
FABH_RICBR       AG---DTEYTSHIALKAAEKAIADA----DISVNEIDLIITCTTTPDNS--FPSVATKLQ
FABH_NEOSM       IA---EEEDVCELAFRASLNCLERA---MHFSQKEVDAIIVATCTANKR--LPAVANMLQ
FABH_AQUAE       AK---E-ETITYMATQAAKEALREA----NLSPEELDLIILATLTPQ-KR-FPSTACLVQ
FABH_PERMH       AE---EWEKASDIALPAAKEAIENA----GLTPKDIDAVIVATSTPD-MT-FPSTACFLA
FABH_SULDN       AA---DGEFTSDMGAKAAQIAIERS----GIEKNKIDMIVCATISPDYFC-MPSTATIIS
FABH_SULNB       AA---DDEYTSDMGAKAAKLAIERA----GIEKEDIDLVLCATVTPDYFN-MPSTACIIS
FABH_ARCB4       AN---EGEASSDLGARAGELAIERA----AISKEEIDLVICATVTPDFLC-MPSTACLIA
FABH_HELP2       AN---DEEKSSDLGVIAAKQAIERA----HLTPKDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELPG       AS---NEEKSSDLGVIAAKQAIERA----HLTPKDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELPY       AN---DEEKSSDLGVIAAKQAIERA----HLTPKDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELPS       AN---DEEKSSDLGVIAAKQAIERA----HLTPKDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELPJ       AN---DEEKSSDLGVIAAKQAIERA----HLTPQDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELPH       AS---NEEKSSDLGVIAAKQAIERA----HLTPKDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELAH       AS---VGEKSSDLGVIAAKQAIERA----HLTPQDIDLVVVATLSPDFLA-MPSTACVLS
FABH_HELHP       AL---PSQQTSDLAYEAGKKAIERA----GIEPKDIDAVIVATLSPDYLT-MPSTACITS
FABH_CAMC1       A----TTEITSDLGTKAAELAIKRS----GLEKSQIDAVICATISPDHLC-MPSTACKIA
FABH_CAMC5       A----EGEITSDLGTKAAKLAIKRA----GLEKPQIDTIICATMSPDHLC-MPSTACKIA
FABH_CAMFF       A----KNEVTSDLAYKAALMAIQRA----GIDKNDIDAVICATITPDYFC-MPSTACKVA
FABH_CAMHC       A----KNETAGDMAAKAADLAISRS----GISKEEIDAIICATITPDFFC-MPSTACITA
FABH_CAMJE       AS---ENENTSDLGTKAALKAIERA----NLKPEDIDAILVATLSPDYFT-MPSTACKIA
FABH_CAMJJ       AS---ENENTSDLGTKAALKAIERA----NLKPEDIDAILVATLSPDYFT-MPSTACKIA
FABH_CAMJ8       AS---ENENTSDLGTKAALKAIKRA----NLKPEDIDAILVATLSPDYFT-MPSTACKIA
FABH_CAMJR       AS---ENENSSDLGTKAALKAIERA----NLKPEDIDAILVATLSPDYFT-MPSTACKIA
FABH_CAMJD       AN---ENENTSDLGTKAALKAIERA----NLKPEDIDAILVATLSPDYFT-MPSTACKIA
FABH2_BACTN      LN--EEGLGSSYMARKAAKQLMKKT----GANPDDIDLVIVATTTPDYH--FPSTASILC
FABH_BACV8       LN--EEGLGTSYMARKAAKQLMQKT----ASNPDDIDAVIVATTTPDYH--FPSTASILC
FABH1_BACTN      LN--EEGLGTSYMARKAAKQLMQRT----KSRPDDIDLVIVATTTSDYR--FPSTASILC
FABH_PARD8       LK--GEGVGLSYMGIRAVKQLLEKT----NLNPEEVEVVLTATTTPDHH--FPTTSSIIA
FABH_PORG3       LR--DKNKGASYLAIRAAQDLFDRH----GIDPKSIDGLILATNSSDYH--FPSTASIVA
FABH_PORGI       LR--DKNKGASYLAIRAAQDLFERH----GIDPKSIDGLILATNSSDYH--FPSTASIVA
FABH_AZOPC       LKP-EEGKGITYLALKAIEDLKSRH----DFDPLEIDAVLFATATPDYP--FPNSASLIA
FABH_PELLD       LR--DPKKATSYMCGEVASQLLRKR----GLAAEELELIIVATMTPDMM--FPSTACLVQ
FABH_CHLPM       LR--DPEKATSYICGEVARQLLEKR----GMKAEELDLIIVATMTPDML--FPSTACLVQ
FABH_CHLCH       LK--DPTKATSYMCGEVARQLLEKR----QLAATDIELIIVATITPDMP--FPATACLVQ
FABH_CHLPD       MN--DPSKATAYMCGEVALQLLEAR----KMKPEEIEVIIVATMTPDML--FPATACFVQ
FABH_CHLTE       LR--DPKKATSYMCTEVARQLLEKR----GISADEIDLIIVATMSPDML--FPSTACLVQ
FABH_KORVE       V---DKGVAASDLAVEAAKKCLANR----GIEAAEVECIVVGTVTPDMM--YPSTACLVQ
FABH_SOLUE       A---APEMATSDMAIEAARCALLQR----GIDACEIDAIILCTVTPDHL--FPSTACLVQ
FABH2_VIBVU      SH-----VNTSDLATVAAKQALARA----GITAQDIDLIIVATCSPDSL--IPNIASMVQ
FABH2_VIBVY      SH-----VNTSDLATVAAKQALARA----GITAQDIDLIIVATCSPDSL--IPNIASMVQ
FABH2_VIBPA      SH-----VNTSDMATVAAQHALARA----GVEASEIDLIIVATCSPDSL--IPNIASKVQ
FABH2_VIBCH      SH-----VNTSDLATVAAQHAIACA----GVSVEEIDLIIVATCSPDSL--IPNIASRVQ
FABH_PSET1       SH-----VSTAELATVAAKHAIACA----GIDAKDIDLVILATCTPSTM--VANTASLVQ
FABH_TRIV2       LPT----ESLSSLAAAASRQAIASA----GITASDIDLILLATSTPDD---LFGTATKIQ
FABH_NOSS1       LPT----ESLSSLAAAASRQAIASA----GITASDIDLILLATSTPDD---LFGTATKIQ
FABH_TRIEI       DTT----ESLCSLATQASLAALNQA----NITPKDIDLIILATSTPDD---LFGTACKIQ
FABH_ACAM1       GPD----DTLAKLGAIAAQNALEMA----QVEATDLDLILLATSTPDD---LFGSACQIQ
FABH_SYNE7       QPQI---ESLSSLAAAAGQSALEAA----GLEATSVDLILLATSTPDD---LFGSACQVQ
FABH_SYNP6       QPQI---ESLSSLAAAAGQSALEAA----GLEATSVDLILLATSTPDD---LFGSACQVQ
FABH_MICAN       DRS----VSLSQLAAQAAIKALEMA----QVSPRDIDLILLATSTPDD---LFGSAAQVQ
FABH_SYNY3       SAQ----ENLASLGVKAGQKALAMA----GLQPEDLDLIILATSTPDD---LFGTAAQIQ
FABH_THEEB       APD----QRLVDLASEAAGAALQMA----GLDPTAVDLIILATSTPDD---LFGTACLVQ
FABH_GLOVI       APG----QSLTQLAARAATDALSQA----GRSPLDVDLLILATSTPDD---LFGGAAHLQ
FABH_PROM0       SLG----DNVNEMGYKAALTAIEMA----NWDIKTVDLIVLATSTPHD---LFGSAPSIQ
FABH_PROM9       GLG----DNVNDMAYEAALSAIEMT----NWDIKTIDLIVLATSTPHD---LFGSAPSIQ
FABH_PROM2       RVE----DNVADMGYKAALTAIEMA----NWDIKTIDLIVLATSTPHD---LFGSAPSIQ
FABH_PROM5       GLS----ENVSEMGYKAGLAAIEMA----KWDIETIDLIILATSTPHD---LFGSAPEIQ
FABH_PROMP       GLS----ENVSEMGYKAALGAIEMA----RWDIETIDLIILATSTPND---LFGSAPEIQ
FABH_PROMA       GAD----ESLTDLCVAAAKAAVDMA----GWGVESIEMVLIATSTPDD---LFGMAPKVQ
FABH_PROMT       GEN----ESLIDLATDAAVNAVKMA----DWDVQTIDLIILATSTPED---LFGSAPKIQ
FABH_PROMM       GPD----ETLTGLSHQAAANALTMA----GWEPESVDLIILATSTPDD---LFGSAPQLQ
FABH_SYNR3       DES----ESLTSLAAAAGKQALERA----GWDASSVDLILLATSSPDD---LFGSAPKVQ
FABH_SYNPW       TAD----QTLVDLAAEAGRSALTMA----GRSPQDLDLILLATSTPDD---LFGSAPRVQ
FABH_PORPU       APSS---TSLTKLAAEAANDALSKA----SINAEDIDLIILATSTPDD---LFGSASQLQ
FABH_PORUM       PLLL---PSLTKLAAEAANDALSKA----SINAEDIDLIILATSTPDD---LFGSASQLQ
FABH_PYRYE       APSS---TSLTKLAAEAANKALYAA----NLKPTEISLIILATSTPDD---LFGSASQLQ
FABH_GRATL       TGTN---KSVVDLAYSAAMKALDKI----HMDPLEIDLIILATSSPND---LFGSASQVQ
FABH_RHOBA       EPG----QATSDLCYEAALRCLENA----NVSVDEIDLILVATITPDHP--TPSTACHLQ
FABH1_STRCO      GP----EETVAAMSVEASGKALADA----GIDASRIGAVVVSTVSHFSQ--TPAIATEIA
FABH_STRGA       ND----EETVAAMSIEASGKAIADA----GITAAQVGAVIVSTVTHFKQ--TPAVATEIA
FABH_KOCRD       PE----DVSVLDMAEHAAREALENS----GLTGEQLSTIIVSTVSFPYL--TPSLAANLA
FABH_MYCA1       AR----DESTASMATEAGREAIAKA----GLEASDIDCVVVATSTHFLQ--TPACGPAVA
FABH_MYCPA       AR----DESTASMATEAGREAIAKA----GLEASDIDCVVVATSTHFLQ--TPACGPAVA
FABH_MYCMM       AP----EESAASMAIEASREAIAKA----ALTGSDIDGVIVATSTHFLQ--TPACAPIVA
FABH_MYCUA       AP----EESAASMAIEASREAIAKA----ALTGSDIDGVIVATSTHFLQ--TPACAPIVA
FABH_MYCTA       AD----DESAASMATEACRRALSNA----GLSAADIDGVIVTTNTHFLQ--TPPAAPMVA
FABH_MYCTU       AD----DESAASMATEACRRALSNA----GLSAADIDGVIVTTNTHFLQ--TPPAAPMVA
FABH_MYCBO       AD----DESAASMATEACRRALSNA----GLSAADIDGVIVTTNTHFLQ--TPPAAPMVA
FABH_MYCBP       AD----DESAASMATEACRRALSNA----GLSAADIDGVIVTTNTHFLQ--TPPAAPMVA
FABH_MYCBT       AD----DESAASMATEACRRALSNA----GLSAADIDGVIVTTNTHFLQ--TPPAAPMVA
FABH_MYCA9       AD----EETAQTLAIEAGRKAIANA----LLTGAEIDAVIVATSTHYLQ--TPASAPAVA
FABH_STRLI       EP----DETIQVMGVAASRRALEHA----GVDPAEIDLVVVSTMTNFVH--TPPLSVAIA
FABH2_STRAW      GP----DEPVDELAGHAAAKALASA----GLAPADIDLVLVATSTAEDR--SPNMAARVA
FABH4_STRCO      GP----DEPVDELAGHAAAKALASA----GLTPADVDLVVVATSTAIDR--SPNTAARVA
FABH2_STRCO      SP----GTTTGDLAVTAGAAALKSA----G--RDDCDLVLLATTTPDRR--CPATAPRVA
FABH5_STRCO      SD----GASTGDLAVEAGQRALKAA----G--TDTVDLVVLATTTPDHP--CPATAPDVA
FABH3_STRCO      EE----GTLTSDLAVGAAERALKSA----RLTPDEIDAVIVATTTPDRP--CPATAPTVA
FABH_PSEA8       AG----DLGSGDLALRAASAALASA----G--LERVDAVVLATSTGDFC--CPATAPRVA
FABH_PSEAB       AG----DLGSGDLALRAASAALASA----G--LERVDAVVLATSTGDFC--CPATAPRVA
FABH_PSEAE       AG----DLGSGDLALRAASAALASA----G--LERVDAVVLATSTGDFC--CPATAPRVA
FABH_LACBA       T-----AERTSDLCTRVAQQLLQRS----GLQATDIDYIVVATMSPDYQ--TPAVSAQVQ
FABH_LACH4       T-----EETTSSMCTDVATQLIAQS----DLTAKDIDLIAVATMSPDYL--TPSVSAMVQ
FABH2_LACPL      T-----DETTTSLAVSVAQQLLQQS----RLAATAIDLIIVATMSPDYL--TPATAPQVQ
FABH_OENOB       V-----DETTASLAASVLQKLLKGS----GISADQIDFVLVATMSPDSM--APSTAAQAS
FABH_LACDA       Q-----QENTSDLAIQVAKQLLAGE----D--PAGVDLIIVATMSPDAY--TPATAALVQ
FABH_LACDB       Q-----QENTSDLAIQVAKQLLAGE----D--PAGVDLIIVATMSPDAY--TPATAALVQ
FABH_LACRD       N-----IENTSDLALNVGNQLLTNA----NLKTTELDLIIIATMSPDAY--TPSTAAIVQ
FABH_LACRJ       N-----IENTSDLALNVGNQLLTNA----NLKTTELDLIIIATMSPDAY--TPSTAAIVQ
FABH_LACSS       E-----TENTSDLCLRVAQTLLDKS----GIAVSQIKAIIVATMTPDYY--TPSTAAIVQ
FABH_LACLM       T-----GENTSDLATKVAKQLIENS----GVDPELIDFIIVATVTPDSM--MPSTAARVQ
FABH_LACLS       T-----GENTSDLATKVAKQLIENS----GVDPELIDFIIVATVTPDSM--MPSTAARVQ
FABH_LACLA       T-----GENTSDLAAKVAKQLISDS----NLSPETIDFIIVATVTPDSL--MPSTAARVQ
FABH_STRA1       K-----NETTADLANKVAEQLIEKS----GYSASQIDFIIVATMTPDSM--MPSTAARVQ
FABH_STRA3       K-----NETTADLANKVAEQLIEKS----GYSASQIDFIIVATMTPDSM--MPSTAARVQ
FABH_STRA5       K-----NETTADLANKVAEQLIEKS----GYSASQIDFIIVATMTPDSM--MPSTAARVQ
FABH_STRE4       T-----VEMTSDLAIRVAEQLLAGS----GYDATALDFIIVATISPDAS--MPSTAAKVQ
FABH_STRS7       T-----VEMTSDLAIRVAEQLLAGS----GYDATALDFIIVATISPDAS--MPSTAAKVQ
FABH_STREM       T-----VEMTSDLAIRVAEQLLAGS----GYDATALDFIIVATISPDAS--MPSTAAKVQ
FABH_STRP1       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPG       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRP3       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPM       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRP8       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPQ       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPB       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPC       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPD       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRP6       R-----DEMTSDLAIQVADQLLTQS----GLKANAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPZ       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRPF       R-----DEMTSDLAIQVADQLLTQS----GLKADAIDFIIVATISPDAT--MPSTAAKVQ
FABH_STRU0       R-----SENTSDLASRVAEKLLEKA----NIDATEIDFIIVATITGDSI--MPSVAAKVQ
FABH_STRGC       H-----HESTSDLATRVALDLLKKS----EISAQDLDFIIVATITPDSL--MPSTAARVQ
FABH_STRSV       S-----DETTSDLATKVAENLLQKS----GISAQDLDFIIVATITPDSL--MPSAAARVQ
FABH_STRP7       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRPS       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRP2       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRPI       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRR6       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRPJ       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRPN       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRZJ       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRZT       R-----TESTSDLATEVAKKLMAKA----GITGEELDFIILATITPDSM--MPSTAARVQ
FABH_STRP4       R-----TESTSDLATEVAKKLMAKA----GITGKELDFIILATITPDSM--MPSTAARVQ
FABH_STRZP       R-----TESTSDLATEVAKKLMAKA----GITGKELDFIILATITPDSM--MPSTAARVQ
FABH_STRMU       Q-----SEDTSDLASQVAKELLKKA----SLKAKEIDFIIVATITPDAM--MPSTAACVQ
FABH_STRT1       L-----NENTSDLATNVAYQLLEKS----GLSPEELDFVLVATISPDNS--MPSVAARVQ
FABH_STRTD       L-----NENTSDLATNVAYQLLEKS----GLSPEELDFVLVATISPDNS--MPSVAARVQ
FABH_STRT2       L-----NENTSDLATNVAYQLLEKS----GLSPEELDFVLVATISPDNS--MPSVAARVQ
FABH_STRS2       T-----GETTSDLASQVARKLLEKS----QLDASEIDFIIVATITPDAS--MPSTAAMVQ
FABH_STRSY       T-----GETTSDLASQVARKLLEKS----QLDASEIDFIIVATITPDAS--MPSTAAMVQ
FABH_ENTFA       T-----QENTSDLCHQVAKQLLEKS----GKQASEIDFILVATVTPDFN--MPSVACQVQ
FABH1_LACPL      MN----DENTSDLATQVAQQLLQKS----GLAASAIDLILVTTITPDAL--TPATACLVQ
                                                       .   : :          .    

FABH1_BACAN      EAIGA--KHAAAMDLSAACAGFMYGMITAQQFIQT-GTYKNVLVVGSDKLSKIVDWNDRN
FABH1_BACCR      EAIGA--KHAAAMDLSAACAGFMYGMITAQQFIQT-GTYKNVLVVGSDKLSKIVDWNDRN
FABH1_BACSU      EQLGA--KKACAMDISAACAGFMYGVVTGKQFIES-GTYKHVLVVGVEKLSSITDWEDRN
FABH_BACP2       EQLGA--HKACAMDISAACAGFMYGLVTGKQFIES-GTFKHVLVVGVEKLSRITDWDDRN
FABH_GEOKA       ERLGA--VNAAALDISAACAGFMYGMVTAAQFIDT-GAYKYILVVGADKLSKITDWTDRN
FABH1_BACHD      QRLGA--KKAAAMDISAACAGFIYGLATGQQFIEN-GGYKHVLVIGVEKLSKITDMTDRN
FABH_OCEIH       DQLGA--KNAAAMDVSAACAGFMYGLITAKQFIDT-GAYKHVLVVGAEKLSKITDWSDRT
FABH_LISIN       DRLGA--KNAAGMDVEAACAGFTFGVVTAAQFIKT-GAYKNIVVVGADKLSKITNWDDRA
FABH_LISW6       DRLGA--KNAAGMDVEAACAGFTFGVVTAAQFIKT-GAYKNIVVVGADKLSKITNWDDRA
FABH_LISMF       DRLGA--KNAAGMDVEAACAGFTFGVVTAAQFIKT-GAYKNIVVVGADKLSKITNWDDRT
FABH_LISMO       DRLGA--KNAAGMDVEAACAGFTFGVVTAAQFIKT-GAYKNIVVVGADKLSKITNWDDRT
FABH1_STAES      ERLGT--GKVATMDQLAACSGFMYSMITAKQYIQS-GDYKHILVVGADKLSKITDMTDRS
FABH_STAEQ       ERLGT--GKVATMDQLAACSGFMYSMITAKQYIQS-GDYKHILVVGADKLSKITDMTDRS
FABH_STAAM       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAN       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAR       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAA9       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAB       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAA1       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAA2       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAA3       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAE       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAA8       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAC       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAW       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAS       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAAT       ERLGT--GKVASMDQLAACSGFMYSMITAKQYVQS-GDYHNILVVGADKLSKITDLTDRS
FABH_STAHJ       EKLDT--RKVPTMDQLAACSGFMYSMITAKQYVQS-GDYKNILVVGADKLSKITDLTDRS
FABH_STAS1       ERLGI--GKVASMDQLAACSGFMYSMINAKQFVQS-GDYKNILVVGVDKLSKITDFTDRS
FABH_DEIDV       MQVGL--VGAAAFDLSTACSGFVYGLSVASGLIHA-GTARRVLVVGAEVLSKIVDQDDRG
FABH_DEIGD       GQVGL--SGAGAFDLSTACSGFVYALSMAQGLILG-GTARRVLVVGAETLSRLVDQHDRS
FABH1_DEIRA      GQVGL--TGVGAYDLSTACSGFVYALSMARGMILG-GSAKNVLVLGGEVLSKALDQDDRD
FABH2_DEIRA      GGTGL--RGAAAFDVSVACSGFLYALSVGYGMIRA-GLAKKALIVGSEVMSGAVDQNDRN
FABH2_BACAN      QYFNI--PHTMAFDLNATCAGFTYGLHVGNSLITS-GSHKKVLVVATETLSKVTDYTDRT
FABH2_BACCR      QYFNI--PHTLAFDLNATCAGFTYGLHVGNSLITS-ESHEKVLVVATETLSKVTDYTDRT
FABH2_BACSU      EYFGW--ESTGALDINATCAGLTYGLHLANGLITS-GLHQKILVIAGETLSKVTDYTDRT
FABH2_BACHD      AKLGI--QNTGAIDLNAACAGFTYGLHMANGLISS-GLHRKILVIGAETISKVTDYTDRT
FABH2_STAES      AQLGL--KNAGAIDINAACAGFTYGLNLANGLITS-GQNKKILVIGSETLSKITDYNDRS
FABH_ACHLI       AKLGLNHKNIVAFDINAACSGFVYAVEIAASMISS-GNYKSALVIGSEHMSSILDWEDRS
FABH_FUSNN       NKLGL--KKIPCFDLNAACTGFIYGLEVAYSLVKS-GLYKNILVIGAETLSRIVDMQNRN
FABH_CLOAB       EKIGA--KNAACFDLNAACTGFIFALNTASQFIKT-GEYKTALVVGTEVLSKILDWQDRG
FABH_CLONN       DAIGA--TKATCFDINAACTGFMYALSVASQFIKS-GQSKNALVIGAETLSKMINWQDRG
FABH_CLOB1       KEIGA--MNALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOBH       KEIGA--MNALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOBJ       KEIGA--INALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOBL       KEIGA--INALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOBM       KEIGA--INALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOB6       KEIGA--INALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWKDRN
FABH_CLOBK       KEIGA--INALCFDISAACSGFIYGLEIACSMLKN-SFRNKALIIGAENLSKIVDWEDRN
FABH_CLOK1       KNIKA--VNATCFDISAACSGLIYGLDIGTQFIRS-GRFKVVLAIGAETLSKILNWQDRS
FABH_CLOK5       KNIKA--VNATCFDISAACSGLIYGLDIGTQFIRS-GRFKVVLAIGAETLSKILNWQDRS
FABH_CLOTE       RNIKA--YNAFAFDISAACSGFTYGISIASQFIRN-GVAKKVLVIGVETLSKLVDWKDRN
FABH_CLOB8       SNLDA--SKAACFDISVACSGFVYGLETAKALMMS-MNYKNALVVGAEVLSKVTDWTDRS
FABH_CLOP1       DKLGA--KNAWAFDINAACTGFIYALKLGRSLIRS-GEAKNALIIGAETLSKALNWEDRG
FABH_CLOPE       DKLGA--KNAWAFDINAACTGFIYALKLGRSLIRS-GEANNALIIGAETLSKALNWEDRG
FABH_CLOPS       DKLGA--KNAWAFDINAACTGFIYALKLGRSLIRS-GEAKNALIIGAETLSKALNWEDRG
FABH_CLOD6       DAIGA--VNATAFDISAACSGFVYGVTIAKQFVET-GCYKNVLVIGAETCSKFLNYDDRT
FABH_CALS4       ANLGA--LNAAAFDISVGCSGFIYGLAIAQQFVET-GMYRNVLVIGAETLSKIINWKDRN
FABH_DESHD       ERLGA--KKAAGFDLQAACTGFLYGVATAAQFIAT-GIYKNALVIGGETLSKILNWEDRG
FABH_DESHY       ERLGA--KKAAGFDLQAACTGFLYGVATAAQFIAT-GIYKNALVIGGETLSKILNWEDRG
FABH_SYMTH       AALGA--HRAAAFDLSAACPGWIYGVVMAQQSIAT-GLYDCALVIGVELLSKMVNWQDRK
FABH_NATTJ       DKLGA--DQACAFDLEAACTGFLYGLRIASQFIAT-DTHKYILVIGSETLSKIVDWEDRN
FABH_SYNWW       DHLGA--RNAAAFDVEAGCTGFIYALGIAEKFLLS-PEYKKILVIGADLCSRFTDYTDRN
FABH_CALS8       KELKL--KNAFAFDISAACSGFIYAMAIATHFIQN-GFCKNALVIGAEALSRITNWSDRS
FABH_CHLCV       AYLGI--KEVPAFDCMAACTGYLYGLSVAKALVES-GAYNNVLLIAADKLSSFVNYEDRN
FABH_CHLPN       AHLGI--EDVPTFDCQAACTGYLYGLSVAKAYVES-GTYNHVLLIAADKLSSFVDYTDRN
FABH_CHLTA       AYLGI--KEIPAFDCLAACTGFLYGLSIAKAYVES-GMYQCVLVIAADKLSSFVNYQDRN
FABH_CHLTR       AYLGI--KEIPAFDCLAACTGFLYGLSIAKAYVES-GMYQCVLVIAADKLSSFVNYQDRN
FABH_CHLMU       AYLGI--KEVPAFDCLVACTGFLYGLSIAKAYVEA-GMYQCVLVIAADKLSSFVNYEDRN
FABH_DESPS       QEIGA--KKAFAFDVNAACSGFLYAMEVGSKYVAT-NPAMKVLCIGTETLSARTNQQDRN
FABH_DESVH       RKLGM--TGVMALDCNAACSGFLYGLELAQGIVAA-RPASRVLLVAAEALSLRCNWKDRT
FABH_DESVV       RKLGM--TGVMALDCNAACSGFLYGLELAQGIVAA-RPASRVLLVAAEALSLRCNWKDRT
FABH_DESVM       AKLGI--MGAMAFDFNAACSGYVYGLSMARAIVAA-QPEARVLLTATEALTRRLNWADRT
FABH_DESAG       HKLGV--SGLMALDLNAACSGFLYALNMAQGIVAL-TPDAKVLVVAAEVLSRRINWNDRS
FABH_ROSCS       AGVGA--RRAAAFDIVAACSGFVYGLQVATSMVRS-GAARNVLFVACDIFTHFINWNDRN
FABH_ROSS1       AGIGA--RRAAAFDLVAACSGFVYGLNVATSMIRS-GAARNVLFVACDIFTHFINWNDRN
FABH_RUBXD       EAVGA--AGVGAMDLSAACAGFAYAASVAGAMLAS-GLASRVLLVGADEMTSIVNVRDRS
FABH1_VIBVU      AKLGI--KGCPAFARAAACSGFVYALSIADQHIKT-GMCKNVLVIGSDTLSKTCDPTDRS
FABH1_VIBVY      AKLGI--KGCPAFDLAAACSGFVYALSIADQHIKT-GMCKNVLVIGSDTLSKTCDPTDRS
FABH1_VIBPA      AKLGI--KGCPAFDLAAACSGFVYALSVADQHIKS-GMCKNVLVIGADALSKTCDPTDRS
FABH1_VIBCH      GKLGI--KGCPAFDLAAACSGFMYALSIADQHVKS-GMCKHVLVIGADALSKTCDPTDRS
FABH_ALIF1       GLLGI--QGCPAFDLSAACSGFVYALSVADQHIKT-GMAKNVLVIGSDAVSHTCDPEDRS
FABH_PSEA6       KALDV--DGIPAFDVAAACAGYCYALSVADQYIKS-GMAKRILVVGTDCLSRMISPEDRT
FABH_SHEON       AMLGV--HTIPAFDIAAACSGFVYALSVADQFVKN-GTAKKVLVIGADVLSRLCEPEDRT
FABH_PSYIN       NLLGI--YDIPAFDISAACAGFTYALSAADNFIKA-GSAKKVLVIGADTLAATCDSTDRS
FABH_ACTP2       GMLDI--QDAIAFDVAAACTGFVYALSVADQFIRS-GKIKKALVIGSDLNSRALDETDRS
FABH_HAEDU       GMLAI--EDAIAFDVAAACTGFIYALSVADQFIRA-GKVKTAFVVGADVNSRVLDEADRG
FABH_HAEI8       GLLNI--DDAISFDLAAACTGFVYALSVADQFIRA-GKVKKALVIGSDLNSRKLDETDRS
FABH_HAEIG       GLLNI--DDAISFDLAAACTGFVYALSVADQFIRA-GKVKKALVIGSDLNSRKLDETDRS
FABH_HAEIN       GLLNI--DDAISFDLAAACTGFVYALSVADQFIRA-GKVKKALVIGSDLNSRKLDETDRS
FABH_ACTSZ       GMLNI--NDAISFDLAAACTGFVYALSVADQFIRA-GTVKKALVIGSDLNSRNLDETDRS
FABH_HAES1       GMLDI--DDAISFDLAAACTGFIYALSVADQFIKT-GKVKKALVIGADINSRKLDETDRS
FABH_HISS2       GMLDI--DDAISFDLAAACTGFIYALSVADQFIKT-GKVKKALVIGADINSRKLDETDRS
FABH_PASMU       KMLGI--KDAIAFDVAAACSGFVYALTVADQFIRT-GKVKKALVIGADLFSRALNPEDRG
FABH_BAUCH       RDLGI--MDCVAFDLAAACAGFPYALSIVDQYIKN-GVIEYALVIGSDVLSNTPAPDDRS
FABH_SODGM       RELGI--NDCIAFDLAAACAGFSYALSVADNYIKN-GAVEYALVVGSDALSHTLDPEDRG
FABH_BLOFL       RDLKI--SDTIAFDLSAACSGFVYALDVANQYIKN-GVVKYALIVGSDILSHFLNPNDRS
FABH_BLOPB       RDLHI--RDTIAFDLSAACSGFVYALGVADQYVKN-GSVDYALVVGSDTLSHALNPRDRG
FABH_SALCH       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKHALVVGSDVLARTCDPGDRG
FABH_SALPB       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKHALVVGSDVLARTCDPGDRG
FABH_SALTY       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKHALVVGSDVLARTCDPGDRG
FABH_SALTI       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GVVKHALVVGSDVLARTCDPGDRG
FABH_SALPA       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKHALVVGSDVLARTCDPGDRG
FABH_SALAR       SMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKHALVVGSDVLARTCDPSDRG
FABH_CITK8       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVIGSDVLARTCDPTDRG
FABH_ECO24       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_SHISS       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECO57       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOLI       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOUT       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOK1       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOL5       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOL6       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_SHIBS       SMLDI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_SHIF8       SMLDI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_SHIFL       SMLDI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOHS       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_ECOLC       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_SHIDS       SMLGI--KGCPAFDVAAACAGFTYALSVADQYVKS-GAVKYALVVGSDVLARTCDPTDRG
FABH_KLEP7       SMLGV--KGCPAFDVAAACAGFTYALSVADQYVKN-GAVDYALVVGADVLARTCDPADRG
FABH_ENT38       GMMGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVKYALVIGADVLARTCNPEDRG
FABH_CROS8       GMLGI--KGCPAFDVAAACAGFTYALSIADQYVKS-GAVNNALVIGSDVLARTLDPEDRG
FABH_YERP3       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERPS       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERPA       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERPE       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERPN       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERPP       RMLGI--KDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDVLSRALDPEDRG
FABH_YERE8       QMLGI--EDAASFDLAAACAGFTYALSVADQYVKS-GAVKHAIVIGSDMLSRALDPEDRG
FABH_SERP5       QMLGI--KDCAAFDLAAACAGFTYALSVADQYVKN-GAVKHALVIGADVLSRTLDPEDRG
FABH_PECAS       QLLGI--KDTIAFDLAAACAGFTYALSVADQYVKS-GAVKYALVIGSDTLSRTLDPEDRG
FABH_PHOLL       HMLGT--QNSAAFDISAACSGFVYALSIADKFIKT-GVAKHALVIGSDSITRTLDPEDRG
FABH_MARHV       ARLGI--QGCPAFDIQAVCSGFVYALATAEKFIRT-GSSKKALVIGAEVFSRILNWEDRT
FABH_THISH       KRLEI--HGCAAFDVQAVCTGFVYALGVADRFIRT-GGAKCALVVGAETLSRIVDWTDRT
FABH_ALKEH       ERLGMR-HGSLAFDLSAACSGFVYGLGVADQFFRT-GAVRRALVIGAETMTRILDWNDRA
FABH_XANAC       ARLGN--IGCGAMDVNAACSGFVYALSVADKFVRS-GDAKTVLVVGAETLTRIVDWTDRT
FABH_XANC5       ARLGN--VGCGAMDVNAACSGFVYALSVADKFVRS-GDAKTVLVVGAETLTRIVDWTDRT
FABH_XANOM       ARLGN--VGCGAMDVNAACSGFVYALSVADKFVRS-GDAKTVLVVGAETLTRILDWTDRT
FABH_XANC8       ARLGN--VGCGAFDVNAACSGFVYALSVADKFVRS-GDAKTVLVVGAETLTRIVDWTDRT
FABH_XANCP       ARLGN--VGCGAFDVNAACSGFVYALSVADKFVRS-GDAKTVLVVGAETLTRIVDWTDRT
FABH_XYLFA       ARLGA--VGCGAFDVNAACSGFVYALSVAEKFVSS-GCSKTVLVVGADTLTRIIDWSDRT
FABH_XYLFT       ARLGA--VGCGAFDVNAACSGFVYALSVAEKFVSS-GCSKTVLVVGADTLTRIIDWSDRT
FABH_METCA       QRLGVR-SC-AAFDVQAACSGFIFALSIADQYISA-GNANRVLVVGTEVNSRSVDWDDRS
FABH_THIDA       SKLGMT-NGKPAFDLQAVCSGFVYALSVADQFIKG-GAAKHVLVVGAETLSRITDWNDRS
FABH_ACIET       NKLGA--NGCPAFDVQAVCSGFVYALTVADAMIRS-GGARRALVVGSEVFSRILDFNDRT
FABH_ACISJ       NKLGA--NGCPAFDVQAVCSGFVYALTVADAMIRS-GGARRALVVGSEVFSRILDFNDRT
FABH_DELAS       NKLGA--NGCAAFDVQAVCSGFVYALTVADAMIQS-GAASRALVVGSEVFSRILDFNDRT
FABH_ACIAC       NKLGA--NGCPAFDVQAVCSGFIYALTVADSMIRS-GAARRALVVGSEVFSRLLDFNDRT
FABH_VEREI       NKLGA--NGCPAFDLQAVCSGFVYALSVADSMVRA-GAANCALVVGAEVFSRILDFNDRT
FABH_POLNA       HKLGI--AGCPAFDLQAVCSGFVYALTVADAMIKS-GAASKALVIGAEVFSRILDFSDRT
FABH_POLSJ       NKLGI--AGCPAFDVQAVCSGFVYALTVADALIKT-GSATKALVIGAEVFSRILDFSDRT
FABH_VARPS       NKLGV--AGCPAFDVQAVCSGFVYALTVADAMIRT-GTARCALVVGAEVFSRILDFNDRT
FABH_RHOFT       DKLGA--NGCPAFDVQAVCSGFIYALSIADAMIKT-GAAKKALVIGAEVFSRILDFKDRT
FABH_BURCC       NKLGIK-NGGAAFDVQAVCSGFAYAMATADSFIRS-GQHRTALIVGAETFSRILDFKDRT
FABH_BURCH       NKLGIK-NGGAAFDVQAVCSGFAYAMATADSFIRS-GQHRTALIVGAETFSRILDFKDRT
FABH_BURCA       NKLGIK-NGGAAFDVQAVCSGFAYAMATADSFIRS-GQHRTALIVGAETFSRILDFKDRT
FABH_BURL3       NKLGIK-NGGAAFDVQAVCSGFAYAMATADSFIRS-GQHRTALVIGAETFSRILDFKDRT
FABH_BURVG       NKLGIK-SGGAAFDVQAVCSGFAYAMAMADSFIRG-GQHRTALVVGAETFSRILDFKDRT
FABH_BURM7       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAEAFSRILDFKDRT
FABH_BURM9       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAEAFSRILDFKDRT
FABH_BURMA       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAEAFSRILDFKDRT
FABH_BURMS       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAEAFSRILDFKDRT
FABH_BURP1       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAETFSRILDFKDRT
FABH_BURPS       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAETFSRILDFKDRT
FABH_BURP6       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAETFSRILDFKDRT
FABH_BURP0       NKLGIK-NGGAAFDVQAVCSGFAYALATADSFIRT-GQHRTALVIGAETFSRILDFKDRT
FABH_BURTA       NKLGIK-NGGAAFDVQAVCSGFAYALAMADSFIRT-GQHRTALIVGAETFSRILDFKDRT
FABH_PARP8       NKLGIK-NNGAAFDVQAVCSGFAYAVATADSFIRS-GQHRTALVVGAETFSRILDFNDRT
FABH_CUPNH       EKLGIT-NHCPAFDLQAVCSGFVYALATADKFIRS-GSHRNVLVIGTEVFSRILDFNDRT
FABH_CUPTR       EKLGIT-NHCPAFDLQAVCSGFVYALATADKFIRS-GSHRNVLVIGTEVFSRILDFNDRT
FABH_CUPPJ       NKLGIN-NQCAAFDLQAVCSGFVYALATADKFIRS-GSHRNVLVIGTEVFSRILDFNDRT
FABH_RALPJ       QKLGIT-NGCAAFDVQAVCSGFVYALATADKFIRS-GAYRNVLVIGSEVFSRIIDFSDRT
FABH_RALSO       QKLGLS-NHCAAFDLQAVCSGFVYGLATADKFIRA-GGYRNALVIGAEVFSRILDFNDRT
FABH_HERAR       RKLGVT-NGCAAVDVQAVCSGFVYALATADKFIKS-GSHKNVLVIGAEVFSRIIDFKDRT
FABH_JANMA       RKLGIT-NDCAAVDVQAVCSGFVYAVSIADNFIKA-GTHKNVLVIGAEVFSRIIDFEDRT
FABH_POLNS       DKLGAH-TSCAAFDVQAVCAGFTYALAVADAFIRS-GSYKKVLVIGAETFSRILNFQDRG
FABH_POLAQ       DKLGAH-TACAAFDVQAVCAGFTYALATADAFIRT-GSYKKVLVIGAETFSRILDFQDRG
FABH_AROAE       SKLGIR-NGAAAFDVQAVCSGFVYGLTIAEKFIRS-GSHKRALVVGAEVFSRILDWSDRG
FABH_AZOSB       SKLGIG-NNGAAFDVQAVCSGFVYALSIAEKFIRS-GSHKRALVVGAEVFSRILDWTDRA
FABH_BORBR       ANLGA--KGGAAFDVQAVCSGFVYAMTTADSFIRA-GRARCALVIGAEVFSRILDWNDRG
FABH_BORPA       ANLGA--KGGATFDVQAVCSGFVYAMTTADSFIRA-GRARCALVIGAEVFSRILDWNDRG
FABH_BORPE       ANLGA--KGGAAFDVQAVCSGFVYAMTTADNFIRA-GRARCALVIGAEVFSRILDWNDRG
FABH_BORPD       ANLGA--KGGAAFDVQAVCSGFVYALSTADAFVRA-GRARCALVIGAEVFSRILDWNDRS
FABH_BORA1       ANLGA--KGGAAFDVQAVCSGFAYALTTADSFVRA-GRVRCALVIGAEVFSSILDWNDRS
FABH_CHRVO       EKLGLP--GVQAFDVQAVCAGFVYALTTANAYIKS-GLAKKALVVGAEIMSRVLDWDDRR
FABH_LARHH       ERLGLA--GVPAFDVQAVCAGFMYAFATANAFIRS-GQIKRALVIGAETLSRLIDWDDRR
FABH_NEIG1       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NEIG2       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NEIM0       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NEIMF       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NEIMB       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NEIMA       QKLGIT-NGCPAFDVQAVCAGFMYALTTANAYIKS-GMAKNALVIGAETFSRIVDWNDRT
FABH_NITEC       NKLGI--SGSPAFDVQAVCSGFIYALATADMFVSS-GKSRNALIVGSEVYSRIMDWNDRS
FABH_NITEU       NKLGM--SNGPAFDVQAVCSGFIYALATADMFVSS-GKARNALVVGAEVYSRIMDWNDRS
FABH_NITMU       DKLGI--GDCAAFDVQAVCSGFIYALATADMFIRA-GKCQTALVVGAEVYSRILDWSDRS
FABH_VESOH       TAIGA---SCPAFDLQSVCAGFIFALTTAEQYIKA-SAANKVLVVGSETLSRIVNWNDRS
FABH_DICNV       SRLSC--QRAAAFDVQAACTGFMYALNTADCFIKS-GQYQNVLVIGAEVFSRIVDWQDRN
FABH_COXB2       KHLNLR-EDIPAFDINAACAGFVYALSIADQYIRN-EGAKHILVIGVDSLTKVVDWKDRS
FABH_COXBU       KHLNLR-EDIPAFDINAACAGFVYALSIADQYIRN-EGAKHILVIGVDSLTKVVDWKDRS
FABH_COXBR       KHLNLR-EDIPAFDINAACAGFVYALSIADQYIRN-EGAKHILVIGVDSLTKVVDWKDRS
FABH_COXBN       KHLNLR-EDIPAFDINGACAGFVYALSIADQYIRN-GGAKHILVIGVDSLTKVVDWKDRS
FABH_COXB1       KHLNLR-EDIPAFDINAACAGFVYALSIADQYIRN-GGAKHILVIGVDSLTKVVDWKDRS
FABH_ACICJ       AAIGMT-RGF-AFDLSAACSGFVYGVSVADAMIRA-GQCRSALVIGTEVYSRILNWEDRG
FABH_GRABC       ALLGAK-RGF-GFDLSAACSGFVYGLSMGDALIRS-GQAKGVLVIGAEVFSRLLDWDDRR
FABH_AGRFC       NRLGMT-HGF-AFDMQAVCSGFVYAVATADLYIRG-GMAKRVLVIGAETFSRILDWKDRT
FABH_RHIL3       NRLGMS-HGF-AFDVQAVCTGFVYAVTTADAYIRG-GLAKRVLVIGAETFSRILDWNDRT
FABH_RHIME       NRLGMR-HGA-AFDMQAVCSGFVYAVATADAYIRG-GLSKRALVIGAETFSRLLDWTDRT
FABH_SINMW       NRLGMR-HGA-AFDMQAVCSGFVYAVTTGDAYIRG-GLATRVLVIGAETFSRILDWTDRT
FABH_AGRRK       NRLGMH-HGF-AFDVQAVCSGFVYAVTTADAYIRG-GVAKRVLVIGAETFSRILDWTDRT
FABH_AGRVS       NRLGMT-HGF-AFDVQAVCTGFVYAMTTADAYIRG-GLAKRVLVIGAETFSRILDWQDRT
FABH_BRUA1       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUA2       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUAB       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUME       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUC2       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSHILDWTDRT
FABH_BRUSU       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSHILDWTDRT
FABH_BRUMB       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUO2       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_BRUSI       RELGIT-RGF-AFDLQAVCSGFIYAITTADLYIRG-GMARRVLVIGAETFSRILDWTDRT
FABH_OCHA4       RELGIT-KGF-AFDMQAVCSGFIYAITTADLYIRG-GMAKRVLVIGAETFSRILDWNDRT
FABH_RHILO       NRLGMH-HGF-AFDMQAVCSGFVYAVTTADLYIRG-GLAKRVLVIGSETFSRILDWNDRS
FABH_CHESB       ERLGIR-QGF-AFDMQAVCSGFVYAVTTADLYIRG-GMAKRALVIGAETFSRILDWTDRT
FABH_BARHE       HALGMS-HGF-AFDIQAVCSGFIFALTTGDAYLRC-GTAKRILVIGSDTFSRILDWQDRT
FABH_BARQU       HALGMS-HGF-AFDIQAVCSGFIFALTTGDAYLRS-GVAKRILVIGSETFSRILDWKDRT
FABH_BART1       YALGMN-HGF-AFDIQAVCSGFIFALTTGDSYLRC-GAAKRILVIGSDTFSRILDWEDRT
FABH_BARBK       HALGMS-HGF-SFDVQAVCSGFIFALTIGDVYLRS-GEAKRVLVIGSETFSRILDWKDRT
FABH_BRASB       DGLGIH-HGA-AFDLQAVCSGFVYALATADNFLRS-GSFKRALVIGAETFSRILDWNDRT
FABH_BRASO       NGLGIH-HGA-AFDLQAVCSGFVYALATADNFLRS-GSFKRALVIGAETFSRILDWNDRT
FABH_BRADU       HGLGIN-HGA-AFDLQAVCSGFVFALATADNFLRT-GAFKRALVIGAETFSRILDWNDRG
FABH_ERYLH       EALGCN-GCI-AFDVQAVCSGFLYALATADSLLKT-GMAKRALVIGAETFSRILDWEDRT
FABH_NOVAD       HNLGCN-GGI-AFDVAAVCSGFLYALATADSMIRS-GMARCALVIGAETMSRLLDWEDRT
FABH_SPHAL       ALLGAP-DCI-AFDVAAVCSGFLYAVSVADAMLRT-GAARHALVIGSETFSRILDWNDRT
FABH_SPHWW       AALGIG-DCV-AFDVQAVCSGFLYALSVADSMIRG-GSATHALVIGAETFSRILDWEDRT
FABH_RHOCS       ARLGIT-RGA-AFDVQAVCSGFVYALAIADNFIKA-GQARTALVIGAETFSRILDWTDRT
FABH_RHORT       AGLGCR-PGAPAFDIQAVCSGFLYALSVADALIKA-GQARTALVIGAETFSRILDFTDRT
FABH_MAGSA       SRIGMR-HGF-AFDVQAVCSGFVYALSVADNFIKS-GQVQTALVIGAETFSRILDWTDRT
FABH_CAUVC       RKLGAP-VGV-AFDVQAVCSGFVYAMSVADGFVAR-GHSKCALVIGAEAMTRLMDWSDRG
FABH_HYPNA       AKLGTG-PGA-AFDVQAVCSGFLFALATADSLMKQ-GLFHKALVIGAETFTRIIDWSDRG
FABH_RHOS1       AALGMT-RGF-AFDVQAVCAGFVYALANADALIRS-GQAQRVLVIGAETFSRLMDWNDRA
FABH_RHOS4       AALGMT-RGF-AFDVQAVCAGFVYALANADALIRS-GQAQRVLVIGAETFSRLMDWNDRA
FABH_RHOS5       AALGMS-RGF-AFDVQAVCAGFVYALANADALIRS-GQANRVLVIGAETFSRLMDWSDRA
FABH_RUEPO       ARLGMT-NGY-AFDVQAVCAGFVYALSNANALIVS-GQAKRVLVIGAETFSRIMDWTDRS
FABH_RUEST       SQLGMT-KGF-AFDVQAVCAGFVYALSNANALIAS-GQADRVLVIGAETFSRIMDWTDRS
FABH_ROSDO       AELGMT-RGF-AFDVQAVCAGFVFALSNANALILS-GQARRVLVIGAEAFSRIMDWTDRS
FABH_DINSH       ARLGMT-RGF-AYDVQAVCAGFVFAMANANAMILS-GQADRILVIGAETFSRIMDWTDRS
FABH_JANSC       AGLGMT-GGF-AFDVQAVCAGFVYALANANALIVS-GQANRVLVIGAETFSRIMDWTDRT
FABH_PARDP       AGLGMR-HGF-AYDLQAVCAGFVYALANADALIRA-GLADRVLLIGAETFSRIMDWTDRG
FABH_RHOCA       AGLGNT-NAF-AFDVQAVCAGFVFALANANGMILS-GQAKRVLVIGAETFSRIMDWADRG
FABH_EHRCJ       SKLGCK-NAF-AFDIQAVCSGFVYALSIADNFIKS-GQVRTVLVIGAEIMSRILDWQDRS
FABH_EHRCR       DKLECK-NAF-AFDIQAVCSGFVYAISIADNFIKS-GQVNTALVIGAEIMSRILDWQDRS
FABH_EHRRG       SKLECK-NAF-AFDIQAVCSGFIYAMAIADNFIKS-GQVNVSLVIGAEVMSRILDWKDRS
FABH_EHRRW       SKLECK-NAF-AFDIQAVCSGFIYAMAIADNFIKS-GQVNVSLVIGAEVMSRILDWKDRS
FABH_WOLPM       SKLKCK-NAF-AFDVQAACSGFIYAVTVADSLIKSNNRIKYALVIGAEIMSRIVDWEDRS
FABH_WOLPP       SKLKCK-NAF-SFDVQAACSGFIYAVTVADSLIKSHNRIKYALVIGAEIMSRIVDWEDRS
FABH_WOLTR       NKLKCK-NAF-SFDVQAACSGFIYAVTIADSLIKSNDRIKYALVIGAEIMSRIVDWKDRS
FABH_ANAMM       GSLGCK-NAA-AFDINAACSGFLYALSIVDSMIKA-GQANIALIIGSEAMSKVVDWTDRS
FABH_RICRO       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLISS-DKYKTILLIGAEKMTSLLDWNDRT
FABH_RICRS       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLISS-DKYKTILLIGAEKMTSLLDWNDRT
FABH_RICCN       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLISS-DKYKTILLIGAEKMTSLLDWNDRT
FABH_RICM5       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLISS-GKYKTILLIGAEKMTSLLDWNDRT
FABH_RICFE       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLIAS-GKYKTVLLIGAEKMTSLLDWSDRS
FABH_RICAH       GYLGLT-NIP-SFDLQAVCAGFVYGLQVADSLIAS-GKYKTILLIGAEKMTSLLDWNDRS
FABH_RICCK       GYLGLT-NIP-SFDLQAVCAGFVYGLQVANSLIAS-SKYKTVLLIGAEKMTSLLDWNDRS
FABH_RICPR       GYLGLT-NIP-SFDLQAVCAGFIYGLQLAHSLIVS-GKYKTILLIGAEKMTSLLDWNDRS
FABH_RICTY       GYLGLT-NIP-SFDLQAVCAGFIYGLQLTNSLIVS-GKYKTILLIGAEKMTSLLDWNDRS
FABH_RICB8       SYLGLN-NVP-SFDLQAVCAGFVYGVQVANSLISS-GKYKTILLIGAEKMTSLLDWEDRA
FABH_RICBR       GYLGLN-NVP-SFDLQAVCAGFVYGVQVANSLISS-GKYKTILLIGAEKMTSLLDWEDRA
FABH_NEOSM       ARLGIG-RHILSFDVNAACTGFLYALSIVDAMIVS-GKVSTVLLVGAEAMSTIIDWNDRN
FABH_AQUAE       AQLKA--KGVYAFDISAACSGFIYALDIADSFIKS-GKAKNVLVIGAEKLSEAVDWEDRS
FABH_PERMH       DKLGS--SKPMAFDISAACSGFIYGLTLANSFIKS-GQFENILVVGAEVFSQIIDWNDRS
FABH_SULDN       TKLGL--ENVTAFDISAACTGFVYILSIAKAFIES-GMKKNVLIIGAEKLSSITDYTDRG
FABH_SULNB       DKLGI--RNVQAFDISAACSGFVYLLTVAKAFIES-GMKKNVLIIGAEKFSSVVDYTDRS
FABH_ARCB4       AKLGL--SNVMAFDVSAACTGFVYALNVAKAFIES-GMKKNVLIVGAEKYSAILDYTDRT
FABH_HELP2       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMCENVLIVGAEKTSSVLDFKDRG
FABH_HELPG       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMCENVLIVGAEKTSSVLDFKDRG
FABH_HELPY       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMYENVLIVGAEKTSSVLDFKDRG
FABH_HELPS       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMCENVLIVGAEKTSSVLDFKDRG
FABH_HELPJ       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMYENVLIVGAEKTSSVLDFKDRG
FABH_HELPH       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMCENVLIVGAEKTSSVLDFKDRG
FABH_HELAH       AKLGI--ENKPAFDISAACTGFIYLLSVAKAYVES-GMYENVLIVGAEKTSSVLDFKDRG
FABH_HELHP       FKLGI--ENKAAFDISAACSGFVYLLSLAKSFIES-GTYKQILIIGAEKTSSVLDFSDRS
FABH_CAMC1       ANLGLN-FGITAFDISAACTGFIYLLELANSLIVS-GAKKNVLIIGAEKLSSIIDYTDRS
FABH_CAMC5       ANLGLD-YGITAFDISAACTGFIYLLQLANSLIKS-GAKKNVLIVGAEKLSSVVDYTDRS
FABH_CAMFF       SNLGL--FDVTAFDISAACTGFIYLLEIAKSLVES-GAKKNVLIIGAEKLSSIINWQDRS
FABH_CAMHC       EKLGLN-KGITAFDISAACSGFIYLLEIGSALIKS-GAKKNVLIIGTEKLSSIVDWKDRA
FABH_CAMJE       SNLGL--VNISAFDISAACSGFIYLLEQAKALVES-GLKKNVLIIGAEKTSSIMDYNDRS
FABH_CAMJJ       SNLGL--VNISAFDISAACSGFIYLLEQAKALVES-GLKKNVLIIGAEKTSSIMDYNDRS
FABH_CAMJ8       SNLGL--VNISAFDISAACSGFIYLLEQAKALVES-GLKKNVLIIGAEKTSSIMDYNDRS
FABH_CAMJR       SNLGL--VNISAFDISAACSGFIYLLEQAKALVES-GLKKNVLIVGAEKTSSIMDYNDRS
FABH_CAMJD       SNLGL--VNISAFDISAACSGFIYLLEQAKALVES-GLKKNVLIIGAEKTSSIMDYSDRS
FABH2_BACTN      DKLGL--KNAFAFDLQAACCGFLYLMETAANFIRS-GRYKKIIIVGADKMSSMVNYTDRA
FABH_BACV8       DKLGL--KNAFAFDLQAACCGFLYLMETAASLIAS-GRHKKIIIVGADKMSSMVNYQDRA
FABH1_BACTN      ERLGL--KNAFAFDMQAVCSGFLYAMETGANFIRS-GKYKKIIIVGADKMSSVIDYTDRA
FABH_PARD8       YHTGC--KNAMTFDMQGACAGFLYALETGANYIRS-GRYKKVVVVSGDKMTSITDYQDRS
FABH_PORG3       HEIGC--GDIFSFDMQAACPTFIYALEVGANFIRS-GRYSKILVIATEKMTAFTDYTDRA
FABH_PORGI       HEIGC--GDIFSFDMQAACPTFIYALEVGANFIRS-GRYSKILVIATEKMTAFTDYTDRA
FABH_AZOPC       HKVGI--TNAFGFDMEAACSGFIYALEVAQGFIVS-GKHKKVMIIAGDVLSVFIDYSDRN
FABH_PELLD       DIIGA--KNAWAFDINAACSGFLYALNTASQFIKA-GTHKNVMVIGGDKMSSIIDYTDRS
FABH_CHLPM       DIIGA--GNAWAFDLNAACSGFLFALNTGSRFIES-GAHKKVMVIGADKMSSVIDYTDRS
FABH_CHLCH       DLIGA--KNAWAFDLNAACSGFLYALNTAIRFVES-GAHKKVMVIGADKMSSIIDYTDRA
FABH_CHLPD       GIIGA--TNAWAFDINAACSGFLFALSTASRLIES-GAHKKVMVIGGDKMSSVIDYTNRS
FABH_CHLTE       GNIQA--KNAWGFDLSAACSGFVYGLYTGAQFIES-GNCKKVMVIGADKMSSILDYEDRT
FABH_KORVE       HKLGI--PNAWGFDVSAGCSGFLFSLTTGAKFIES-GQYKKVLVIGSDVNSSMIDYTDRA
FABH_SOLUE       NAIGA--KGAWGFDLIAACSGFLYGLTTGAHFVMA-GTHKKVLVIGSDTMSRIIDYTDRA
FABH2_VIBVU      KNLEI--EAAAAFDLNAACTGFVYGLETGTRLIQS-GAYRHALIIGAERLSFYIDWAMRD
FABH2_VIBVY      KNLEI--EAAAAFDLNAACTGFVYGLETGTRLIQS-GAYRHALIIGAERLSFYIDWAMRD
FABH2_VIBPA      QNLGI--RSAAAFDLNAACTGFVYGLETGTRLIQS-GNYRHAIIIGAERLSFYIDWAMRD
FABH2_VIBCH      QNLGI--PSAAAFDLNAACTGFLYGLETATRLMQA-SHYRHALVIGAERLSFYLDWTKRD
FABH_PSET1       KNIGA--VGAAAMDTNAACSGFLYALQAATAQIQA-GMIKKAVVIAAERMTWYVNWSRRD
FABH_TRIV2       AELGATK--AVAFDLTAACSGFVFGLVTAAQFIRT-GVYQNVLLIGADILSRWVDWQDRR
FABH_NOSS1       AELGANK--AVAFDLTAACSGFVFGLVTAAQFIRT-GVYQNVLLIGADILSRWVDWQDRR
FABH_TRIEI       WELGAQK--AVAFDITVACSGFLFALVTGAQFIRN-GVYQNVLLIGADILSRWVDWEDRR
FABH_ACAM1       AAIGAKH--AVAFDLTAACSGFVFGMITAAQFIRT-GVYRNVLLVGADVLSRWVDWTDRR
FABH_SYNE7       AALGATQ--AVAFDLTAACSGFLFALVTGAQFIRS-GAYRTVLVIGADVLSRWTDWSDRR
FABH_SYNP6       AALGATQ--AVAFDLTAACSGFLFALVTGAQFIRS-GAYRTVLVIGADVLSRWTDWSDRR
FABH_MICAN       SQIGANR--AIAFDLTAACSGFLVGLVTATQFIRT-GTYRNVLVIGADVLSRWVDWNDRA
FABH_SYNY3       GGLGATR--AFAFDITAACSGFVVGLNVAAQFLRT-GVYQRVLIVGGDVLSRWVDWSDRT
FABH_THEEB       TRIGAVN--AVAFDLTAACSGFLFALVTAAQYLRT-GAYRSALVVGGDILSRWVDWGDRR
FABH_GLOVI       HEIGAVR--AVAFDLTAACSGFVFALATASQFVRT-GTYRTVLVVGADALSRYTDWTDRA
FABH_PROM0       AKLGAAN--AVAFDLTAACSGFLFALITTSQFLKG-GSFKRAIVIGADQLSSFVDWNDRR
FABH_PROM9       AKLGAHN--AVAFDLTAACSGFLFALITASQFLKG-GSFKRAIVIGADQLSSFVDWNDRR
FABH_PROM2       SKLGASN--AVAFDLTAACSGFLFALITTSQFLKA-GNFKRALVVGADQLSSFVDWNDRR
FABH_PROM5       SKLGANN--AVAFDLTAACSGFLFAVITATQFLKA-GSYRRAIVIGSDQLSSYVDWNDRR
FABH_PROMP       SKLGAIN--AVAFDLTAACSGFLFAAITATQFLKA-GSYKRAVVIGSDQLSSYVDWNDRR
FABH_PROMA       SKLGATR--AVAFDLTAACSGFLFGLVSAAQFLQN-GSFKRAVVIGADQLSGWVDWDDRS
FABH_PROMT       SNLGASN--AVAFDLTAACSGFLFALVTASQYLAS-GSMKRALVIGADQLSKWVDWDDRK
FABH_PROMM       AILGARQ--AVAFDLTAACSGFLFALITAAQFLRT-GAMRRALVIGADQLSRWVDWDDRR
FABH_SYNR3       ALIGAGS--AVAFDLTAACSGFLFSLVTAAQYLRT-GAMTRALVIGADQLSRWVDWDDRR
FABH_SYNPW       AELGATN--AVAFDLTAACSGFLFALVTAAQYLRT-GAMRRALVIGADQLSRFVDWDDRR
FABH_PORPU       AEIGATS--STAFDITAACSGFIIALVTASQFIQA-GSYNKVLVVGADTMSRWIDWSDRS
FABH_PORUM       AEIGATS--STAFDITAACSGFIIALVTASQFIQA-GSYNKVLVVGADTMSRWIDWSDRS
FABH_PYRYE       AEIGATT--PVAFDITAACSGFIVALVTAAQFIQL--VYDNILVVGADTCLDGLIGQIEL
FABH_GRATL       AKIGAAR--AVAFDLTAACSGFVLAIVTATQFIQN-GSYKNILIIGADVLSKWIDWSDRK
FABH_RHOBA       RRLGAV---APAMDIGAACAGFMYALVTGAQFVSN-GNARNVLVIGADLMSRTVDPEDKK
FABH1_STRCO      DRLGTD--KAAAFDISAGCAGFGYGLTLAKGMVVE-GSAEYVLVIGVERLSDLTDLEDRA
FABH_STRGA       DKLGTN--KAAAFDISAGCAGFGYGLTLAKGMIVE-GSAEYVLVIGVERLSDLTDLEDRA
FABH_KOCRD       DRLGAT--PAAAYDISAACAGYCYGVAQADSLVRS-GDSTNVLVIGVEKLSDVIDNHERS
FABH_MYCA1       AALGAT--GVPAFDISAGCAGFGYALGVAADMVRG-GTAGKVLVLGSEKLSPTVDMTDRS
FABH_MYCPA       AALGAT--GVPAFDISAGCAGFGYALGVAADMVRG-GTAGKVLVLGSEKLSPTVDMTDRS
FABH_MYCMM       AALGCQ--NVPAFDISAGCSGFGHALGIAADMIRG-GSAATILVIGTEKLSPTVDMTDRS
FABH_MYCUA       AALGCQ--NVPAFDISAGCSGFGHALGIAADMIRG-GSAATILVIGTEKLSPTVDMTDRS
FABH_MYCTA       ASLGAK--GILGFDLSAGCAGFGYALGAAADMIRG-GGAATMLVVGTEKLSPTIDMYDRG
FABH_MYCTU       ASLGAK--GILGFDLSAGCAGFGYALGAAADMIRG-GGAATMLVVGTEKLSPTIDMYDRG
FABH_MYCBO       ASLGAK--GILGFDLSAGCAGFGYALGAAADMIRG-GGAATMLVVGTEKLSPTIDMYDRG
FABH_MYCBP       ASLGAK--GILGFDLSAGCAGFGYALGAAADMIRG-GGAATMLVVGTEKLSPTIDMYDRG
FABH_MYCBT       ASLGAK--GILGFDLSAGCAGFGYALGAAADMIRG-GGAATMLVVGTEKLSPTIDMYDRG
FABH_MYCA9       TALGAQ--GVPAFDLSAGCAGFGYAVGVAGDMIRG-GSASKVLVIGSEKLSPALDMTDRG
FABH_STRLI       HELGAD--NAGGFDLSAACAGFCHALSIAADAVES-GGSRHVLVVATERMTDVIDLADRS
FABH2_STRAW      ARLGIP--SPAAMDINVVCAGFTHALATADHAVRA-GAATRALVIGADKMSAVTDWSDRT
FABH4_STRCO      ARLGIP--GPAALDLNVVCAGFTHALATADHAVRA-GSASRALVVGADKMSEVVDWTDRT
FABH2_STRCO      SRLGLR--AAAAFDLSAVCSGFVYGLSVASAMITA-GTCDRALVIGADVYSSIVDPDDRG
FABH5_STRCO      DRLGLS--GVAAYDIAAVCSGFIYGLASAVAHITA-GLVGSALVIGAETYSTILDPLDRT
FABH3_STRCO      ARLGTG--PVPAFDVSAVCSGFLYGLATGSGLIAS-GAAERVLVIGAETFSRILNPQDRS
FABH_PSEA8       ARLGLV--GALAFDLSAACTGFVYGLASVGSLISA-GLADSALLVGVDTFSHTLDPADRS
FABH_PSEAB       ARLGLV--GALAFDLSAACTGFVYGLASVGSLISA-GLADSALLVGVDTFSHTLDPADRS
FABH_PSEAE       ARLGLV--GALAFDLSAACTGFVYGLASVGSLISA-GLADSALLVGVDTFSHTLDPADRS
FABH_LACBA       GNIGAT--KAVALDVNAACSGFVYGLQVVHRLLMG-DSPKTALLIGGETLSRLVDWQDRS
FABH_LACH4       GNIGAD--HAIAFDIDAACSGFVYGLHLVKQMLIA-NQQKNAILIGGETLSKLLDWSDRS
FABH2_LACPL      AAIGAE--KAIAFDINVACAGFVYGMQLVHQYLQP-GQ--TALLIGSETLSRLVDWHDRS
FABH_OENOB       ALAGLS--NAFAMDINVACSGFVYGLTLAHGLVNT-LGSHYGVVIGAETLSKLVDWQERS
FABH_LACDA       AAVGAE--NAACFDLSAACSGFVYALDVAEKMLRR-P-GGMALVIGAETLSKLVDWQDRT
FABH_LACDB       AAVGAE--NAACFDLSAACSGFVYALDVAEKMLRR-P-GGMALVIGAETLSKLVDWQDRT
FABH_LACRD       GELGAK--NAIAFDISAACTGFIYAMNTAELMLKS-SNWQNAMVIGAEVLSKLIDWKDRS
FABH_LACRJ       GELGAK--NAIAFDISAACTGFIYAMNTAELMLKS-SNWQNAMVIGAEVLSKLIDWKDRS
FABH_LACSS       GRLGAD--QAFAFDISAACSGFTYALSAARGYVQT-P-DDYVLVIGGEVISKMLDWSDRS
FABH_LACLM       AQVGAT--NAFAYDLTAACSGFVFALSTAEKLISS-GAYQRGIVIGAEVFSKVIDWSDRS
FABH_LACLS       AQVGAT--NAFAYDLTAACSGFVFALSTAEKLISS-GAYQRGIVIGAEVFSKVIDWSDRS
FABH_LACLA       AQVGAV--NAFAYDLTAACSGFVFALSTAEKLISS-GAYQRGLVIGAEVFSKVIDWSDRS
FABH_STRA1       AHIGAS--NAFAFDLSAACSGFVFALSTAEKLISS-GSYQKGLVIGAETVSKVLDWTDRG
FABH_STRA3       AHIGAS--NAFAFDLSAACSGFVFALSTAEKLISS-GSYQKGLVIGAETVSKVLDWTDRG
FABH_STRA5       AHIGAS--NAFAFDLSAACSGFVFALSTAEKLISS-GSYQKGLVIGAETVSKVLDWTDRG
FABH_STRE4       AAIGAT--NAFAFDMTAACSGFVFALAMADKLIAS-GAYQRGLVIGAETLSKIIDWQDRS
FABH_STRS7       AAIGAT--NAFAFDMTAACSGFVFALAMADKLIAS-GAYQRGLVIGAETLSKIIDWQDRS
FABH_STREM       AAIGAT--NAFAFDMTAACSGFVFALAMADKLIAS-GAYQRGLVIGAETLSKIIDWQDRS
FABH_STRP1       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPG       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRP3       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPM       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRP8       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPQ       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPB       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPC       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPD       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRP6       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPZ       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRPF       AAIAAT--SAFAFDMTAACSGFVFALAMADKLIAS-GAYQNGMVIGAETLSKLVNWQDRA
FABH_STRU0       GTIGAT--HAFAFDMTAACSGFVFALAMADKLIRS-ASYQKGLVIGAEVLSKYLDWEDRS
FABH_STRGC       ANIGAK--KAFAYDLVAACSGFVFALSTAEKLISS-GAYQKGLVIGSETLSKVVDWSDRG
FABH_STRSV       ANIGAK--NAFAFDLTAACSGFIFALSTGEKFISS-GRYQKGLVIGSETLSKTVDWSDRS
FABH_STRP7       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRPS       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRP2       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRPI       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRR6       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRPJ       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRPN       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRZJ       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRZT       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRP4       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRZP       ANIGAN--KAFAFDLTAACSGFVFALSTAEKFIAS-GRFQKGLVIGSETLSKAVDWSDRS
FABH_STRMU       AKIGAV--NAFAFDLTAACSGFIFALSAAEKMIKS-GQYQKGLVIGAEVLSKIIDWSDRT
FABH_STRT1       GTIGAV--NAFAFDITAACSGFVFALATAEKLIKS-GAYKKGLVIGAEVLSKTLDWSDRA
FABH_STRTD       GTIGAV--NAFAFDITAACSGFVFALATAEKLIKS-GAYKKGLVIGAEVLSKTLDWSDRA
FABH_STRT2       GTIGAV--NAFAFDITAACSGFVFALATAEKLIKS-GAYKKGLVIGAEVLSKTLDWSDRA
FABH_STRS2       AAIGAK--NAFAYDLVAACSGFVFALSTAEKLLAS-GVYKRGLVIGAETLSRSVDWSDRS
FABH_STRSY       AAIGAK--NAFAYDLVAACSGFVFALSTAEKLLAS-GVYKRGLVIGAETLSRSVDWSDRS
FABH_ENTFA       GAIGAT--EAFAFDISAACSGFVYALSMAEKLVLS-GRYQTGLVIGGETFSKMLDWTDRS
FABH1_LACPL      ANIGAD--NAFAFDLSAACAGFTFGLATADKFIRS-GQYQNVMVISAEVNSKMMDFQDRT
                                   *             .         .  . :          . 

FABH1_BACAN      TAVLFGDGAGAIVMGAV------------------SEGKGVLSFELGA-DG-------SG
FABH1_BACCR      TAVLFGDGAGAVVMGAV------------------SEGKGVLSFELGA-DG-------SG
FABH1_BACSU      TAVLFGDGAGAAVVGPV------------------SDDRGILSFELGA-DG-------TG
FABH_BACP2       TAVLFGDGAGAAVLGEV------------------SEGKGILSFELGA-DG-------RG
FABH_GEOKA       TAVLFGDGAGAVVMGPV------------------SPGRGILSFELGA-DG-------TG
FABH1_BACHD      TAVLFGDGAGAAVMGAV------------------SEDRGILAYELGA-DG-------EG
FABH_OCEIH       TCVLFGDGAGAAVVGEV------------------GEGKGILSFELGA-NG-------AG
FABH_LISIN       TAVLFGDGAGAVVMGPV------------------SDDHGLLSFDLGS-DG-------SG
FABH_LISW6       TAVLFGDGAGAIVMGPV------------------SDDHGLLSFDLGS-DG-------SG
FABH_LISMF       TAVLFGDGAGAVVMGPV------------------SDDHGLLSFDLGS-DG-------SG
FABH_LISMO       TAVLFGDGAGAVVMGPV------------------SDDHGLLSFDLGS-DG-------SG
FABH1_STAES      TAVLFGDGAGAVVMGEV------------------AEGRGIISYEMGS-DG-------SG
FABH_STAEQ       TAVLFGDGAGAVVMGEV------------------AEGRGIISYEMGS-DG-------SG
FABH_STAAM       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAAN       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAAR       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAA9       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAAB       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAA1       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAA2       TAVLFGDGAGAVIIGEV------------------SEGRGIISYEMGS-DG-------TG
FABH_STAA3       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAAE       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAA8       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAAC       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAAW       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAAS       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAAT       TAVLFGDGAGAVIIGEV------------------SDGRGIISYEMGS-DG-------TG
FABH_STAHJ       TAVLFGDGAGAVVIGEV------------------SEGRGIISYEMGS-DG-------NG
FABH_STAS1       TAILFGDGAGAVVIGEV------------------SEGRGILSYELGS-DG-------SG
FABH_DEIDV       TAILFGDGAGAAVVGPV------------------PEGYGFQDFVLGA-DG-------NG
FABH_DEIGD       TAILFGDGAGAAVVGPV------------------PQGHGFQEFVLGA-DS-------AG
FABH1_DEIRA      TAILFGDGCGCAVVGEV------------------PAGYGFQDFVLGA-DS-------AG
FABH2_DEIRA      TAILFGDGAGCVVIGEV------------------PQGYGFQSFVLGA-DS-------AG
FABH2_BACAN      TCILFGDGAGAILLERD------------------ENKPSFIAYHMGT-NG-------HG
FABH2_BACCR      TCILFGDGAGAILLERD------------------ENTPSFIAAHMGT-NG-------DG
FABH2_BACSU      TCVLFGDAAGALLVERD------------------EETPGFLASVQGT-SG-------NG
FABH2_BACHD      TCILFGDGAGAVLVEYD------------------ENEPSFVSFNLGS-EG-------ER
FABH2_STAES      TCILFGDGAGAFLVEYD------------------KEEMSFIASNAGS-DG-------LK
FABH_ACHLI       TAILFGDAAGAAIIEVS------------------DNPKDNAYFWNGS-RG-------DD
FABH_FUSNN       TCVLFGDGAAAAIIGEV------------------EKGYGFLGFSIGA-EG-------ED
FABH_CLOAB       TCVLFGDGAGAVIIRGG------------------DEN-GIIKACLGS-DG-------TG
FABH_CLONN       TCVLFADGAGAAILTRS------------------EEV-GLISQYTCS-DG-------TG
FABH_CLOB1       TCVLFGDGAGSAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOBH       TCVLFGDGAGSAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOBJ       TCVLFGDGAGAAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOBL       TCVLFGDGAGAAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOBM       TCVLFGDGAGAAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOB6       TCVLFGDGAGAAILSKT------------------KEE-GILEFHSGS-NG-------LK
FABH_CLOBK       TCVLFGDGAGAAILSKT------------------KEE-GILEFHSRS-NG-------LK
FABH_CLOK1       TCILFGDGAAAAILQMG------------------EEE-SILSMYTGS-DG-------FQ
FABH_CLOK5       TCILFGDGAAAAILQMG------------------EEE-SILSMYTGS-DG-------FQ
FABH_CLOTE       TCILFGDGSGAAILTES------------------NEK-GIMNVYLGS-DGRGADLLKCK
FABH_CLOB8       TCILFGDGAGAAVLKRD------------------EAP-GIIKSYLRA-DG-------KK
FABH_CLOP1       SCVLFGDGAGATVLTST------------------EEDCGIKCVNVKS-DG-------SK
FABH_CLOPE       SCVLFGDGAGATVLTST------------------EEDCGIKCVNVKS-DG-------SK
FABH_CLOPS       SCVLFGDGAGAIVLTST------------------EEDCGIKCVNVKS-DG-------SK
FABH_CLOD6       TAVLFGDGAGAAVIGPV------------------NEG-GILSTHMGS-DG-------KG
FABH_CALS4       TCVLFGDGAGAAVVGRV------------------ESGYGILGSYLGA-DG-------TG
FABH_DESHD       TCILFGDGAGAAVLQPV------------------EEGYGFLGYDLGM-DG-------AG
FABH_DESHY       TCILFGDGAGAAVLQQV------------------EEGYGFLGYDLGM-DG-------AG
FABH_SYMTH       TCVLFGDAAGAAVLQPV------------------SEGRGILSSVLGA-EG-------AG
FABH_NATTJ       TCVLFGDGAGAAVLGPVENG---------------EEDKGLISFDLGA-DG-------SK
FABH_SYNWW       TCVLFGDGAGAAVVG---KG---------------NLGPGILSSYLAA-DG-------SG
FABH_CALS8       TCVLFGDGAGAAILSSS-------------------DEQGILGFELGS-DG-------EN
FABH_CHLCV       TCVLFGDGGSACVVGESRPGA----------L-------EITNVNLGA-DG-------SV
FABH_CHLPN       TCVLFGDGGAACVIGESRPGS----------L-------EINRLSLGA-DG-------KL
FABH_CHLTA       TCVLFGDGGSACIVGHSRPGA----------L-------EISKVNLGA-DG-------KQ
FABH_CHLTR       TCVLFGDGGSACIVGHSRPGA----------L-------EISKVNLGA-DG-------KQ
FABH_CHLMU       TCVLFGDGGSACVVGPSRPGS----------L-------KISKVNLGA-DG-------KQ
FABH_DESPS       TSIIFADGAGAAVIGYEE-GD----------R-------GILASKLFS-DG-------SF
FABH_DESVH       TCVLFGDGAGATVVTADVDAT----------QG----TAVLEDSIVTS-DG-------SL
FABH_DESVV       TCVLFGDGAGATVVTADVDAT----------QG----TAVLEDSIVTS-DG-------SL
FABH_DESVM       TCVLFGDGAGASVITAEGEG------------------ALLEDVLCAS-DG-------NL
FABH_DESAG       TCVLFGDGAGAVIVGSHPNEG----------R-----AVEVADSLLSS-DG-------AL
FABH_ROSCS       TCVLFGDGAGAVVLQPSDEP------------------AGLLSCVLGA-DG-------EQ
FABH_ROSS1       TCVLFGDGAGAVVLQPSDEP------------------AGLISCVLGA-DG-------EQ
FABH_RUBXD       TGILFGDGAGAVVLDRGDGS------------------SGFVDHILGA-DG-------RM
FABH1_VIBVU      TIILFGDGAGAVVVGASEE-------------------PGILSTHIYA-DG-------EF
FABH1_VIBVY      TIILFGDGAGAVVVGASEE-------------------PGILSTHIYA-DG-------EF
FABH1_VIBPA      TIILFGDGAGAVVVGASQE-------------------PGIISTHIYA-DG-------QF
FABH1_VIBCH      TIILFGDGAGAVVVGASNE-------------------PGILSTHIHA-DG-------EF
FABH_ALIF1       TIILFGDGAGAVVLGQSEE-------------------PGIISTHLHA-DG-------KF
FABH_PSEA6       MVILFGDAAGATIIEASEE-------------------PGILSTHIHA-AG-------SY
FABH_SHEON       TIILFGDGAGAAIIGASDE-------------------PGIISTHIYA-DG-------RQ
FABH_PSYIN       TIILFGDGAGAVVISATED-------------------EGILSTHINA-DG-------RF
FABH_ACTP2       TVVLFGDGAGAVILEASEE-------------------QGIISTHLHS-SS-------DT
FABH_HAEDU       TVVLFGDGAGAVILQASEQ-------------------AGILSTHLHS-SA-------DT
FABH_HAEI8       TVVLFGDGAGAVILEASEQ-------------------EGIISTHLHA-SA-------DK
FABH_HAEIG       TVVLFGDGAGAVILEASEQ-------------------EGIISTHLHA-SA-------DK
FABH_HAEIN       TVVLFGDGAGAVILEASEQ-------------------EGIISTHLHA-SA-------DK
FABH_ACTSZ       TVILFGDGAGAIVLEASEE-------------------EGIISTHLHA-VA-------DK
FABH_HAES1       TVILFGDGAGAVILESSDI-------------------EGIISTHLHA-SL-------DK
FABH_HISS2       TVILFGDGAGAVILESSDI-------------------EGIISTHLHA-SL-------DK
FABH_PASMU       TIILFGDGAGAVILEASEQ-------------------AGIISTHLHA-TG-------ES
FABH_BAUCH       TLILFGDGAGAVLVGCSEQ-------------------PGILSTHLHA-DG-------SY
FABH_SODGM       TLILFGDGAGAAVLGRSAE-------------------PGIISTHLHA-DG-------HY
FABH_BLOFL       TLILFGDGAGAVILGRSKS-------------------PGIISTHLHA-NG-------YY
FABH_BLOPB       TLILFGDGAGAVVLGRSKT-------------------PGIISIHLHA-DG-------DH
FABH_SALCH       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_SALPB       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_SALTY       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_SALTI       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_SALPA       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_SALAR       TIIIFGDGAGAVVLSASEE-------------------PGIISTHLHA-DG-------RY
FABH_CITK8       TIIIFGDGAGAAVLSASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECO24       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_SHISS       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECO57       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOLI       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOUT       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOK1       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOL5       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOL6       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_SHIBS       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_SHIF8       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_SHIFL       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOHS       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_ECOLC       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_SHIDS       TIIIFGDGAGAAVLAASEE-------------------PGIISTHLHA-DG-------SY
FABH_KLEP7       TIIIFGDGAGAVVLGASEE-------------------PGIISTHLHA-DG-------SY
FABH_ENT38       TIIIFGDGAGAVLLGQSEE-------------------QGIISTHLHA-DG-------SY
FABH_CROS8       TIILFGDGAGAVVLGASEE-------------------PGILSTHLHA-DG-------SY
FABH_YERP3       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERPS       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERPA       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERPE       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERPN       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERPP       TIILFGDGAGAVVLGASEQ-------------------PGIMSTHLHA-DG-------RY
FABH_YERE8       TIILFGDGAGAVVLGASEE-------------------PGILSTHLHA-DG-------KY
FABH_SERP5       TIILFGDGAGAVLLGASEE-------------------PGILSTHLHA-DG-------SY
FABH_PECAS       TLILFGDGAGAVLLTTSEQ-------------------PGILSTHLHA-DG-------RY
FABH_PHOLL       TLVLFGDGAGAMVVGASDE-------------------PGILSTHLHA-NG-------SY
FABH_MARHV       TCVLFGDGAGAVVLEASEE-------------------TGILSTHLHA-DG-------RY
FABH_THISH       TCVLFGDGAGAVVLEASEE-------------------QGILSTHLHA-DG-------RF
FABH_ALKEH       TCVLFGDGAGAVVLDRSEE-------------------PGILSTHLHS-DG-------RY
FABH_XANAC       TCVLFGDGAGAVILKADEE-------------------TGILSTHLHA-DG-------SK
FABH_XANC5       TCVLFGDGAGAVILKADEE-------------------TGILSTHLHA-DG-------SK
FABH_XANOM       TCVLFGDGAGAVILKADEE-------------------TGILSTHLRA-DG-------SK
FABH_XANC8       TCVLFGDGAGAVVLKADED-------------------TGILSTHLHA-DG-------SK
FABH_XANCP       TCVLFGDGAGAVVLKADED-------------------TGILSTHLHA-DG-------SK
FABH_XYLFA       TCVLFGDGAGAVVLKADED-------------------TGILSTHLHA-DG-------SK
FABH_XYLFT       TCVLFGDGAGAVVLKADED-------------------TGILSTHLHA-DG-------SK
FABH_METCA       TCILFGDGAGAVVLESATE-------------------PGIMSTHIHS-DG-------HY
FABH_THIDA       NCILWGDGAGAVVVGASSE-------------------PGIIATHIHA-DG-------RH
FABH_ACIET       TCVLFGDGAGAVVLEASEA-------------------PGILASDLHA-DG-------SH
FABH_ACISJ       TCVLFGDGAGAVVLEASEA-------------------PGILASDLHA-DG-------SH
FABH_DELAS       TCVLFGDGAGAVVLEASEQ-------------------PGILASDLHA-DG-------KH
FABH_ACIAC       TCVLFGDGAGAVVLEASET-------------------PGILASDLHA-DG-------RH
FABH_VEREI       TCVLFGDGAGAVVLQASAT-------------------PGILCSDLKA-DG-------KH
FABH_POLNA       TCVLFGDGAGAVVLEASET-------------------PGILASDLHA-DG-------KH
FABH_POLSJ       TCVLFGDGAGAVVLEASET-------------------PGILASDLHA-DG-------KH
FABH_VARPS       TCVLFGDGAGAVVLEASEE-------------------PGILASDLHA-DG-------KH
FABH_RHOFT       TCVLFGDGAGAVVLEASDT-------------------PGILASDLHA-DG-------KH
FABH_BURCC       TCVLFGDGAGAVILSASEE-------------------PGVLGSALHA-DG-------SY
FABH_BURCH       TCVLFGDGAGAVILSASEE-------------------PGVLGSALHA-DG-------SY
FABH_BURCA       TCVLFGDGAGAVILSASEE-------------------PGVLGSALHA-DG-------SY
FABH_BURL3       TCVLFGDGAGAVILSASEE-------------------PGVLGSALHA-DG-------SY
FABH_BURVG       TCVLFGDGAGAVILSASEE-------------------PGVLGSALHA-DG-------SY
FABH_BURM7       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURM9       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURMA       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURMS       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURP1       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURPS       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURP6       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURP0       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_BURTA       TCVLFGDGAGAVVLSASEE-------------------PGILGSALHA-DG-------SY
FABH_PARP8       TCVLFGDGAGAVVLQASDE-------------------PGVLASALHA-DG-------SH
FABH_CUPNH       TCVLFGDGAGAVLLSASEE-------------------PGILSTAMHS-DG-------RH
FABH_CUPTR       TCVLFGDGAGAVVLSASDE-------------------PGILSSAMHS-DG-------SH
FABH_CUPPJ       TCVLFGDGAGAVVLSASDE-------------------PGILSTAMHS-DG-------SH
FABH_RALPJ       TCVLFGDGAGAVVLQASDE-------------------PGILSTALHA-DG-------SH
FABH_RALSO       TCVLFGDGAGAVVLQASDE-------------------PGILSTALHA-DG-------SH
FABH_HERAR       TCVLFGDGSGAVVMTASEE-------------------PGVLATKLHA-DG-------SY
FABH_JANMA       TCVLFGDGAGAVLMTASQE-------------------PGVLATKLHA-NG-------NY
FABH_POLNS       TCVLFGDGAGAVVLEASKE-------------------AGILSTVMHA-DG-------SQ
FABH_POLAQ       TCVLFGDGAGAVVLEASSE-------------------PGILSTALHA-DG-------SQ
FABH_AROAE       TCVLFGDGAGAVVLEAAEA-------------------PGILASALHA-DG-------SH
FABH_AZOSB       TCVLFGDGAGAVVLEASER-------------------PGVLTTALHA-DG-------SH
FABH_BORBR       TCVLFGDGAGAVVLKAADE-------------------PGILAAHLHA-DG-------SQ
FABH_BORPA       TCVLFGDGAGAVVLKAADE-------------------PGILAAHLHA-DG-------SQ
FABH_BORPE       TCVLFGDGAGAVVLKAADE-------------------PGILAAHLHA-DG-------SQ
FABH_BORPD       TCVLFGDGAGAVVLKAGSK-------------------PGILAAQLHA-DG-------SQ
FABH_BORA1       TCVLFGDGAGAVVIKAADE-------------------PGILAAQLHA-DG-------SQ
FABH_CHRVO       TCVLFGDGAGAVVLGESDE-------------------PGILHAKLAA-DG-------RY
FABH_LARHH       TCILFGDGAGAVVLGADED-------------------TGILSTELRA-DG-------RY
FABH_NEIG1       TCVLFGDGAGAVVLSASDK-------------------PGIIHSKLKA-DG-------NY
FABH_NEIG2       TCVLFGDGAGAVVLSASDK-------------------PGIIHSKLKA-DG-------NY
FABH_NEIM0       TCVLFGDGAGAVVLSAADK-------------------PGIIHSKLKA-DG-------NY
FABH_NEIMF       TCVLFGDGAGAVVLSAADK-------------------PGIIHSKLKA-DG-------NY
FABH_NEIMB       TCVLFGDGAGAVVLSASDT-------------------PGIIHSKLKA-DG-------NY
FABH_NEIMA       TCVLFGDGAGAVVLSASDT-------------------PGIIHSKLKA-DG-------NY
FABH_NITEC       TCVLFGDGAGAVVLTRDQK-------------------PGILSSHLHA-DG-------SY
FABH_NITEU       TCVLFGDGAGAVILTRDQK-------------------PGILSSHLHA-DG-------SY
FABH_NITMU       TCVLFGDGAGAVLLTGDER-------------------PGVLSTHLHA-DG-------SQ
FABH_VESOH       TAVLFGDGAGAVVLSGSDN-------------------TGILYSKLFS-DG-------NY
FABH_DICNV       TAVLFGDGAGAVVLSASEE-------------------AGILGTILHA-DG-------SH
FABH_COXB2       TCILFGDGAGAVILQAHKE-------------------PGILNTILHA-NG-------DY
FABH_COXBU       TCILFGDGAGAVILQAHKE-------------------PGILNTILHA-NG-------DY
FABH_COXBR       TCILFGDGAGAVILQAHKE-------------------PGILNTILHA-NG-------DY
FABH_COXBN       TCILFGDGAGAVILQAHKE-------------------PGILNTILHA-NG-------DY
FABH_COXB1       TCILFGDGAGAVILQAHKE-------------------PGILNTILHA-NG-------DY
FABH_ACICJ       TCVLFGDGAGAVLLRAGTG------------EDD----RGVISTHIHS-DG-------RY
FABH_GRABC       TNVLFGDGAGAAFLRASTD------------NDDPA--RGILSTHLHS-EG-------EF
FABH_AGRFC       TCVLFGDGAGALVIEAGEG------------EGTSS-DRGILTSQLRS-DG-------SH
FABH_RHIL3       TCVLFGDGAGAIILEATEG------------EGTVA-DRGVLTAHLRS-DG-------SH
FABH_RHIME       TCVLFGDGAGAIVLEAQEA------------AGTKA-DRGVLTAQLRS-DG-------AH
FABH_SINMW       TCVLFGDGAGAIVLEAQEG------------AGTKA-DRGVLTAQLRS-DG-------AH
FABH_AGRRK       TCVLFGDGAGALILEAGEG------------TGANT-DRGVLTASLRS-DG-------AH
FABH_AGRVS       TCVLFGDGAGALVLEAVEG------------QGTIA-DRGVLTAHLRS-DG-------SH
FABH_BRUA1       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUA2       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUAB       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUME       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUC2       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUSU       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUMB       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUO2       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILAANLRS-DG-------NH
FABH_BRUSI       TCVLFGDGAGAIVLEAAEG------------HGLTS-DRGILATNLRS-DG-------NH
FABH_OCHA4       TCVLFGDGAGALVLEAAEG------------NGLTS-DRGVLAANLRS-DG-------NH
FABH_RHILO       TCVLFGDGAGALILEAGEG------------AGTIA-DRGVLAASLRS-DG-------VH
FABH_CHESB       TCVLFGDGAGAIVLEAEEG------------QGDIS-DRGILAEALRS-DG-------SH
FABH_BARHE       TCVLFGDGAGAAVLEAQEI------------ERGVASDHGILSTKLRS-NG-------AY
FABH_BARQU       TCVLFGDGAGAVVLEAQEI------------QSDVALECGILSAKLYS-NG-------AY
FABH_BART1       TCVLFGDGAGAAVLEAEEI------------EGGIAFQRGILSAKLRS-DG-------AY
FABH_BARBK       TCVLFGDGAGAAILEAREV------------EGNVAIDRGILSTKLRS-NG-------AH
FABH_BRASB       TCVLFGDGAGALVLDAQRQ------------DG-TSADRGVLTTHLRS-DG-------RH
FABH_BRASO       TCVLFGDGAGALVLDAQQQ------------GG-TAADRGVLSTHLRS-DG-------RH
FABH_BRADU       TCVLFGDGAGAVVLEAQEQ------------PGSAATDRGVVTTHLRS-DG-------RH
FABH_ERYLH       TCVLFGDGAGAVVLEAA---------------EGDTEAPGILASRLHA-DG-------AQ
FABH_NOVAD       TCVLFGDGAGAVVLEAVDV------------DETDPKAPGILATRLHA-DG-------AH
FABH_SPHAL       TCVLFGDGAGAVVLSAE----------------DVADDRGVLATRLHA-EG-------RY
FABH_SPHWW       TCVLFGDGAGAVVLKAE----------------EGGD-RGVLATRLHA-DG-------RH
FABH_RHOCS       TCVLFGDGAGAVVLRAEE-------------GEG-TADRGILSTHLHS-DG-------RH
FABH_RHORT       TCVLFGDGAGAVVLRATP-------------STGDGGERGILSTHLHA-DG-------RH
FABH_MAGSA       TCVLFGDGAGAVVLRASR-------------GKGSSADRGILSTHLHS-DG-------SH
FABH_CAUVC       TCVLFGDGAGAIVLEPGE-------------GEGTTDDRGMLGFALRA-DG-------TK
FABH_HYPNA       TCVLFGDGGGAIVLECVE-------------WDGA-DDAGVITHHVRT-DG-------TK
FABH_RHOS1       TCVLFGDGAGAVVLEGTES------------AGTSA-DRGILATDLHS-DG-------RF
FABH_RHOS4       TCVLFGDGAGAVVLEGTES------------AGTSA-DRGILATDLHS-DG-------RF
FABH_RHOS5       TCVLFGDGAGALVLEGAEG------------AGTSA-DRGILATDLHS-DG-------RF
FABH_RUEPO       TCVLFGDGAGALVLEYEEG------------EGTPQ-DRGILSVDLNS-DG-------RY
FABH_RUEST       TCVLFGDGAGALLLEAQEG------------EGTSK-DRGILATDLNS-DG-------RY
FABH_ROSDO       TCVLFGDGAGAVLLEAQDG------------TGTSA-DRGILSTDLNS-DG-------RH
FABH_DINSH       TCVLFGDGAGAVVLEARDG------------TGGTA-DRGILSADLNS-DG-------RH
FABH_JANSC       TCVLFGDGAGALILEGRDS------------AGTPQ-DRGILSTDLHS-DG-------TH
FABH_PARDP       TCVLFGDGAGAVVLEAAEG------------QGSSA-DRGILATDLNS-DG-------QY
FABH_RHOCA       TCVLFGDGAGAVILEAAEG------------AGTAA-DRGILASDLHS-DG-------RY
FABH_EHRCJ       TCVLFGDGAGAIVLSSS-----------------TEDDSGIISTNLHS-DG-------TF
FABH_EHRCR       TCVLFGDGAGAVVLGNN-----------------SEKDSGIISTILHS-DG-------AF
FABH_EHRRG       TCVLFGDGAGAVVLSNN-----------------SARNTGVISTILYS-DG-------TL
FABH_EHRRW       TCVLFGDGAGAVVLSNN-----------------SARNTGVISTILYS-DG-------TL
FABH_WOLPM       TCVLFGDGAGAVVMKS------------------EMGRSGIISTNLYS-DG-------N-
FABH_WOLPP       TCVLFGDSAGAVIIKS------------------EMGSSGIISTNLHS-DG-------N-
FABH_WOLTR       TCVLFGDGAGAVIMKSTAHCN----------EMTENSTRGIISTNLYS-DG-------N-
FABH_ANAMM       TCVLFGDGAGAFVFKGQ--------------DETEKPGAGVMSTLLCA-DG-------SL
FABH_RICRO       TCVLFGDGAGSVILQRS------------------SDDSGLIDSNIFSSGA-------DY
FABH_RICRS       TCVLFGDGAGSVILQRS------------------SDDSGLIDSNIFSSGA-------DY
FABH_RICCN       TCVLFGDGAGSVILQRS------------------SDDSGLIDSNIFSSGA-------DY
FABH_RICM5       TCVLFGDGAGSVILQRS------------------RDDSGLIDSNIFSSGA-------DY
FABH_RICFE       TCVLFGDGAGSVILQRS------------------SDDSGLIDSNIFSSGA-------DY
FABH_RICAH       TCVLFGDGAGSVILQRS------------------SDDSGLIDSNIFSSGA-------DY
FABH_RICCK       TCVLFGDGAGSVILQRS------------------SDDSGLIESNIFSSGI-------DY
FABH_RICPR       TCVLFGDGAGSVILQRS------------------NDDSGLIDSNIFSSGT-------DY
FABH_RICTY       TCVLFGDGAGSVILQRS------------------NDESGLIDSNIFSSGT-------DY
FABH_RICB8       TCVLFGDGAGSVILQRS------------------DDNSGIIDSNIFSSGA-------DY
FABH_RICBR       TCVLFGDGAGSVILQRS------------------DDNSGIIDSNIFSSGA-------DY
FABH_NEOSM       TCVLFGDGAGAVLVSAGDS-------------------GGVLYEHMAC-DS-------SL
FABH_AQUAE       TCVLFGDGAGAVVVTRSEDKS----------D--------ILATRMYA-EG-------SL
FABH_PERMH       TAVIFGDGAGAVVVSKSDGES----------D--------ILSAVMKS-DG-------SH
FABH_SULDN       TCILFGDGAGAAIISATDDKS----------EA-------IIDIHTGA-DG-------EF
FABH_SULNB       TCILFGDGAGAAIISATDKKE----------EG-------FIDVHASA-DG-------SY
FABH_ARCB4       TCFLFGDGAGAAIISATNDKS----------ES-------IIDINCSS-DG-------NY
FABH_HELP2       TCILFGDGAGACVIGRTKRLK----------ES-------ILDVQISA-NG-------NF
FABH_HELPG       TCILFGDGAGACVIGRTKRLK----------ES-------ILDVQISA-NG-------NF
FABH_HELPY       TCILFGDGAGACVIGRTKRLK----------ES-------ILDVQISA-NG-------NF
FABH_HELPS       TCILFGDGAGACVIGRTKRLK----------ES-------VLDVQISA-NG-------NF
FABH_HELPJ       TCILFGDGAGACVIGRTKRLK----------ES-------VLDVQISA-NG-------NF
FABH_HELPH       TCILFGDGAGACVIGRTKRLK----------ES-------ILDVQISA-NG-------NF
FABH_HELAH       TCILFGDGAGACVIGRTKHLK----------ES-------ILDVQISA-NG-------NF
FABH_HELHP       TCVLFGDGAGACVIGSTNDEK----------AA-------ILGVNVSA-NG-------RY
FABH_CAMC1       TCILFGDGAGAAVISASEENE-------------------IIDIHTAS-DG-------RQ
FABH_CAMC5       TCILFGDGAGAAIISASNENE-------------------IIDIHTAS-DG-------TQ
FABH_CAMFF       TCVLFGDGAGAAIVSSSDDNY-------------------IIDVHTSS-DG-------SK
FABH_CAMHC       TCVLFGDGAGAAVLSCMDNKN----------NGISK-PYGIIDIHTAS-DG-------NK
FABH_CAMJE       ICILFGDGAGAGVVSLDNENH-------------------ILDVHTAS-NG-------NY
FABH_CAMJJ       ICILFGDGAGAGVVSLDNENH-------------------ILDVHTAS-NG-------NY
FABH_CAMJ8       ICILFGDGAGAGVVSLDNENH-------------------ILDVHTAS-NG-------NY
FABH_CAMJR       ICILFGDGAGAGVVSLDNENH-------------------ILDVHTAS-NG-------NY
FABH_CAMJD       ICILFGDGAGAGVVSLDNENY-------------------ILDVHTAS-NG-------NY
FABH2_BACTN      TCPIFGDGAAAFMMEPTT------------------EDLGVMDSILRTDG--------KG
FABH_BACV8       TCPIFGDGAAACMVEATT------------------EDYGIMDSILRTDG--------KG
FABH1_BACTN      TCPIFGDGAAAFMLEPTT------------------EEVGIMDSVLRTDG--------KG
FABH_PARD8       TCPLFGDACGAVLLEPTT------------------EEFGVLDTILRTDG--------VG
FABH_PORG3       TCPLFGDGAGCVLLEATE------------------EEVGVMDAVLHSNG--------IG
FABH_PORGI       TCPLFGDGAGCVLLEATE------------------EEVGVMDAVLHSNG--------IG
FABH_AZOPC       TSPIFGDGCGCALVEATM------------------EDIGLVDSIMRCDG--------SI
FABH_PELLD       TAILFGDGAGGVILEAAE-----------------SEGFGVLDARMYSDGT-------NG
FABH_CHLPM       TAILFGDGGGGVILEPAT-----------------TEGCGVLDNRMYCDGT-------SG
FABH_CHLCH       TAILFGDGAGGVLVEPAA-----------------DDSCGVLDVRLYSDGT-------NG
FABH_CHLPD       TAILFGDGAAGVILEPST-----------------NDNYGILDARLYSDGA-------SG
FABH_CHLTE       TAILFGDGAGGVILEAAN-----------------EEGYGVLDARLYSDGL-------NG
FABH_KORVE       TCIIFGDGAGAVLLEPTEDG---------------ED-VGVMDHIHQVEGV-------GG
FABH_SOLUE       TCVLFGDGAGAMLIEATDEA---------------DDGTGFIDFLGEIDGS-------GG
FABH2_VIBVU      TAVLFGDGAGAVVLSRTE------------------EAVGLQNAKSGCDAQ-------GR
FABH2_VIBVY      TAVLFGDGAGAVVLSRTE------------------EAVGLQNAKIGCDAQ-------GR
FABH2_VIBPA      TAVLFGDGAGAVILSRTE------------------KETGLLQSQIGCDAK-------GR
FABH2_VIBCH      TAVLFGDGAGAVVLSKTE------------------QKVGLQDAQIGCDAQ-------GR
FABH_PSET1       SAVLFGDGAGAVVLEAAD------------------TPAGLLATKTGCDST-------DR
FABH_TRIV2       TCVLFGDGAGAIVLQSNQS-------------------DRLLGFALKS-DG-------TQ
FABH_NOSS1       TCVLFGDGAGAVVLQANSS-------------------DRLLGFALKS-DG-------TQ
FABH_TRIEI       TCVLFGDGAGAVLLQASES-------------------DRLLGFELGS-DG-------SQ
FABH_ACAM1       SCVLFGDGAGAVVLQANDT-------------------DRLLGFALHS-DG-------CL
FABH_SYNE7       TCVLFGDGAGAVVLQASEI-------------------DQLLGFEMRS-DG-------SL
FABH_SYNP6       TCVLFGDGAGAVVLQASEI-------------------DQLLGFEMRS-DG-------SL
FABH_MICAN       TCVLFGDGAGAVVCQANDTK------------------DNILGFELHS-DG-------SQ
FABH_SYNY3       TCVLFGDGAGAVVLQRQAQ-------------------DNLLAFEMYT-DG-------TG
FABH_THEEB       TCILFGDGAGAMVLQASDV-------------------DQLLSFELRS-DG-------RL
FABH_GLOVI       TCVLFGDGAGAALLEAGEV-------------------EGILGFELRT-DG-------AR
FABH_PROM0       SCILFGDGAGALAIEATNQF------------------DNLIGFDMRT-DG-------ER
FABH_PROM9       SCILFGDGAGALAIEATNEF------------------DNFLGFDMRT-DG-------ER
FABH_PROM2       SCILFGDGAGALAIEATNEF------------------DNFIGFDMRT-DG-------ER
FABH_PROM5       SCILFGDGAGALAIEATNEF------------------DNLIGFSMRT-DG-------QR
FABH_PROMP       SCILFGDGAGAIAIEGTNEL------------------DNLLGFSMRT-DG-------QR
FABH_PROMA       SCVLFGDGAGAIAIEATAEE------------------DDLIGFKMKS-DG-------SR
FABH_PROMT       TCVLFGDGAGAVALESSGDE------------------SGLIGYDLKS-DG-------SK
FABH_PROMM       SCVLFGDGAGAVALEATSAAQ-----------------NGLLGFQLKS-DG-------SR
FABH_SYNR3       SCVLFGDGAGAVAIEACPAEN-----------------DGLLGFRLNS-DG-------AR
FABH_SYNPW       SCVLFGDGAGAVVLEASDE-------------------DGLLGFLLHS-DG-------AR
FABH_PORPU       SCILFGDGAGAVLIGESS--I-----------------NSILGFKLCT-DG-------RL
FABH_PORUM       SCILFGDGAGAVLIGESS--I-----------------NSILGFKLCT-DG-------RL
FABH_PYRYE       PVFYLVMVLEQLVLGQSL--K-----------------NSILGFKLCT-DG-------QL
FABH_GRATL       TCILFGDGAGAAIIQACYEED-----------------NAILGFQLNT-DG-------KQ
FABH_RHOBA       TYPLFGDAAGAALLVPSTQDECQSTECNGSAADSTIQTDGLLAYQLGS-EG-------CG
FABH1_STRCO      TAFLFGDGAGAVVVGPSQ-------------------EPAIGPTVWGS-EG-------DK
FABH_STRGA       TAFLFGDGAGAVVVGPSN-------------------EPAIGPTIWGS-EG-------DK
FABH_KOCRD       ISFLLGDGAGAVVIGPSE-------------------VPGIGPSVWGS-DG-------SK
FABH_MYCA1       NCFIFADGAAGVVVGETP-------------------TQGIGPTVWGS-DG-------TQ
FABH_MYCPA       NCFIFADGAAGVVVGETP-------------------TQGIGPTVWGS-DG-------TQ
FABH_MYCMM       NCFIFADGAASVLVGHSP-------------------IQGIGPTVWGS-DG-------EQ
FABH_MYCUA       NCFIFVDGAASVLVGHSP-------------------IQGIGPTVWGS-DG-------EQ
FABH_MYCTA       NCFIFADGAAAVVVGETP-------------------FQGIGPTVAGS-DG-------EQ
FABH_MYCTU       NCFIFADGAAAVVVGETP-------------------FQGIGPTVAGS-DG-------EQ
FABH_MYCBO       NCFIFADGAAAVVVGETP-------------------FQGIGPTVAGS-DG-------EQ
FABH_MYCBP       NCFIFADGAAAVVVGETP-------------------FQGIGPTVAGS-DG-------EQ
FABH_MYCBT       NCFIFADGAAAVVVGETP-------------------FQGIGPTVAGS-DG-------EQ
FABH_MYCA9       NCFIFGDGAGAVVVGETA-------------------EQGIGPTVWGS-DG-------SQ
FABH_STRLI       LSFLFGDGAGAAVVGPSD-------------------VPGIGPVVRGI-DG-------TG
FABH2_STRAW      TCVLVGDGAGAAVVDACPEGA----------------EPGIGPVLWGS-VP-------EM
FABH4_STRCO      TCVLVGDGAGAAVVEACAPGE----------------EPGIGPVLWGS-VP-------EM
FABH2_STRCO      TAVVFGDGAGAVLLERGDTGD----------------PGAVLHTELGS-DG-------TG
FABH5_STRCO      TSVIFGDGAGAVVLRSGSVDE----------------RGAFLGFDLGS-DG-------AL
FABH3_STRCO      TSVIFGDGAGAVVLRAGEPGE----------------TGALGPLRLGS-DG-------TG
FABH_PSEA8       TRALFGDGAGAVVLRAGDAEE----------------EGALLAFDLGS-DG-------HQ
FABH_PSEAB       TRALFGDGAGAVVLRAGDAEE----------------EGALLAFDLGS-DG-------HQ
FABH_PSEAE       TRALFGDGAGAVVLRAGDAEE----------------EGALLAFDLGS-DG-------HQ
FABH_LACBA       TAVLFGDGAGGVVLTSALAQD-----------------GAFIAADYRT-MG-------EQ
FABH_LACH4       TAVLFGDGAGGVLIRNTAVDK-----------------GSFISEDLRT-LG-------NL
FABH2_LACPL      TAVLFGDGAGGLLITAKPNTTT----------------GHWLGGHYAT-FG-------AD
FABH_OENOB       TAVLFGDGAAGVLVEAVDGPE------------------RLLAADLKT-FG-------KE
FABH_LACDA       TAVLFGDGAGGVLV-KNDALE-----------------PHFLASQLKS-YG-------HL
FABH_LACDB       TAVLFGDGAGGVLV-KNDALE-----------------PHFLASQLKS-YG-------HL
FABH_LACRD       TAVLFGDGAGGVLLQKTTTAT-----------------PLILGRDLHT-FG-------DL
FABH_LACRJ       TAVLFGDGAGGVLLQKTTTAT-----------------PLILGRDLHT-FG-------DL
FABH_LACSS       TAVLFGDGAAGVLLQGTTSDQ-----------------ESWVSEKLIT-IG-------TE
FABH_LACLM       TAVLFGDGAAGVLLDNSGSQP------------------LIIAEKMQT-DG-------KR
FABH_LACLS       TAVLFGDGAAGVLLDNSGSQP------------------LIIAEKMQT-DG-------KR
FABH_LACLA       TAVLFGDGAAGVLIEAGASQP------------------LIIAEKMQT-DG-------SR
FABH_STRA1       TAVLFGDGAGGVLLEAS-KEK------------------HFLAESLNT-DG-------SR
FABH_STRA3       TAVLFGDGAGGVLLEAS-KEK------------------HFLAESLNT-DG-------SR
FABH_STRA5       TAVLFGDGAGGVLLEAS-KEK------------------HFLAESLNT-DG-------SR
FABH_STRE4       TAVLFGDGAGGVLLEAS-EQQ------------------HFLAEALHT-DG-------AQ
FABH_STRS7       TAVLFGDGAGGVLLEAS-EQQ------------------HFLAEALHT-DG-------AR
FABH_STREM       TAVLFGDGAGGVLLEAS-EQQ------------------HFLAEALHT-DG-------AR
FABH_STRP1       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPG       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRP3       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPM       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRP8       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPQ       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPB       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPC       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPD       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRP6       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRPZ       TAVLFGDGAGGVLLEAS-KDK------------------HVLAEPLHT-DG-------AR
FABH_STRPF       TAVLFGDGAGGVLLEAS-KDK------------------HVLAETLHT-DG-------AR
FABH_STRU0       TAVLFGDGAGGVLVEAC-SEQ------------------HFMAESLHT-DG-------SR
FABH_STRGC       TAVLFGDGAGGVLLEST-SDQ------------------HFLAEIQKT-DG-------SR
FABH_STRSV       TAVLFGDGAGGVLLESA-SEQ------------------HFLAESQFT-DG-------SR
FABH_STRP7       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRPS       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRP2       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRPI       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRR6       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRPJ       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRPN       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRZJ       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRZT       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRP4       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRZP       TAVLFGDGAGGVLLEAS-EQE------------------HFLAESLNS-DG-------SR
FABH_STRMU       TAVLFGDGAGGVLLEAD-SSE------------------HFLFESIHS-DG-------SR
FABH_STRT1       TAVLFGDGAGGVLLEES-EEE------------------HFFGESLNT-DG-------SK
FABH_STRTD       TAVLFGDGAGGVLLEES-EEE------------------HFFGESLNT-DG-------SK
FABH_STRT2       TAVLFGDGAGGVLLEES-EEE------------------HFFGESLNT-DG-------SK
FABH_STRS2       TAVLFGDGAGGVLLEAC-EQP------------------TFLAEILRT-DG-------GR
FABH_STRSY       TAVLFGDGAGGVLLEAC-EQP------------------TFLAEILRT-DG-------GR
FABH_ENTFA       TAVLFGDGAAGVLIEAA-ETP------------------HFLNEKLQA-DG-------QR
FABH1_LACPL      AAVFFGDGAGGALLQATDNPDE----------------NSLIAEKLES-QG-------NA
                                                                             

FABH1_BACAN      GKHLYQDE------------------------------------YVMMNGREVFKFAVRQ
FABH1_BACCR      GKHLYQDE------------------------------------YVMMNGREVFKFAVRQ
FABH1_BACSU      GQHLYLNEKR----------------------------------HTIMNGREVFKFAVRQ
FABH_BACP2       GKHLYLDEKD----------------------------------HTIMNGREVFKFAVRQ
FABH_GEOKA       GKHLYKDE------------------------------------YIVMNGREVFKFAVRQ
FABH1_BACHD      AMHINQKGE-----------------------------------YIQMNGREVFKFAVRQ
FABH_OCEIH       AKELYLNHDD----------------------------------HIIMNGREVYKFAVRQ
FABH_LISIN       GKYLNLDENK----------------------------------KIYMNGREVFRFAVRQ
FABH_LISW6       GKYLNLDENK----------------------------------KIYMNGREVFRFAVRQ
FABH_LISMF       GKYLNLDENK----------------------------------KIYMNGREVFRFAVRQ
FABH_LISMO       GKYLNLDENK----------------------------------KIYMNGREVFRFAVRQ
FABH1_STAES      GKYLYLDRETG---------------------------------KLKMNGREVFKFAVRI
FABH_STAEQ       GKYLYLDRETG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAM       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAN       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAR       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAA9       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAB       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAA1       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAA2       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAA3       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAE       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAA8       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAC       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAW       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAS       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAAT       GKHLYLDKDTG---------------------------------KLKMNGREVFKFAVRI
FABH_STAHJ       GKYLYLNKDTG---------------------------------KLVMNGREVFKFAVRI
FABH_STAS1       AKHLYLNPENG---------------------------------KIFMNGREVFKFAVRI
FABH_DEIDV       GSSLYMRSVAKQLPGGFAMG-----------------------DFTGMNGREVFKFAVRV
FABH_DEIGD       GPSLYARCMADRLPGGILMG-----------------------ERVGMNGREVFKFAVRV
FABH1_DEIRA      GPALYISNLADQFPDGQIMR-----------------------GVPTMNGREVFKFAVRV
FABH2_DEIRA      GPHLYLRGAALRLPEGTEMG-----------------------PHLTQNGREVFKFAVRT
FABH2_BACAN      GIHLYRTNLSTTMNDTPLQTN----------------------EKIVQNGREVYKWATRT
FABH2_BACCR      GIHLYRTNLSTTMNGTPLQTN----------------------EKIVQNGREVYKWATRT
FABH2_BACSU      GDILYRAGLRNEINGVQLVGS----------------------GKMVQNGREVYKWAART
FABH2_BACHD      ANKLYCTGLAEQMNGEELVNT----------------------GNLVQSGREVYKWAVNT
FABH2_STAES      GHNLYCTELSEEMFSDDLENH----------------------GYIVQNGRGVYKWAVGN
FABH_ACHLI       TGILWIDP-K-----------------------------------VKMAGREVYKFAVDI
FABH_FUSNN       NMILKVPA-GGSKKPNNEETIK------------------NRENFVIMKGQDVFKFAVST
FABH_CLOAB       KDFLHCPA-TNVINPFSDEKG-------------------LASSKISMNGREVFKFAVKV
FABH_CLONN       GKFLKCDA-LPVENPYVSEKT-------------------EFLNKLSMEGREVFKFAVNA
FABH_CLOB1       GEHLTCGV-LKANNTPNKNDSL------------------EKNNFIKMNGKEIFRFAVGA
FABH_CLOBH       GEHLTCGV-LKANNTPNKNDSL------------------EKNNFIKMNGKEIFRFAVGA
FABH_CLOBJ       GEHLTCGV-LKANNTPNKNDRL------------------EKNNFIKMNGKEIFRFAVGA
FABH_CLOBL       GEHLTCGV-LKANNTPNKNDRL------------------EKNNFIKMNGKEIFRFAVGA
FABH_CLOBM       GEHLTCGV-LKANNTSNKNDRL------------------EKNNFIKMNGKEIFRFAVGA
FABH_CLOB6       GEHLTCGV-LKANNISNKNDRL------------------ENDNFIKMNGKEIFRFAVGA
FABH_CLOBK       GEHLTCGA-LEANNIFNKDDML------------------KNNKFIKMNGKEIFRFAVGA
FABH_CLOK1       GDALTCPA-VPVNNPCTTSD--------------------FQKSVVTMDGKAIFKFAVKI
FABH_CLOK5       GDALTCPA-VPVNNPCTTSD--------------------FQKSVVTMDGKAIFKFAVKI
FABH_CLOTE       SSSLTVNS-DELKELLNSKEED------------------LENKFIEMDGKEIFKFAVKV
FABH_CLOB8       GEALTIGA-TDFDTPFSKEKK-------------------LAKRTIDMNGREILRFAVSA
FABH_CLOP1       GDSLVIQG-LPLNSPFKDGRE-------------------VSENYINMNGREIFKFATKV
FABH_CLOPE       GDSLVIQG-LPLNSPFKDGRE-------------------VSENYINMNGREIFKFATKV
FABH_CLOPS       GDSLVIQG-LPLNSPFKDGRE-------------------VSKNYINMNGREIFKFATKV
FABH_CLOD6       KDCLKVPA-GGSRLKASKETVE------------------ANLHTIEMAGSDVFKFAVRK
FABH_CALS4       GKYLYMPA-GGSRMPASHETVE------------------KNLHTIFMEGQEVFKFAVKV
FABH_DESHD       GSLLTMPG-GGSMHPASAETVA------------------KKMHTIQMAGSEVFKFAVRI
FABH_DESHY       GSLLTMPG-GGSMHPASAETVA------------------KKMHTIQMAGSEVFKFAVRI
FABH_SYMTH       HCHLYTPA-GGSRLPASPETVA------------------QGLHYVHMNGPEVFKFAVRV
FABH_NATTJ       GELLQQPA-GGSLKPATLETVS------------------SKEHFIKMNGNEVFKFAVKV
FABH_SYNWW       GKHLYMPA-GGSALPPSKETVE------------------QRLHFIRMDGNEIFRFATKI
FABH_CALS8       GLLLYCHAFGLSDVTYSQVKEN------------------PNFRKIYMEGNEVYKFAVKI
FABH_CHLCV       ADLLSLPAGGSRLPASPETVA-------------------EGKHFIYMEGKEVFKHAVRR
FABH_CHLPN       GELLSLPAGGSRCPASKETLQ-------------------SGKHFIAMEGKEVFKHAVRR
FABH_CHLTA       GDLLRLPAGGSRCPASQDTVQ-------------------NHQHFITMEGKEVFKHAVRR
FABH_CHLTR       GDLLRLPAGGSRCPASQDTVQ-------------------NHQHFITMEGKEVFKHAVRR
FABH_CHLMU       GDLLRLPAGGSRCPASQDTIQ-------------------NQQHFITMEGKEVFKHAVRR
FABH_DESPS       GDILFLSGSESTNTDLRLGEY-------------------EGSH-IHMEGREVFKHAVRA
FABH_DESVH       GDLLTI-GGGTANPYAIGDSV-------------------GEEYFVRMQGRDVFKHAVRS
FABH_DESVV       GDLLTI-GGGTANPYAIGDSV-------------------GEEYFVRMQGRDVFKHAVRS
FABH_DESVM       GGLLTI-GGGTHTPYAKGDPV-------------------GEDFFVQMNGRDVFKHAVRN
FABH_DESAG       GDLLLISGGGTSVPYKHGQPV-------------------GDEFFVRMEGREIFKHAVRS
FABH_ROSCS       EDLMAVDAGGTRLPATPELLE-------------------EGRQYVFMNGREIFKHAVRE
FABH_ROSS1       EDLMAVDAGGTRLPATPELLE-------------------QGRQYVYMNGREIFKHAVRE
FABH_RUBXD       APLGRAGHPG------------------------------DGKRPLYQNGREIFRFAVRM
FABH1_VIBVU      GDLLSLEVPER---GK------------------------DADKWLHMAGNEVFKVAVTQ
FABH1_VIBVY      GDLLSLEVPER---GK------------------------DADKWLHMAGNEVFKVAVTQ
FABH1_VIBPA      GDLLSLPVPER---GK------------------------DVDKWLHMAGNEVFKVAVTQ
FABH1_VIBCH      GDLLSLEVPVR---GG------------------------DSDKWLHMAGNEVFKVAVTQ
FABH_ALIF1       GELLSLPVPSRK--NE------------------------EADKWLYMAGNEVFKVAVTQ
FABH_PSEA6       GDLLAIGNPTRGDESS------------------------IHENWGSMKGNEVFRVAVTK
FABH_SHEON       GDLLKCAFPPRQGETS------------------------EAVGFMTMKGNDVFKVAVTQ
FABH_PSYIN       GELLKLPNPQRGNAQT------------------------VHEAYLSMSGNDVFKVAVKK
FABH_ACTP2       EYMLALPAQKRGD-E--------------------------KSGFIQMQGNATFKLAVGQ
FABH_HAEDU       DNMLALPIQERGN-A--------------------------QSGFIQMQGNATFKLAVSR
FABH_HAEI8       NNALVLAQPERGI-E--------------------------KSGYIEMQGNETFKLAVRE
FABH_HAEIG       NNALVLAQPERGI-E--------------------------KSGYIEMQGNETFKLAVRE
FABH_HAEIN       NNALVLAQPERGI-E--------------------------KSGYIEMQGNETFKLAVRE
FABH_ACTSZ       NDVLVLPHAQRND-E--------------------------KSGYIMMQGNETFKLAVRE
FABH_HAES1       SNALILPQTQHGE-A--------------------------QSGYIQMQGNATFKLAVRE
FABH_HISS2       SNALILPQTQQGE-V--------------------------QSGYIQMQGNATFKLAVRE
FABH_PASMU       AEVLTLANQARGI-E-------------------------SDPAYLEMQGNATFKIAVRE
FABH_BAUCH       SDLLTLPYYNRFN-P-------------------------TADIYLKMSGNEVFKIAVTK
FABH_SODGM       GDLLTLPYHNRLD-P-------------------------AASAYLTMSGNEVFKVAVTE
FABH_BLOFL       GDLLTLPHYNTQN-PE------------------------KLSVYLTMSGNKVFKMAIAT
FABH_BLOPB       GDLLTLPNCNRKS-P-------------------------AISNYLTMSGNKVFKIAVSV
FABH_SALCH       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_SALPB       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_SALTY       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_SALTI       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_SALPA       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_SALAR       GELLTLPNADRVN-P-------------------------DNPIYLTMAGNEVFKVAVTE
FABH_CITK8       GELLTLPNADRVN-P-------------------------ENPIYLTMAGNEVFKVAVTE
FABH_ECO24       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_SHISS       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECO57       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOLI       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOUT       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOK1       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOL5       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOL6       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_SHIBS       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_SHIF8       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_SHIFL       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOHS       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_ECOLC       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_SHIDS       GELLTLPNADRVN-P-------------------------ENSIHLTMAGNEVFKVAVTE
FABH_KLEP7       GELLTLPNADRVD-P-------------------------ENPIYLTMAGNEVFKVAVTE
FABH_ENT38       GELLTLPNADRVN-P-------------------------DNSIFLTMAGNEVFKVAVTE
FABH_CROS8       GELLTLPNQDRVN-P-------------------------DSPTFLTMAGNEVFKVAVTE
FABH_YERP3       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERPS       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERPA       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERPE       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERPN       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERPP       GELLALPYPDRQ--Q-------------------------DQPAYVTMAGNEVFKVAVTE
FABH_YERE8       GELLALPYPDRQH-Q-------------------------EQPAYVTMAGNEVFKVAVTE
FABH_SERP5       GGLLTLPFKDRQD-Q-------------------------DKPAYVTMAGNEVFKVAVTE
FABH_PECAS       GELLTLPHQDRNH-T-------------------------DKPAYLTMAGNEVFKVAVTE
FABH_PHOLL       GELLVLPYQERQN-L-------------------------KEPAYASMIGNEVFKIAVRE
FABH_MARHV       EELLHVPCGIANDFDAVK----------------------AGQAFVEMKGNEVFKVAVNT
FABH_THISH       DNLLHVPKGISTAYSEVL----------------------AGEAYIEMKGNEVFKVAVNT
FABH_ALKEH       QDLLGVPWGPGQGYEKRD----------------------ALGPYITMQGNEVFKVAVRT
FABH_XANAC       KELLWDPVGVSVGFGEGK----------------------NGGGALLMKGNDVFKYAVKA
FABH_XANC5       KELLWDPVGVSVGFGEGK----------------------NGGGALLMKGNDVFKYAVKA
FABH_XANOM       KELLWDPVGVSVGFGEGK----------------------NGGGALLMKGNDVFKYAVKA
FABH_XANC8       KELLWDPVGVSVGFGEGK----------------------NGGGALLMKGNDVFKYAVKA
FABH_XANCP       KELLWDPVGVSVGFGEGK----------------------NGGGALLMKGNDVFKYAVKA
FABH_XYLFA       KELLWDPVGVSVGFGEGK----------------------D-CGALLMKGNEVFKYAVKA
FABH_XYLFT       KELLWDPVGVSVGFGEGK----------------------D-CGALLMKGNEVFKYAVKA
FABH_METCA       QDLLYLPNPASNGEG--S----------------------DESRTIRMQGSEVFKVAVNT
FABH_THIDA       KELLRTTTGPSSG----S----------------------KTPALMRMEGNAVFKMAVNT
FABH_ACIET       VGILCVPGNVYGGQIL-------------------------GDPLLKMDGQAVFKLAVGV
FABH_ACISJ       VGILCVPGNVYGGQIL-------------------------GDPLLKMDGQAVFKLAVGV
FABH_DELAS       VGILCVPGNVSGGQVL-------------------------GDPLLKMDGQAVFKLAVGV
FABH_ACIAC       VGILCVPGNVYGGQIL-------------------------GDPLLKMDGQAVFKLAVGV
FABH_VEREI       VGILCVPGNVSGGQVL-------------------------GDPVLKMDGQAVFKLAIGV
FABH_POLNA       VGILCVPGHVSGGQVL-------------------------GSPLLTMDGKAVFKLAVGV
FABH_POLSJ       VGILCVPGNVSGGQVL-------------------------GDPLLKMDGQAVFKLAVGV
FABH_VARPS       VGILCVPGHVSGGNVL-------------------------GTPLLHMDGQAVFKLAVRV
FABH_RHOFT       VGILCVPGHVSGGNVL-------------------------GAPLLQMDGPAVFKLAVGV
FABH_BURCC       SNILCTPGNVNRGVID-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURCH       SNILCTPGNVNRGVID-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURCA       SNILCTPGNVNRGVID-------------------------GSVFLHMDGQAVFKLAVNV
FABH_BURL3       SHILCTPGNVNRGVIE-------------------------GSAFLYMDGQAVFKLAVNV
FABH_BURVG       SNILCTPGNVNRGVIE-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURM7       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURM9       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURMA       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURMS       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURP1       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURPS       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURP6       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURP0       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_BURTA       SNILCTPGNVNRGVIA-------------------------GSAFLHMDGQAVFKLAVNV
FABH_PARP8       SNILCTPGNVNGGIVQ-------------------------GSAFLHMDGQAVFKLAVNV
FABH_CUPNH       VDILCVPGNVAGGNIT-------------------------GNPFLHMDGQAVFKLAVNV
FABH_CUPTR       VDILCVPGNVAGGNIT-------------------------GNPFLHMDGQAVFKLAVNV
FABH_CUPPJ       VGILCVPGNVHGGAIA-------------------------GNAFLHMDGQAVFKLAVTV
FABH_RALPJ       ANILCVPGNVAAGAIQ-------------------------GSAFLYMDGQAVFKLAVTV
FABH_RALSO       ADILCVPGNVAGGAIK-------------------------GSAFLYMDGQAVFKLAVNV
FABH_HERAR       GDILCGPGRISNGVLE-------------------------GSAFMYMDGQAVFKLAIGL
FABH_JANMA       GDILCLPGKVSKGVVE-------------------------GSAFLYMDGPAVFKLAVSV
FABH_POLNS       RDILCVPGRAGNGEVR-------------------------GSPFMTMDGQAVFKLAVKV
FABH_POLAQ       RDILCVPGRSGNGAVH-------------------------GSPFMTMDGQAVFKLAVKV
FABH_AROAE       HPILCVPGAVAAGQVV-------------------------GDPFLRMDGQAVFKFAVRV
FABH_AZOSB       HPILCVPGNVATGQVV-------------------------GDPFLRMDGQAVFKFAVKV
FABH_BORBR       TKILCAAGNVAYGDVT-------------------------GDPFLRMDGQAVFKQAVTV
FABH_BORPA       TKILCAAGNVAYGDVT-------------------------GDPFLRMDGQAVFKQAVTV
FABH_BORPE       TKILCAAGNVAYGDVT-------------------------GDPFLRMDGQAVFKQAVTV
FABH_BORPD       TKILCAAGNVAYGDVT-------------------------GDPFLRMDGQAVFKQAVTV
FABH_BORA1       TKILCAAGNVAYGQVT-------------------------GDPFLRMDGQAVFKQAVTV
FABH_CHRVO       QGLLNTPAQISGGKIQ-------------------------GIPYLHMDGPAVFKFAVKS
FABH_LARHH       KDILKCDARPSQGVLA-------------------------GNPFVYMDGQAVFKFAVKA
FABH_NEIG1       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NEIG2       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NEIM0       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NEIMF       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NEIMB       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NEIMA       LKLLNVPGQIACGKVS-------------------------GSPYISMDGPGVFKFAVKM
FABH_NITEC       SQVLSAPASIHSGKIQ-------------------------GTPFITMEGSTVFKFAVKV
FABH_NITEU       SQVLTAPASIHSGKIQ-------------------------GTPFITMEGGTVFKFAVKV
FABH_NITMU       SKILSAPANICGGKVQ-------------------------GKPFVVMEGNTVFKFAVKV
FABH_VESOH       LSSLQVSNNYINE-----------------------------VGFIEMSGNEVFKIAVNR
FABH_DICNV       KELLWVPQGIGSSETDFA----------------------TRRPFIEMQGREVFKFAVRS
FABH_COXB2       SDLITAKSGVWER---------------------------ESVPHLHMYGKEVFKLAVTK
FABH_COXBU       SDLITAKSGVWER---------------------------ESVPHLHMYGKEVFKLAVTK
FABH_COXBR       SDLITAKSGVWER---------------------------ESVPHLHMYGKEVFKLAVTK
FABH_COXBN       SDLITAKSGVWER---------------------------ESVPHLHMYGKEVFKLAVTK
FABH_COXB1       SDLITAKSGVWER---------------------------ESVPHLHMYGKEVFKLAVTK
FABH_ACICJ       GDILFIDGATGQDDRP---------------------------QHLVMNGREVFRHAVSK
FABH_GRABC       GDILFIDGANGVAGHP---------------------------GTIVMNGREVFRHAVGK
FABH_AGRFC       KDKLYVDGGPSTTGTV---------------------------GHLRMEGREVFKHAVGM
FABH_RHIL3       KEKLYVDGGPSTTGTV---------------------------GKLRMEGREVFKYAVGM
FABH_RHIME       RDKLYVDGGPSTTGTV---------------------------GHLRMEGREVFKHAVGM
FABH_SINMW       GDKLYVDGGPSTTGTV---------------------------GHLRMEGREVFKHAVGM
FABH_AGRRK       KDKLYVDGGPSSTGTV---------------------------GVLHMAGREVFKHAVGM
FABH_AGRVS       KDKLYVDGGPSTTGTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUA1       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUA2       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUAB       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUME       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUC2       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUSU       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUMB       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUO2       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRUSI       KEKLYVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_OCHA4       KEKLFVDGGPSTTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_RHILO       KDKLFVDGGPSTTGTV---------------------------GHLRMEGREVFKHAVGM
FABH_CHESB       KEKLYVDGGPSTTRTV---------------------------GHLRMQGREVFKHAVGM
FABH_BARHE       MDKLYVDGGPSTTQKT---------------------------GYLRMEGREVFKYAVGM
FABH_BARQU       VNKLYVDGGPSTTQTT---------------------------GYLRMEGREVFKYAVCM
FABH_BART1       IDKLYVDGGPSTTQTT---------------------------GYLRMEGREVFKYAVGM
FABH_BARBK       IDKLYADGGPSTTQTI---------------------------GYLRMKGQEVFKHAVGI
FABH_BRASB       KAKLYVDGGPSSTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRASO       KAKLYVDGGPSSTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_BRADU       KAKLFVDGGPSSTQTV---------------------------GHLRMEGREVFKHAVGM
FABH_ERYLH       HDLLYVDGGPSTTQTV---------------------------GHLRMRGREVFRHAVVN
FABH_NOVAD       NELLYVDGGPSTTGTV---------------------------GKLRMKGREVFRHAVTN
FABH_SPHAL       CDMLYVDGGPSTTGTV---------------------------GHVRMQGREVFRHAVTN
FABH_SPHWW       NQLLYVDGGPSTTQTV---------------------------GKLRMKGQEVFRHAVTN
FABH_RHOCS       HDLLYVDGGPSTTQTV---------------------------GHLRMKGQEVFKHAVVN
FABH_RHORT       HDLLYVDGGPSSTGTV---------------------------GHLRMQGREVFRHAVTN
FABH_MAGSA       YDLLYVDGGPSSTQTV---------------------------GHVHMEGREVFRHAVIN
FABH_CAUVC       QDLLYVDGGPSTTGTV---------------------------GKLRMLGNQVFKHAVVN
FABH_HYPNA       SNLLYVDGGVSSTGTI---------------------------GHVRMEGNKVFKHAVTN
FABH_RHOS1       KDLLYVDGGSS-TGTT---------------------------GHLRMQGREVFRHAVEK
FABH_RHOS4       KDLLYVDGGSS-TGTT---------------------------GHLRMQGREVFRHAVEK
FABH_RHOS5       KDLLYVDGGAS-TGST---------------------------GHLRMQGREVFRHAVEK
FABH_RUEPO       KDLLYVDGGVS-TQTT---------------------------GHLRMQGNQVFRHAVEK
FABH_RUEST       KDLLYVDGGVS-TQST---------------------------GYLRMQGNQVFRHAVEK
FABH_ROSDO       KDLLYVDGGVS-TGTT---------------------------GYLRMQGNQVFRHAVEK
FABH_DINSH       RDILYVDGGVSSSQTA---------------------------GYLRMEGKEVFRHAIEK
FABH_JANSC       RELLYVDGGVSSTGTT---------------------------GVLKMQGKEVFRHAIEK
FABH_PARDP       RDLLYVDGGVASTGTA---------------------------GHLRMQGNLVFRHAVEK
FABH_RHOCA       RELLYVDGGVSTNGQS---------------------------GHLRMQGNAVFKHAVQK
FABH_EHRCJ       HDLLYTSGGTAYNGVA---------------------------GTICMNGTVVFEHAIEK
FABH_EHRCR       CDLLYTTGGTAYNGHA---------------------------GTICMNGTIVFEHAIEK
FABH_EHRRG       HNLLYTSGGTAYNGVA---------------------------GTICMNGTVVFEHAIEK
FABH_EHRRW       HNLLYTSGGTAYNGVA---------------------------GTICMNGTVVFEHAIEK
FABH_WOLPM       VDILCTNGGISSTGDS---------------------------GKICMNGREVFKHAVDK
FABH_WOLPP       VDILCTNGGVSSTRDS---------------------------GKILMNGREVFKHAVDK
FABH_WOLTR       VDVLCTKGGISSTGDS---------------------------GKIYMNGREVFKHAVDK
FABH_ANAMM       GNVLYTNGGVASTGKA---------------------------GYICMKGTVLFEHAVVK
FABH_RICRO       DEILYTNGGVSMNGIS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICRS       DEILYTNGGVSMNGIS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICCN       DEILYTNGGVSMNGIS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICM5       -EILYTNGGVSMNGIS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICFE       -EILYTNGGVSMNGIS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICAH       -EILYTSGGISMNGTS---------------------------GKIIMQGQKLFRHAIEK
FABH_RICCK       -DILYTNGGISMNGTS---------------------------GKIIMQGQKLFRHAIEK
FABH_RICPR       -EILYTSGGTSMNGTS---------------------------GKIVMQGQKLFRHAIEK
FABH_RICTY       -EILYTSGGTSMNGTS---------------------------GKIVMQGQKLFRHAIAK
FABH_RICB8       -EILYTNGGVSMNGSS---------------------------GKIIMQGQKLFRLAVEK
FABH_RICBR       -EILYTNGGVSMNGSS---------------------------GKIIMQGQKLFRLAVEK
FABH_NEOSM       GEALLAEVGGT----------------------------------LKMDGRSVFEAAIKR
FABH_AQUAE       EELLHAD----------------------------------NCGYIRMKGRELFKVAVRS
FABH_PERMH       WGSLYCP----------------------------------VGEKLRMRGRETFKLAIKS
FABH_SULDN       ADLLMSPNGGSGSIHDTLDQE-------------------AKSCFMQMKGNETFKVAVKT
FABH_SULNB       ADFLVTPAPGAINPASQKVID-------------------EGLNFVQMKGNETFKLAVKT
FABH_ARCB4       EDLIKTPGGGSKNPCSQEVLE-------------------NKMACIKMKGNETFKLAVKT
FABH_HELP2       SNYLYTPRTLKPTPFNAK-EE-------------------ALEPFLCMKGNEVFKLAVKT
FABH_HELPG       SNYLYTPRTLKPTPFNAK-EE-------------------ALEPFLCMKGNEVFKLAVKT
FABH_HELPY       SNYLYTPRTLKPTPFNAK-EE-------------------ASEPFLCMKGNEVFKLAVKT
FABH_HELPS       SNYLYTPRTLKPTPFNAK-EE-------------------ASEPFLRMKGNEVFKLAVKT
FABH_HELPJ       SNYLYTPRTLKPTPFNAK-EE-------------------ALEPFLRMKGNEVFKLAVKT
FABH_HELPH       SNYLYTPRTLKPTPFNSK-EE-------------------ALEPFLCMKGNEVFKLAVKT
FABH_HELAH       SNYLYTPRTLKPTPFNAK-EE-------------------TSDPFLCMKGNEVFKLAVKT
FABH_HELHP       QDFLCTPRVHATFGATQA-QE-------------------K-QSFIQMKGNETFKVAVKT
FABH_CAMC1       AELLITPGCGSAFPASDETLK-------------------NRLNFIHMSGNEVFKIAVQT
FABH_CAMC5       SHLLITPGCGSAYPASDETLA-------------------KRLNFIHMSGNEVFKIAVQT
FABH_CAMFF       GNLLITPGCGIVHPANKDTID-------------------KKLNFLHMSGNEVFKIAVNT
FABH_CAMHC       AELLMTPTKNS---NIKDIAD-------------------ENLGFLHMKGNEVFKIAVQT
FABH_CAMJE       GDLLMTQ------RSQKSSLC-------------------QTLS-MQMKGNEVFKIAVNT
FABH_CAMJJ       GDLLMTQ------RSQKSSLC-------------------QTLS-MQMKGNEVFKIAVNT
FABH_CAMJ8       GDLLMTQ------RSQKSNLC-------------------QTLS-MQMKGNEVFKIAVNT
FABH_CAMJR       GDLLMTQ------RSQKSSLC-------------------QTLS-MQMKGNEVFKIAVNT
FABH_CAMJD       GDLLMTQ------RSQKSSLC-------------------QTLS-MQMKGNEVFKIAVNT
FABH2_BACTN      LPFLHMKAGGSVCPPSYFTVD-------------------NKMHYLHQEGRTVFKYAVSS
FABH_BACV8       LPFLHMKAGGSVCPPSYFTVD-------------------HKMHYLYQEGRTVFKYAVSN
FABH1_BACTN      LPFLHIKAGGSVCPPSYYSLD-------------------HHLHYIYQEGRTVFKYAVAN
FABH_PARD8       YPHLIMKSGGSAYPPSHETVD-------------------NREHFVYQDGRVVFKYAVSY
FABH_PORG3       KDHLIMKAGGSACPATHETVD-------------------NRWHYVYQEGQVVFKHAVVD
FABH_PORGI       KDHLIMKAGGSACPATHETVD-------------------NRWHYVYQEGQVVFKHAVVD
FABH_AZOPC       PESLHVYGGGSVNPTTYETIN-------------------NKLHYVWQDGKVVFRHAVSN
FABH_PELLD       KDHLLMKGGGSLHPATHDTVD-------------------QHLHYIYQDGRMVFKSAVTS
FABH_CHLPM       KDHLLMKGGGSLHPATHQTVD-------------------DHLHYIYQDGRMVFKSAVTS
FABH_CHLCH       RERLLMTGGGSRYPASHETVD-------------------KKMHYIYQDGRQVFKAAVTA
FABH_CHLPD       TSHLLMAAGGSLNPATHETVD-------------------KRMHFLHQDGKQVFKSAVTS
FABH_CHLTE       REHLLMPGGGSLHPASHETVD-------------------QHMHFIQQDGKQVFKAAVIA
FABH_KORVE       -QYLYMPGGGSLNPASHETID-------------------QKMHYVHQDGQNVFKYAVKK
FABH_SOLUE       -EFLRMPAGGSRRPASHETVD-------------------QRMHYVHQEGSQVFKYASRK
FABH2_VIBVU      DILSVPKFGTSMDRFAADNGY-------------------WDFNFV---GKEIFKRAVKG
FABH2_VIBVY      DILSVPKFGTSMDRFAADNGY-------------------WDFNFV---GKEIFKRAVKG
FABH2_VIBPA      DILSVPKFGTCMDRFAEDNGY-------------------WDFNFV---GQEIFKRAVKG
FABH2_VIBCH      DILAVPKFGTAMDRFDADNGY-------------------WAFDFV---GKEIFKRAVRG
FABH_PSET1       DILHIENFGSDLNKYEP-IGP-------------------SNLLFE---GREIFKRAVKG
FABH_TRIV2       NHYLNLAYQGTAQEILPNIKITQ-----------------GTYQPVTMNGKEVYRFAAQK
FABH_NOSS1       NHYLNLAYQGTAKEILPNVKITQ-----------------GTYQPVTMNGKEVYRFAAQK
FABH_TRIEI       NSCLSLSYQPQEKRIIEGVTVSQ-----------------GTYQPIAMNGKEVYRFVVQK
FABH_ACAM1       HDCLNVQYQGEARPLTGEINVSQ-----------------GTYQPISMNGKEVYRFAVNR
FABH_SYNE7       NGCLTLAYQADNQSLLSDIEIAQ-----------------GTYQPVAMNGQEVYRFAVKR
FABH_SYNP6       NGCLTLAYQADNQSLLSDIEIAQ-----------------GTYQPVAMNGQEVYRFAVKR
FABH_MICAN       NGSLNLAYEGEELPLKQGIRVQK-----------------GTYKPLRMNGREVYRFAVAK
FABH_SYNY3       NGCLNLSYQANPQPLTAEKTVAQ-----------------GTYQAITMNGREVYRFAVAK
FABH_THEEB       NEHLTLAFAGTPQTLGENLAIAQ-----------------GGFAPITMNGREVYRFAVTQ
FABH_GLOVI       AGHLNIHCTAEAVPLAADMAATR-----------------ARFASITMNGREVYRFAVEA
FABH_PROM0       GSFLNLPSKNNKDLIIDNIDFLS-----------------GAFSPIQMNGQEVYKFAVRE
FABH_PROM9       GSFLNLPSKNNKDLIIDNIDFLN-----------------GGFSPIQMNGQEVYKFAVRE
FABH_PROM2       GCFLNLPSKNNEDSIIDNIEFLS-----------------GGFSPIQMNGQEVYKFAVKE
FABH_PROM5       GSFLNLPSQKNNDQIIDNINFSS-----------------GGFSTIAMNGQEVYKFAVRE
FABH_PROMP       GSFLNLPSQNNQDLIINDINFSS-----------------GGFSSIKMNGQEVYKFAVRE
FABH_PROMA       GDCLNLAQKRNFVPLVESYQTQK-----------------GDFSPIKMNGQEVYKFAVRE
FABH_PROMT       GGCLNLSQSNVFLDLVQGANHQK-----------------GEYLPIKMEGKEVYKFAVKE
FABH_PROMM       GDCLNLPQVQNHLSLVAGNSHQQ-----------------GGFKPIQMNGQEVYKFAVRE
FABH_SYNR3       GDCLTLAQTSERAELLPGMSHQR-----------------GGYAPIGMNGQEVYKFAVRE
FABH_SYNPW       GAVLNLPANDTSAPLIAGAEHRA-----------------GGYRPIVMNGQEVYKFAVRE
FABH_PORPU       NSHLQLMNSPSDSQQFGLTTVPK-----------------GRYDSIRMNGKEVYKFAVFQ
FABH_PORUM       NSHLQLMNSPSDSQQFGLTTVPK-----------------GRYDSIRMNGKEVYKFAVFQ
FABH_PYRYE       NSHLQLMNKPVNNQKFGGTEIPH-----------------GNYNSITMNGKEVYKFAVFQ
FABH_GRATL       YKKLSITYKE-NNYSLNTLKLFQ-----------------GQFQYISMNGKEVYKFAVSK
FABH_RHOBA       GEMLCIPAGGSRTPITTDGEDSA-----------------SRY--LQMDGRGVFKWAVRV
FABH1_STRCO      AETIKQTVSWDRFRIGDV------------SELPLDSEGNVKFPAITQEGQAVFRWAVFE
FABH_STRGA       AETIKQTVPWTDYREG----------------------GVERFPAITQEGQAVFRWAVFE
FABH_KOCRD       WDAIRMTHPLTDIRTVERGGQRTFAKDLVDPETGEMDPDATLWPTLRQDGQTVFRWASWE
FABH_MYCA1       ATAIRQDIDWMDYLDRPT----------------------GPRPFLRLEGSAVFRWAAFE
FABH_MYCPA       ATAIRQDIDWMDYLDRPT----------------------GPRPFLRLEGSAVFRWAAFE
FABH_MYCMM       AAAIRQDIDWISHAENPA----------------------GPRPFLRMEGTAVFRWAAFE
FABH_MYCUA       AAAIRQDIDWISHAENPA----------------------GPRPFLRMEGTAVFRWAAFE
FABH_MYCTA       ADAIRQDIDWITFAQNPS----------------------GPRPFVRLEGPAVFRWAAFK
FABH_MYCTU       ADAIRQDIDWITFAQNPS----------------------GPRPFVRLEGPAVFRWAAFK
FABH_MYCBO       ADAIRQDIDWITFAQNPS----------------------GPRPFVRLEGPAVFRWAAFK
FABH_MYCBP       ADAIRQDIDWITFAQNPS----------------------GPRPFVRLEGPAVFRWAAFK
FABH_MYCBT       ADAIRQDIDWITFAQNPS----------------------GPRPFVRLEGPAVFRWAAFK
FABH_MYCA9       SNAIRQDIDWMDFAAAPDP--------------------EGPRPYLRIEGTSVFRWAAFE
FABH_STRLI       LGSLHMSSSWDQYVEDPS----------------------VGRPALVMDGKRVFRWAVAD
FABH2_STRAW      GHAVRIE---------------------------------GTPPRFAQEGQSVYRWATTQ
FABH4_STRCO      GNAVRIE---------------------------------GTPPRFAQEGQSVYRWATTR
FABH2_STRCO      DELITIP---------------------------------PDGAYLTMRGSDVYTRAVTT
FABH5_STRCO      KDLIVIPGGGSRERAAAER-------------------PQPAGAYFTMQGKPVFRHAVTR
FABH3_STRCO      VDLITVPAGGPPRPGAAAP-------------------DDLADRYFTMEGKRVFWLAVQR
FABH_PSEA8       FDLLMTPAVSRAERSSG-----------------------QASNYFRMDGKAVFGQAVTQ
FABH_PSEAB       FDLLMTPAVSRAERSSG-----------------------QASNYFRMDGKAVFGQAVTQ
FABH_PSEAE       FDLLMTPAVSRAERSSG-----------------------QASNYFRMDGKAVFGQAVTQ
FABH_LACBA       GRYLTAGANGVDSP----FASDPQPVLP----------------FFKMNGRRVYNFAIKQ
FABH_LACH4       GQYLTAGQTGNPSP----FATDQQPFSP----------------FFKMSGRRVYSFAVKN
FABH2_LACPL      GHYLTAGQQPQVNP----WSTRTDGADSN-------------RWAFQMNGRRVYDFATKQ
FABH_OENOB       AKSLTAGHLWSSTT----WNQPEKGSR-----------------YFQMDGHAVYSFATRQ
FABH_LACDA       AKFLSAGQTSPQP-----FPGPVTDLAP-----------------FKMNGREVYKFATHK
FABH_LACDB       AKFLSAGQTSPQP-----FPGPVTDLAP-----------------FKMNGREVYKFATHK
FABH_LACRD       GDKIVAGKTTPKAG----FPKQLTSLSP-----------------FAMAGRDVYRFATHE
FABH_LACRJ       GDKIVAGKTTPKAG----FPKQLTSLSP-----------------FAMAGRDVYRFATHE
FABH_LACSS       SDQLVSGYAPVKRPNFGQVGQTQVGIDF-----------------FKMTGKAIYQFSTRR
FABH_LACLM       GGSLLSSYADIQTP----FASVSYEG-----------------SNLSMEGRAIFDFAVRD
FABH_LACLS       GGSLLSSYADIQTP----FASVSYEG-----------------SNLSMEGRAIFDFAVRD
FABH_LACLA       GNSLLSSYADIQTP----FASVSYES-----------------SNLSMEGRAIFDFAVRD
FABH_STRA1       -QGLQSSQVGLNSP----FSDEVLDD-----------------KFLKMDGRAIFDFAIKE
FABH_STRA3       -QGLQSSQVGLNSP----FSDEVLDD-----------------KFLKMDGRAIFDFAIKE
FABH_STRA5       -QGLQSSQVGLNSP----FSDEVLDD-----------------KFLKMDGRAIFDFAIKE
FABH_STRE4       GQSLTSGQSSLRSP----FSQGQEVN-----------------SFLQMDGRAIFDFAIRD
FABH_STRS7       GQSLTSGQSSLRSP----FSQGQEVN-----------------SFLQMDGRAIFDFAIRD
FABH_STREM       SQSLTSGQSSLRSP----FSQGQEVN-----------------SFLQMDGRAIFDFAIRD
FABH_STRP1       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPG       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRP3       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPM       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRP8       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPQ       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPB       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPC       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPD       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRP6       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPZ       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRPF       CQSLISGETSLSSP----YSIGKKAI-----------------ATIQMDGRAIFDFAIRD
FABH_STRU0       GQNLTSGNNPLRSP----FSDSEEAS-----------------PFIKMDGRAIFDFAIRD
FABH_STRGC       GESLTSCLMGLQSP----FAQTEDDE-----------------KYLTMDGRAIFDFAIRD
FABH_STRSV       GDSLTCGKIGLSSP----FSEKGENQ-----------------PYLTMDGRAIFDFAIRD
FABH_STRP7       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRPS       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRP2       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRPI       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRR6       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRPJ       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRPN       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRZJ       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRZT       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRP4       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRZP       SECLTYGHSGLHSP----FSDQESAD-----------------SFLKMDGRTVFDFAIRD
FABH_STRMU       GESLTSGEHAVSSP----FSQVDKKDN----------------CFLKMDGRAIFDFAIRD
FABH_STRT1       -GGLESGASAVISP----YSDGTEQPN----------------PYMQMDGKAIFDFAVKT
FABH_STRTD       -GGLESGASAVISP----YSDGTEQPN----------------PYMQMDGKAIFDFAVKT
FABH_STRT2       -GGLESGASAVISP----YSDGTEQPN----------------PYMQMDGKAIFDFAVKT
FABH_STRS2       GASLTAGIDQKETP----FSTQSCQQ-----------------PFIQMEGRAIFEFATRD
FABH_STRSY       GASLTAGIDQKETP----FSTQSCQQ-----------------PFIQMEGRAIFEFATRD
FABH_ENTFA       WAALTSGYTINESP----FYQGHKQAS----------------KTLQMEGRSIFDFAIKD
FABH1_LACPL      TVIHSGRVRPITEV----AATNYPQT-----------------DAFYQVGRDVFQFATTV
                                                                  *          

FABH1_BACAN      LGDSCLRVLDKAGLTKEDVDFLVPHQANIRIMESARERLNLPQEKMSMTIEKF-GNTSAS
FABH1_BACCR      LGDSCLRVLDKAGLTKEDVDFLVPHQANIRIMESARERLNLPQEKMSMTIEKF-GNTSAS
FABH1_BACSU      MGESCVNVIEKAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHKY-GNTSAA
FABH_BACP2       MGESSVNVIEKAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHKY-GNTSAA
FABH_GEOKA       MGESSVRVLEKAGLTKDDVDFLIPHQANIRIVEAARQRLELPEEKISTTIRRY-GNTSAA
FABH1_BACHD      MGESALSVLEKAGLSKEDVDFLIPHQANIRIMEASRERLELPVEKMSTTVKKY-GNTSSA
FABH_OCEIH       MPDSTVNVIEQLGLSRDDVDYLVPHQANIRIMEAARERLGISEDKMAKSIEKF-GNNSSA
FABH_LISIN       MGEASLRVLESAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKY-GNTSSS
FABH_LISW6       MGEASLRVLERAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKY-GNTSSS
FABH_LISMF       MGEASLRVLERAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKY-GNTSSS
FABH_LISMO       MGEASLRVLERAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKY-GNTSSS
FABH1_STAES      MGDASTRVVEKAGLSSEDIDLFVPHQANIRIMESARERLGIEREKMSVSVNKY-GNTSAA
FABH_STAEQ       MGDASTRVVEKAGLSSEDIDLFVPHQANIRIMESARERLGIEREKMSVSVNKY-GNTSAA
FABH_STAAM       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAN       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAR       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAA9       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAB       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAA1       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAA2       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAA3       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAE       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAA8       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAC       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAW       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAS       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAAT       MGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNKY-GNTSAA
FABH_STAHJ       MGEASTRVVDKAGLQSDDIDMFIPHQANIRIMESARERLGIEREKMSVSVNRF-GNTSAA
FABH_STAS1       MGEASNNAVAKANLTADDVDMFVPHQANIRIMESARERLGIPKEKMSVSVDRF-GNTSAA
FABH_DEIDV       LGDSGTQALEKSGLTTADVDWVIPHQANVRIIEAAMERFGLPMSKTIINLDRY-GNTSSA
FABH_DEIGD       LGDSGQQVLDKSGLTSADVDWVIPHQANIRIIEAANERFGVPMSKTVVNIDRY-GNTSSA
FABH1_DEIRA      LGDSGTQALQKSGLSNADVDWLIPHQANIRIIEAATQRFGIPMEKTVINLDRY-GNTSAG
FABH2_DEIRA      LGDSAEQAMRQAGKTTADIDWLVPHQANIRIIEAACERFGLPIERAVTNLDRY-GNTSAA
FABH2_BACAN      VPVGIKELLHTANMKMDDIDWFIPHSANLRMIESICEKSQIPIHKTLTSVEYM-GNTSSV
FABH2_BACCR      VPKGIKNLLHTVNMQVDDIDWFIPHSANLRMIESICEKSQIPIQKTLTSVEYM-GNTSSV
FABH2_BACSU      VPGEFERLLHKAGLSSDDLDWFVPHSANLRMIESICEKTPFPIEKTLTSVEHY-GNTSSV
FABH2_BACHD      VPAGMKAVLEKAAMKRNEIDWFVPHSANLRMIESICDKSGIPLEQTLYSLVQY-GNTSSA
FABH2_STAES      VPNIIHEVLNQSNYSIEDLNWFVPHSANARMIESICEKANIETDKALKSLKYY-GNTSSA
FABH_ACHLI       MPKAIHKVLEKAGLTIDDIDYIIPHQANYRIIQSVAKDMNLPIERFLMNLEEY-GNTSAA
FABH_FUSNN       LPKVTSDALEKAKLKVNDLSMVFPHQANLRIIESAAKRMKFPLEKFYMNLSRY-GNTSSA
FABH_CLOAB       MVSSVKKVIEDSGLNIEDIDYIVPHQANIRIIEFAAKKLGLSMDKFFINLQNY-GNTSGA
FABH_CLONN       MIDSVHKVLEKTDYTIEDIDYIVPHQANIRIIEYVAKKLKVSQDKFYINLHRY-GNTSGA
FABH_CLOB1       MNETIYNIQEKTKWDLNEVKYIISHQANSRIIEYTAKKLNTEKDKFYMNLDKY-GNTSAA
FABH_CLOBH       MNETIYNIQEKTKWDLNEVKYIISHQANSRIIEYTAKKLNTEKDKFYMNLDKY-GNTSAA
FABH_CLOBJ       MNETICNIQEKTKWNLNEVKYIISHQANSRIIEYTAKKLNTEKDKFYMNLDKY-GNTSAA
FABH_CLOBL       MNETICNIQEKTKWDLNEVKYIISHQANSRIIEYTAKKLNTEKDKFYMNLDKY-GNTSAA
FABH_CLOBM       MNETICNIQEKTKWDLNEVKYIISHQANSRIIEYTAKKLNTEKDKFYMNLDKY-GNTSAA
FABH_CLOB6       MSETICNIQEKTKWDLSEVKYIISHQANSRIIEYTAKKLNTSKDKFYMNLDKY-GNTSAA
FABH_CLOBK       MSETIYSIQEKTKWDLSEVKYIISHQANSRIIEYTAKKLNTNKDKFYMNLDKY-GNTSAA
FABH_CLOK1       LVKSVKMLLKEQEVTLEEIKYIIPHQANYRIIECAAKILKVDIDKFYINLDLY-GNTSAA
FABH_CLOK5       LVKSVKMLLKEQEVTLEEIKYIIPHQANYRIIECAAKILKVDIDKFYINLDLY-GNTSAA
FABH_CLOTE       MIKGIEKVLKDSNLELKDINYIIPHQANLRIIEHVAKKLGIDENKFYININHY-GNTSAA
FABH_CLOB8       IDEAVTEVMKDTNVSFDDIKYIVPHQANYRIIKLAAEKLKLSEDKFYLNLEKV-GNTSAA
FABH_CLOP1       MEESIVEILEKENIKIEDIDAIIPHQANLRIIDYVVKRLGIPREKFITNLQNY-GNTSGA
FABH_CLOPE       MEESIVEILEKENIKIEDIAAIIPHQANLRIIDYVVKRLGIPREKFITNLQNY-GNTSGA
FABH_CLOPS       MEESIVEILEKENIKIEDISAIIPHQANLRIIDYVVKRLGIPREKFVTNLQNY-GNTSGA
FABH_CLOD6       MAETSLRALEKANLNTTDIDYLVPHQANIRIIQASSKRLELDMKKVYVNIDKY-GNMSAA
FABH_CALS4       MDSATIEVLERCGLTPEDIDMLIPHQANTRIIEAARKRLKLTNDKVYINLDKY-GNTSAA
FABH_DESHD       MGETALKALDKAGLGIGDVDCLIPHQANTRIVDAAVKRLGIDAGKVVVNLDRY-GNMSAA
FABH_DESHY       MGETALKALDKAGLGIGDVDCLIPHQANTRIVDAAVKRLGIDAGKVVVNLDRY-GNMSAA
FABH_SYMTH       MDEATVQVVEKAGLTVGDIDLLVPHQANVRIIDSAVKRLGLAPEKVVVNLDRY-GNTSSA
FABH_NATTJ       IGDTTEKALKKIDKTTEDIDLFIPHQANQRIIDSATNRLGISKEKTFVNLQNY-GNMSAA
FABH_SYNWW       VVAVSEKLLSQAGLSYQDVDLFIPHQANLRIIKTAMKRMRIPAEKTLINLDHF-GNMSAA
FABH_CALS8       MPYAVEKVLEKVGLSSSDIDVFIPHQANIRIIESAAKRLKIPMEKVFVNLHKY-GNTSAA
FABH_CHLCV       MESAAKICIAEAGLAEGDIDWLVPHQANERIIDAIAKRFEIDESKVFKTLSKY-GNTAAS
FABH_CHLPN       METAAKHSIALAGIQEEDIDWFVPHQANERIIDALAKRFEIDESRVFKSVHKY-GNTAAS
FABH_CHLTA       MEFAAKTCITEAGLQEKDIDWLVPHQANERIIDAIAKRFAVKDSRVFKTLAKY-GNTAAS
FABH_CHLTR       MEFAAKTCITEAGLQEKDIDWLVPHQANERIIDAIAKRFAVKDSRVFKTLAKY-GNTAAS
FABH_CHLMU       MEFAAKTCITEAGLQEEDIDWLVPHQANERIIDAIAKRFAVEDSRVFKTLAKY-GNTAAS
FABH_DESPS       MEGAVNTIMEEVGVSPHEIKLLIPHQANIRIIKNLGERLGLSSEQVFVNIANY-GNTSAA
FABH_DESVH       MTQVCNDLLARNGFTTEDVDLVIPHQANLRIIEAVGDRLGFASEKVFVNVHDF-GNTSAA
FABH_DESVV       MTQVCNDLLARNGFTTEDVDLVIPHQANLRIIEAVGDRLGFASEKVFVNVHDF-GNTSAA
FABH_DESVM       MAAISQDVLARNGLTIDDVALVIPHQANLRIIEAVGDRLGVPAERVFVNLHEF-GNTSAA
FABH_DESAG       MARVCEELLERNGIAREDVDMLLPHQANLRIIEAVGKKLGIPADKVFVNLQEY-GNTSAA
FABH_ROSCS       MAASSFDALQAAGLSTDDVALVIPHQANLRIIEATAKRLEVPLDRVFVNLDRY-GNTSAA
FABH_ROSS1       MAASSLEAIRVAGLSPDDIALVVPHQANLRIIEATARRLEVPMERVFVNLDRY-GNTSAA
FABH_RUBXD       FPEMVEKIMARNGISLDEVQYIIPHQANARIIQAAARKLEVPEEKLVVNVDRF-GNTSAA
FABH1_VIBVU      LSKLVKDTLEANGMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRH-GNTSAA
FABH1_VIBVY      LSKLVKDTLEANGMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRH-GNTSAA
FABH1_VIBPA      LSKLVKDTLEANDMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRH-GNTSAA
FABH1_VIBCH      LSKLVVDTLKANNMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRH-GNTSAA
FABH_ALIF1       LSNLVKETLQENQMDKSELDWLVPHQANLRIIKATAKKLSMSMDQVVVTLDRH-GNTSAA
FABH_PSEA6       LSEIVEETLAANNMQKSDLDWLVPHQANFRIIKATAKKLDMSLDQVVITLERY-GNTSAA
FABH_SHEON       LSHVVTETLRLNNIDKSEIDWLVPHQANFRIINATAKKLDMSLDKVVLTLAKH-GNTSAA
FABH_PSYIN       LSQVVVDTLAANNIEKEQLDWLVPHQANKRIITATAKKLGMSMDQVILTLENQ-GNTSAA
FABH_ACTP2       LSSVVEETLEANNLQKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKY-GNNSAA
FABH_HAEDU       LANVVEETLQANNLQKADLDWLVPHQANIRIIAATAKKLEMEMSQVVLTVEKY-GNNSAA
FABH_HAEI8       LSNVVEETLLANNLDKKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDKY-ANNSAA
FABH_HAEIG       LSNVVEETLLANNLDKKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDKY-ANNSAA
FABH_HAEIN       LSNVVEETLLANNLDKKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDKY-ANNSAA
FABH_ACTSZ       LSNVVEETLVANNLDKKDIDWLVPHQANLRIIAATVKKLDMTLEQAVVTLDKY-ANTSAA
FABH_HAES1       LSNVVEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKY-GNTSAA
FABH_HISS2       LSNVVEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKY-GNTSAA
FABH_PASMU       LANVVEETLEANQLDKKDIDWLVPHQANLRIISATAKKLDMDMSQVVVTLDRH-GNTSAG
FABH_BAUCH       LAHLVDETMSINHLSSKEIDWLVPHQANLRIISATAKLLGMKMNKVIVTLDKH-GNTSAA
FABH_SODGM       LAHIVDETLSANGLDRSELDWLVPHQANLRIITATAKRLGMGMEKVVVTLDRH-GNTSAA
FABH_BLOFL       LTGIINETLHANNLQQDELDWLVPHQANLRIISKAAKRLNIDMEKIIITLHKH-GNTSAA
FABH_BLOPB       LARVIDETLNVNNLHRDELDWLVPHQANLRIISATAKRLDMDMRKVVITLDRH-GNTSAA
FABH_SALCH       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SALPB       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SALTY       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SALTI       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SALPA       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SALAR       LAHIVDETLAANNLDRSELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_CITK8       LAHIVDETLAANNLDRSALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECO24       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SHISS       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECO57       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOLI       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOUT       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOK1       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOL5       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOL6       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SHIBS       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SHIF8       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SHIFL       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOHS       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ECOLC       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_SHIDS       LAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_KLEP7       LAHIVDETLAANNLERSALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_ENT38       LAHIVDETLAANNLERSALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_CROS8       LAHIVDETLEANKLDRADLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRH-GNTSAA
FABH_YERP3       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERPS       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERPA       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERPE       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERPN       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERPP       LAHIVDETLQANNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_YERE8       LAHIVDETLQANNLDRSALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRH-GNTSAA
FABH_SERP5       LAHIVDETLQANNLDRSALDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRH-GNTSAA
FABH_PECAS       LAHIVEETLQAAQLDKSELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRH-GNTSAA
FABH_PHOLL       LANIVDETLEANNLPYSELDWLVPHQANLRIIAATAKKLNMTMDKVVVTLDRY-GNTSAA
FABH_MARHV       LGRIVDETLEANQMQKSEIDWLVPHQANLRIIAATARKLDMPMDQVVVTVNRH-GNTSAA
FABH_THISH       LGRIVDETLEYNDIDQAEIDWLIPHQANIRIIQATARKLKMPMDRVVVTVDEH-GNTSAA
FABH_ALKEH       LSRIVDESLAANGLEKRDIDWLVPHQANIRIIQATARKLEMPMERVVVTVDKQ-GNTSAA
FABH_XANAC       LDSVVDETLAASGYDKHDLDWLIPHQANLRIIEATAKRMELPMEQVVVTVDRH-GNTSSA
FABH_XANC5       LDSVVDETLAANGYDKHDLDWLIPHQANLRIIEATAKRLELPMEQVVVTVDRH-GNTSSA
FABH_XANOM       LNSVVDETLAANGYDAHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRH-GNTSSA
FABH_XANC8       LDSVVDETLAANGLDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRH-GNTSSA
FABH_XANCP       LDSVVDETLAANGLDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRH-GNTSSA
FABH_XYLFA       LDRVVDETLEANHLDKHELDWLIPHQANLRIIEATARRLDMSMDQVVVTVDRH-GNTSTA
FABH_XYLFT       LDRVVDETLEANHLDKHELDWLIPHQANLRIIEATARRLDMSMNQVVVTVDRH-GNTSTA
FABH_METCA       LGRIVDETLEQNGLQKSDVDWLVPHQANIRIIAATAKKLQLPMERVVVTVDEQ-GNTSSA
FABH_THIDA       LDRIVDETLEANGLAKTDIDWLVPHQANIRIISATAKKLGMSMDNVVTTVAGH-GNTSAA
FABH_ACIET       LEKAARATLDKAGMTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQH-GNTSAA
FABH_ACISJ       LEKAARATLDKAGMTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQH-GNTSAA
FABH_DELAS       LEKAARATLDKAGLTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQH-GNTSAA
FABH_ACIAC       LDKAARAVLDKAGLKESDVDWLIPHQANIRIMQGTAKKLGLPMDRVVVTVDQH-GNTSAA
FABH_VEREI       LEQAAHAVLAKAGLKPADVDWLIPHQANIRIMQGTARRLKMGMDKMVVTLDQH-GNTSAA
FABH_POLNA       LESAARATLAKAGLLETDIDWLIPHQANLRIMHSTAKKLKLPLEKLIVTVDEH-GNTSAA
FABH_POLSJ       LESSARAALAKANLRDTDIDWLIPHQANIRIMQSTAKKLKVPPEKLIVTVDEH-GNTSAA
FABH_VARPS       LEDAARATLAKAGKTEADIDWLIPHQANIRIMEGTAKKLKLPREKLIVTVNEH-GNTSAA
FABH_RHOFT       LDEAARAVLAKAGKTAADIDWLIPHQANIRIMQSSARKLKLSMDKVVVTVDQH-GNTSAA
FABH_BURCC       LEKVAIEALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQH-GNTSAA
FABH_BURCH       LEKVAIEALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQH-GNTSAA
FABH_BURCA       LEKVAIEALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQH-GNTSAA
FABH_BURL3       LEKVAIEALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQH-GNTSAA
FABH_BURVG       LEKVAVEALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQH-GNTSAA
FABH_BURM7       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURM9       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURMA       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURMS       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURP1       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURPS       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURP6       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURP0       LEKVAVEALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_BURTA       LEKVAVEALSKAALAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEH-GNTSAA
FABH_PARP8       LEKVAVEALQKADLQPEQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVHEH-GNTSAA
FABH_CUPNH       LDKVAREAMEAASVTPGQIDWLIPHQANIRIMQGTAKKLGLPAERMVATVHEH-GNTSAA
FABH_CUPTR       LDKVAREAMEAASVSPDQVDWLIPHQANIRIMQGTAKKLGLPAERMVATVHEH-GNTSAA
FABH_CUPPJ       LDKVARETMAAAEIQPEQIDWLIPHQANIRIMQGTARKLGLPAERMIAVVHEH-GNTSAA
FABH_RALPJ       LDKVAREALAAAELDASQVDWLIPHQANIRIMQGTTKKLGLSNERLIVTVDEH-GNTSAA
FABH_RALSO       LDKVAREALALAEVESSQIDWLIPHQANIRIMQGTAKKLGLPGERMVVTVDEH-GNTSAA
FABH_HERAR       LDKVANEVLQLAKMDASEVDWIVPHQANIRIMQGTAKKLGLSMDKMIVTVDQH-GNTSAA
FABH_JANMA       LDKVAHEALEIAGMQSSEVDWIIPHQANIRIMQSTAKKLGLGMDKMIVTVDQH-GNTSAA
FABH_POLNS       LEQVAHEALDKAKLKPEQIDWLVPHQANIRIMEGTAKKMGMSMDKVIVTVHEH-GNTSAA
FABH_POLAQ       LEQVAHEVLAKANLKPEQIDWLVPHQANIRIMEGTAKKMGMSMDKVIVTVHEH-GNTSAA
FABH_AROAE       LGDVALEVLDQAGVTVDSVDWLIPHQANIRILQATARRLGVSMDKVITTVDHH-GNTSAA
FABH_AZOSB       LGDVAHEVLDAAGVAADSVDWLIPHQANIRIIQATAKRLGLSMEKVVATVDRH-GNTSAA
FABH_BORBR       LDRSARDVCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITVDQH-ANTSAA
FABH_BORPA       LDRSARDVCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITVDQH-ANTSAA
FABH_BORPE       LDRSARDVCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITMDQH-ANTSAA
FABH_BORPD       LDRSARDVCAEAGVELAELDWLVPHQANVRILNFLARKLQVPTEKVVITVDSH-ANTSAA
FABH_BORA1       LDRSARDVCAEAGMTIDQVDWLVPHQANVRILNFLARKLNVSADRVVVTVDQH-ANTSAA
FABH_CHRVO       LSEIATATLAEAGVEQASLDWLVPHQANLRIIESTAKHLGLPMDKVVVTLPEQ-GNTSAA
FABH_LARHH       LADIAEVTLAKAGKTKADLDWLVPHQANLRIIEATARHLALPMDKVVVTLPNH-ANTSAA
FABH_NEIG1       LSKIADDVIEEAGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NEIG2       LSKIADDVIEEAGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NEIM0       LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NEIMF       LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NEIMB       LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NEIMA       LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDH-GNTSAA
FABH_NITEC       LEEAVLEALHANDLQSSDIDWLIPHQANIRIITSTAKKLGIPEEKVVVTVTQH-GNTSAA
FABH_NITEU       LEEAALEALQANQLQPSDIDWLIPHQANIRIITSTAKKLGIPEEKVVATVSQH-GNTSAA
FABH_NITMU       LEEVVHEALTENNLESSDIDWLIPHQANIRIIASTAKKLGIPMDKVVATVDKH-GNTSAA
FABH_VESOH       LSSLAEKTLKETNLNSNKLDWIVPHQANIRIISAVAKRIKTPMNKVIVTLENH-GNTSAA
FABH_DICNV       LTHLVSELLVQCQMSADEIDFLIPHQANSRIIQAVAEHLNLPIEKVIITVNQH-ANTSAA
FABH_COXB2       LGEIVDEIIEKSGLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQH-GNTSAA
FABH_COXBU       LGEIVDEIIEKSGLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQH-GNTSAA
FABH_COXBR       LGEIVDEIIEKSGLKQSGIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQH-GNTSAA
FABH_COXBN       LGEIVDEIIEKSGLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQH-GNTSAA
FABH_COXB1       LGEIVDEIIEKSGLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQH-GNTSAA
FABH_ACICJ       LAGAVDEALAANDLTQADIDWLVPHQANRRIIDAMGKRLGLAPEQVVVTVDRH-ANTSAA
FABH_GRABC       MAQAVEEAMAANDLTPADIDWLVPHQANLRIIEAMGKKLDLPPEKVVVTVNRH-ANTSAA
FABH_AGRFC       ITDVIEQAFEATGTTADDLDWLVPHQANKRIIDGSAKKLNIDPEKVVITVDKH-GNTSAA
FABH_RHIL3       ITDVIQAAFDSTGTTADDLDWLVPHQANRRIIDGSAKKLNIDAAKVVITVDLH-GNTSAA
FABH_RHIME       ITDVIEAAFEATGTTADDIDWLVPHQANRRIIDGSAKKLGIPLEKVVVTVDLH-GNTSAA
FABH_SINMW       ITDVIEAAFEATGTTADDIDWLVPHQANRRIIEGSAKKLGIPLEKVVVTVDLH-GNTSAA
FABH_AGRRK       ITDVIEATFKAADVTADDLDWLVPHQANRRIIDGSAKKLGIAPEKVVVTVDLH-GNTSAA
FABH_AGRVS       IADVIEQSFAASGLTAEDVDWLVPHQANRRIIDGAAKKLDIPLEKVVITVDQH-GNTSAA
FABH_BRUA1       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUA2       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUAB       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUME       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUC2       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUSU       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUMB       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUO2       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_BRUSI       ITDVIEASFEATGLTAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRH-GNTSAA
FABH_OCHA4       ITDVIEASFEETGLTAEDIDWFVPHQANKRIIDASAKKLNIAEGKVVITVDRH-GNTSAA
FABH_RHILO       ITDVIEATFSAAGISADDLDWFVPHQANKRIIDASAKKLGIAEQKVVVTVDLH-GNTSAA
FABH_CHESB       ITDVIEDVFGQAGITAEDIDWFVSHQANKRIIDASAKKLGIAEEKVVITVDLH-GNTSAA
FABH_BARHE       ITDVVDECFAAAGMDSSQLDWFVPHQANKRIIEASAKKLGISIDKVVITVDRH-GNTSAA
FABH_BARQU       ITDAVDDCFAAAGINSSQLDWFVPHQANKRIIEASAKKLGISMDKVIITVDQH-GNTSAA
FABH_BART1       ITDVVDDCFAAAGMDSSQLDWFVPHQANKRIIEASAKKLKISSDKVVITVDKH-GNTSAA
FABH_BARBK       VTDVIDDCFAAVGMNPSQLDWFVPHQANKRIIEASAKKLGIKTDKVVITVDQH-GNTSAA
FABH_BRASB       ITDVIVDAFEATGLSAETIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRH-GNTSAA
FABH_BRASO       ITDVIVDAFEATGLSAETIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRH-GNTSAA
FABH_BRADU       ITDVIVDAFEATGLNADSIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRH-GNTSAA
FABH_ERYLH       LADVLKEVLDDAGVSASDIDWVVPHQANARILDATARKLGLPMEKIVVTVDRH-ANTSAA
FABH_NOVAD       LANVLKEVLETTGHDAEEIDWVVPHQANFRILDATARKLDLPADKVIVTVDHH-ANTSAA
FABH_SPHAL       LAAVLGEVMRDVGLSADDIDWVVPHQANKRIIDATAKKLGLPADRVVLTVDQH-ANTSAA
FABH_SPHWW       LAQVLREVMGDAGLTVDDIDWVVPHQANRRILDATARKLGLPAERVIVTVDQH-ANTSAA
FABH_RHOCS       LAHVVEEALAANGLSPADISWLVPHQANRRIIESTARKLKLDGSRVVLTVDHH-GNTSAA
FABH_RHORT       LYEVVLEALAANGLQADAIDWVVPHQANQRILDGTAKKLGIDPAKVISTIALH-ANTSAA
FABH_MAGSA       LAAVVGEALAANDLKASDIDWVVPHQANRRIIEGTAKKLGFPLDKMVMTVERH-ANTSAA
FABH_CAUVC       ISEAIHAAAGKAGVAVADVDWFIPHQANQRILQGVAHRCGIDEEKVISTVAIH-ANTSAA
FABH_HYPNA       ISAAIEAVLTETGLTSADIDWFVPHQANKRILDGVAKKMSIPEEKVVITVSEH-ANTSAA
FABH_RHOS1       LAETAHTALEKAGLGAGDVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDH-GNTSAA
FABH_RHOS4       LAETAHTALEKAGLGAGDVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDH-GNTSAA
FABH_RHOS5       LAETAHTALDKAGLTSADVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDH-GNTSAA
FABH_RUEPO       LAQTAETALDKAGLSSADVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDH-GNTSAA
FABH_RUEST       LASTAHTALERAGASTDEVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDH-GNTSAA
FABH_ROSDO       LAATATTALERAGVSASDVDWVVPHQANIRIIQGTAKKLGVSMDRVVVTVQDH-GNTSAA
FABH_DINSH       LAATAETALAKAGLTEADVDWVVPHQANLRIITATARKMGIGMDRVVVTVADH-GNTSAA
FABH_JANSC       LTKTADTGLAKAGVTVGDVDWVVPHQANIRIISGTVKKFGLPMDKVIVTVQDH-GNTSAA
FABH_PARDP       LADTAHRALDRAGLTPDQVDWLVPHQANLRIIEATAKRMHLPMEKVVLTVADH-GNTSAA
FABH_RHOCA       LAETAHAALAKAGLTPEDVSWIVPHQANLRIITATAERMGVPMERVVVTVADH-GNTSAA
FABH_EHRCJ       LSASILEILSQNDLEICDIDWFVLHQANIRIIELVARRLKIPYEKMIVSIDQH-ANTSAA
FABH_EHRCR       LSASILEILDQNDLEINDVDWFVLHQANIRIIELVARRLKIPYEKMVVSVNWH-GNTSAA
FABH_EHRRG       LSASIVEILNKNNLSIDEVNWFVLHQANIRIIELVARRLKIPSEKMVISINQH-ANTSAA
FABH_EHRRW       LSASIVEILNKNNLSIDEVNWFVLHQANIRIIELVARRLKIPSEKMVISINQH-ANTSAA
FABH_WOLPM       LTASVEETLKCNNLKITDIDWLIPHQANIRIIEAVVKKLDFPIEKVINTVDKH-ANTSAA
FABH_WOLPP       LTASVEETLKCNNLKIIDIDWLIPHQANIRIIEAVVKKLDFPIEKVINTVDKH-ANTSAA
FABH_WOLTR       LTASIEETLRCNNLKITDIDWLVPHQANIRIIEAVVKKLNFLMEKVINTVDQH-ANTSAA
FABH_ANAMM       LSSAISALLESSALDVDSIDWFIPHQANVRIIDLVINRLGLSRDKVILSIDEH-ANTSSA
FABH_RICRO       MQQSIKDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVDKH-ANCSAA
FABH_RICRS       MQQSIKDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVDKH-ANCSAA
FABH_RICCN       MQQSIKDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVDKH-ANCSAA
FABH_RICM5       MQQSIKDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEKH-ANCSAA
FABH_RICFE       MQQSIEDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEKH-ANCSAA
FABH_RICAH       MQQSIEDLLHTNQFSVSGIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEKH-ANCSAA
FABH_RICCK       MQQSIEELLCANQFSVSDIDYFIPHQANVRIINKLAELLNIEEHKIIKTVEKH-ANCSAA
FABH_RICPR       MLQSIEDLLYANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEKH-ANCSAA
FABH_RICTY       MLQSIEDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEKH-ANCSAA
FABH_RICB8       MHQSIEELLRNNNFTVNDIDYFIPHQANVRIINKLAELLNVEDHKVVKTVEKH-ANCSAA
FABH_RICBR       MHQSIEELLRNNNFTVNDIDYFIPHQANVRIINKLAELLNVEDHKVVKTVEKH-ANCSSA
FABH_NEOSM       LTLAIGEALKTTGISVEELDYFIMHQANIRIIELIGEKIGIDRSKIIVTVDRY-ANTSAA
FABH_AQUAE       MEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKEKVFVNIQKY-GNTSAA
FABH_PERMH       METASKKALQKAGLTLEDIKLVIPHQANIRIINALAERMELPEERVYSNIHRY-GNTSAA
FABH_SULDN       LTKDVIEILQDNNIESSEIKHFVPHQANLRIIKAVGDALKLNDEQVVLTVEKF-GNTSGA
FABH_SULNB       LTKDVKEILAKNKIDSGDIPHFIPHQANYRIIKAVGDALKMREDQVVLTVGKY-GNTSAA
FABH_ARCB4       LTSDVKTMLEKHNLTNEDINHFIPHQANYRIIKAVGEALDLSDEKTVVTVDKY-GNTSAA
FABH_HELP2       LLRDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELPG       LLKDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELPY       LLKDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELPS       LLKDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELPJ       LLKDVETILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELPH       LLKDVETILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELAH       LLKDVEMILEKNALKPEDVRLFIPHQANLRIIQAVREHLDFKDEQVVLTVHKY-GNTSAA
FABH_HELHP       LVSEVKEILNTHHINPQDVSFFIPHQANLRIINAVGENLNFTPEQIVVSIQKY-GNTSAA
FABH_CAMC1       LSKSVIEILHANKMQSEDIDFFIPHQANIRIIDAVKNRLNFTDEQCVLTVAKY-GNTSSA
FABH_CAMC5       LTKSVIEILERNNMTSRDIDFFVPHQANIRIIEAVKQRLDFKDEQCVLTIAKY-GNTSSA
FABH_CAMFF       LAKDVVDILEKNSVSSKDIDLFIPHQANLRIIEAVKQRLDFTDEQCVVTVVDY-GNTSSA
FABH_CAMHC       LSNDVVKILKKNNVKPEEIDLFVPHQANFRIIEAVKNRLNFTDNQCVVTVGKY-GNTSSA
FABH_CAMJE       LSNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKY-GNTSAA
FABH_CAMJJ       LSNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKY-GNTSAA
FABH_CAMJ8       LSNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKY-GNTSAA
FABH_CAMJR       LSNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKY-GNTSAA
FABH_CAMJD       LSNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKY-GNTSAA
FABH2_BACTN      MSDVSAAIAEKNGLTKDTINWVVPHQANVRIIEAVAHRMELPMDKVLVNIEHY-GNTSAA
FABH_BACV8       MSDITATIAEKNGLNKDNIDWVIPHQANLRIIDAVASRLEVPLEKVMINIQRY-GNTSGA
FABH1_BACTN      MSDSCEAIIARNHLTKEEVDWVIPHQANQRIITAVAQRLEVPSEKVMVNIERY-GNTSAG
FABH_PARD8       MADVAAEIAEKNGLTHDDIAWIVPHQANLRIIDATAKRLGVDMDKVMINIQKY-GNTSAG
FABH_PORG3       MCNSCVEIMERNNLSHDDITWVVPHQANLRIIDAVARRMGVPYEKVMVNIERY-GNTSSA
FABH_PORGI       MCNSCVEIMERNNLSHDDITWVVPHQANLRIIDAVARRMGVPYEKVMVNIERY-GNTSSA
FABH_AZOPC       MADTCQKLISKNNLSKDEIDWVVPHQANLRIIDAVTNHLKISRERVMINIEKY-GNTGAA
FABH_PELLD       MADVAAEIMERNGLTSDDVSWLVPHQANQRIISATAERMGIDESKVISNVGRY-GNTTAG
FABH_CHLPM       MANVAVEIMERNGLTAENVSWLVPHQANQRIISATAERMGISSDKFISNVARY-GNTTAG
FABH_CHLCH       MADVATEIMQRNNLTADDVAYLVPHQANQRIIDAIAERMGVDRAKVVSNVGYY-GNTTAG
FABH_CHLPD       MADVAAEIMTRNNLSAEDISFLVPHQANQRIINATAERMGLDQEKVYSNVARY-GNTTAG
FABH_CHLTE       MADVAEEIMQRNNLTAETIDWLVPHQANQRIIHATAERMGITEEKVMMNIARY-GNTTAG
FABH_KORVE       MSEMTEKVLKRNSLTGTDVDCFIAHQANKRIIVATAERLKMPMEKVIINIEKY-GNTTAG
FABH_SOLUE       MYEVCRDLLERNHFKVEDVGLMIPHQANKRIIKAAGDRLGIAPERVMINIERY-GNTTAG
FABH2_VIBVU      MGSAAAHVLAHAGMSKDDINVVIPHQANIRIIQTLCDLSGIDQSKAFVNIQKY-GNTSAA
FABH2_VIBVY      MGSAAAHVLAHAGMSKDDINVVIPHQANIRIIQTLCDLSGIDQSKAFVNIQKY-GNTSAA
FABH2_VIBPA      MGLAAKTVLKASQLTTEQIDVVIPHQANIRIIQTLCDLSGIPQDKAFVNIQNY-GNTSAA
FABH2_VIBCH      MGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFVNIHRY-GNTSAA
FABH_PSET1       MSEACDDVLAQANLSLDDINVLVPHQANLRIIQAIQHRLKVPDEKVMVNIGQY-GNTSAA
FABH_TRIV2       VPEIIDKALFEANITVDQIDWLLLHQANQRILDTVAQRLNIPAHKVISNLANY-GNTSAA
FABH_NOSS1       VPEIIDKALFEAQLTVDQIDWLLLHQANQRILDTVAQRLNIPAHKVISNLANY-GNTSAA
FABH_TRIEI       VPEAIEKALLKANIDIDKLDWLLLHQANQRILDAVANRLNIPPEKVISNLRNY-GNTSAA
FABH_ACAM1       VPEVVEKALFQSDLKTDDIDWLLLHQANQRILDAVAKRLKVPAEKVISNIANY-GNTSAA
FABH_SYNE7       VPEILEKTLFHAGIDRQEVDWLLLHQANQRILDAVADRLDISRDRVLSNLVNY-GNTSSA
FABH_SYNP6       VPEILEKTLFHAGIDRQEVDWLLLHQANQRILDAVADRLDISRDRVLSNLVNY-GNTSSA
FABH_MICAN       VPEVIEKALYRANLTTSDIDWLVLHQANQRIMDAVSERLKLPPEKVISNLSEY-GNTSAA
FABH_SYNY3       VPEIIEKVLFKAQLTTSDLDWVILHQANQRIMDAVGDRLGIPSEKIISNVGEY-GNTSAA
FABH_THEEB       VPEVIEKALHRAGCTVEEIDWLVLHQANQRILDAVAERLGIPQEKVISNVGQC-GNTSAA
FABH_GLOVI       VPDLIEKTLAACGVAPEQVKAYLLHQANQRILDSVASRLHVAPERMASNLADY-GNTSSA
FABH_PROM0       VPIILEKLFNKTHYTSDEVDWLVLHQANQRILDSVGDRLKIPREKILSNLEKY-GNTSAA
FABH_PROM9       VPIILDNLFRKTNYTSDEVDWLILHQANQRILDSVGDRLKIPREKILSNLAKY-GNTSAA
FABH_PROM2       VPIILDKLFKKTNYSSDEVDWLILHQANQRILDSVGDRLKIPREKILSNLEKY-GNTSAA
FABH_PROM5       VPLIIDNLFKKTNFNSEKINWLLLHQANQRILDSVGDRLNISSEKILSNLSNY-GNTSAA
FABH_PROMP       VPLIIDNLFKKTNFNSEKINWLLLHQANQRILDSVGERLNVSTEKILSNLSNY-GNTSAA
FABH_PROMA       VPSLLKDVLQTYGIVPESLDWLLLHQANQRILNAVADRFSIPHHKVLTNLANY-GNTSAA
FABH_PROMT       VPIILGEILEKCQIKSESIDWLLLHQANQRILDAVASRFSIPSEKVLSNLKYY-GNTSAA
FABH_PROMM       VPAILQTLLKATNTAPESLDWLLLHQANQRILDAVANRFAIPQAKVLSNLAEY-GNTSAA
FABH_SYNR3       VPAILKQLLADTNTEPASIDWLLLHQANQRILDAAAERLGIAADKVLSNLANY-GNTSAG
FABH_SYNPW       VPAVLQSLLKRCDVSADQLDWLLLHQANQRILDAVADRLSVPGAKVLSNLAAY-GNTSAA
FABH_PORPU       VPIVIKNCLNDVNISIDEVDWFILHQANIRILEAIATRLSIPLSKMITNLENY-GNTSAA
FABH_PORUM       VPIVIKNCLNDVNISIDEVDWFILHQANIRILEAIATRLSIPLSKMITNLENY-GNTSAA
FABH_PYRYE       VPTVIRQCLNNLNISIDEVDWFILHQANTRIIEAIASRLSVPFSKMITNLEHY-GNTSAA
FABH_GRATL       VPASIIKCLNALHLSIQDVNWLLLHQANKRILQAVANRLSVDNYKIISNLSKY-GNTSAA
FABH_RHOBA       FDESAKDVLRAANVSSDQLSLVVLHQANQRIIDSAVSDLNVPPEKVFVNLDKY-GNTSGA
FABH1_STRCO      MAKVAQQALDAAGISPDDLDVFIPHQANVRIIDSMVKTLKLPEHVTVARDIRTTGNTSAA
FABH_STRGA       MAKVAQQALDAAGVAAADLDVFIPHQANERIIDSMVKTLKLPESVTVARDVRTTGNTSAA
FABH_KOCRD       GARVAQEALDAAGLAPEDLAAFVPHQANMRIIDQMAKVLKLPESVIIARDIAEAGNTSAA
FABH_MYCA1       MGKVGQQAMDAAGVRPDEIDVFLPHQANSRINEILAKSLELRPDAVIANDIEHTGNTSAA
FABH_MYCPA       MGKVGQQAMDAAGVRPDEIDVFLPHQANSRINEILAKSLELRPDAVIANDIEHTGNTSAA
FABH_MYCMM       MGKVGQQAMDAAGVKPDEIDVFIPHQANSRINELLTKNLQLRPDAVIANDIEHTGNTSAA
FABH_MYCUA       MGKVGQQAMDAAGVKPDEIDVFIPHQANSRINELLTKNLQLRPDAVIANDIEHTGNTSAA
FABH_MYCTA       MGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAA
FABH_MYCTU       MGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAA
FABH_MYCBO       MGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAA
FABH_MYCBP       MGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAA
FABH_MYCBT       MGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAA
FABH_MYCA9       MGKVGQRAMEAAKVGPEQIDVFVPHQANTRINELLAKNLHLRADAVIANDIEHTGNTSAA
FABH_STRLI       VVPAAREALEVAGLTVGDLVAFVPHQANLRIIDVLVDRLGVPEHVVVSRDAEDTGNTSSA
FABH2_STRAW      LPAIARRACERAGLTPADLAGVVLHQANLRIIEPLAAKIG-AVNAVVARDVVESGNTSAA
FABH4_STRCO      LPAIARQACERSGLEPADLAAVVLHQANLRIVEPLAAKIG-AVNAVVARDVVESGNTSAA
FABH2_STRCO      MAESARSTAAHAGWDLADVDAFVGHQANLRILTSVAKRLRLPPERV-VSNIADVANTAAA
FABH5_STRCO      MTSSAGALLDRTGWSPASVDRFVGHQANARILHAVADQLRIDGART-VIDLDRVGNTSAA
FABH3_STRCO      MGECAESVLDRAGWRVADVDWLVSHQANHRITARLADEIGIPRERS-VSNIAEVGNTAAA
FABH_PSEA8       MSDSVRRVLDRVGWQASDLHHLVPHQANTRILAAVADQLDLPVERV-VSNIAEVGNTVAA
FABH_PSEAB       MSDSVRRVLDRVGWQASDLHHLVPHQANTRILAAVADQLDLPVERV-VSNIAEVGNTVAA
FABH_PSEAE       MSDSVRRVLDRVGWQASDLHHLVPHQANTRILAAVADQLDLPVERV-VSNIAEVGNTVAA
FABH_LACBA       VPASLRRVLDQGHLAVTDVDYFILHQANQRIIERIAEDLTGSMAQFPVNIGQY-GNTAAA
FABH_LACH4       VPESINDALKQANLTADEVDCFVLHQANRRIVERIADELAVSMAKFPINIDEY-GNTAAA
FABH2_LACPL      VPHSIEQALMQARLESSDIKAFVLHQANARIVKSVGQKLNLATEQLPMNIAQY-GNTAAA
FABH_OENOB       VAASIKRTFEKISADIGDTDYFLLHQANQRIIDKVADLLKQPADRFLSNLSKY-GNTSAA
FABH_LACDA       VPEVITACLEEAGVGLAEVDLFLLHQANYRIVKQVARRLDLPEEKFPCNIAEY-GNTSAA
FABH_LACDB       VPEVITACLEEAGVGLAEVDLFLFHQANYRIVKQVARRLDLPEEKFPCNIAEY-GNTSAA
FABH_LACRD       VPRSIASAVQQANLKLDDIDYFLLHQANERIINQIAKRLGQPITKFPMNISEY-GNTGAA
FABH_LACRJ       VPRSIASAVQQANLKLDDIDYFLLHQANERIINQIAKRLGQPITKFPMNISEY-GNTGAA
FABH_LACSS       VPKAIEAAVLEAGLTLDQIDHFLVHQANSRLITKMASMLDQPLTKFPMNLQHY-GNTSAA
FABH_LACLM       VPKNIQATLEKSDLAAEEIDYYLLHQANSRILDKMAKKLGVTRDKFLQNMQEY-GNTSAA
FABH_LACLS       VPKNIQATLEKSDLAAEEIDYYLLHQANSRILDKMAKKLGVTRNKFLQNMQEY-GNTSAA
FABH_LACLA       VPKNIQATLEKANLSAEEVDYYLLHQANSRILDKMAKKLGVTRQKFLQNMQEY-GNTSAA
FABH_STRA1       VSKSINHLIETSYLEKEDIDYLFLHQANRRILDKMSRKIDIARDKFPENMMDY-GNTSAA
FABH_STRA3       VSKSINHLIETSYLEKEDIDYLFLHQANRRILDKMSRKIDIARDKFPENMMDY-GNTSAA
FABH_STRA5       VSKSINHLIETSYLEKEDIDYLFLHQANRRILDKMSRKIDIARDKFPENMMDY-GNTSAA
FABH_STRE4       VSRSITAIIEQSGLAKEELDYLLLHQANRRILDKMAKKIGMPREKFLENMMHY-GNTSAA
FABH_STRS7       VSRSITAIIEQSGLAKEELDYLLLHQANRRILDKMAKKIGMPREKFLENMMHY-GNTSAA
FABH_STREM       VSRSIAAIIEQSGLAKEELDYLLLHQANRRILDKMAKKIGMPREKFLENMMHY-GNTSAA
FABH_STRP1       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPG       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRP3       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPM       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRP8       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPQ       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPB       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPC       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPD       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPRGKFLENMMRY-GNTSAA
FABH_STRP6       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPZ       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRPF       VSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRY-GNTSAA
FABH_STRU0       VSKSIISLLEESSVTAEEIDYFLLHQANRRILDKMARKIGCPRDKFLENMMTY-GNTSAA
FABH_STRGC       VAQSIKDTIEASPLEVDEIDYFLLHQANDRILNKIAKKLSVSRDKIPANMMEY-GNTSAA
FABH_STRSV       VARSIKETIESSQLSAEDLDFLLLHQANIRILDKMAKKLGVAREKLPANMMEY-GNTSAA
FABH_STRP7       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRPS       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRP2       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRPI       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRR6       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRPJ       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRPN       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRZJ       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRZT       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRP4       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRZP       VAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEY-GNTSAA
FABH_STRMU       VSKSISMLIRKSDMPVEAIDYFLLHQANIRILDKMAKKIGADREKFPANMMKY-GNTSAA
FABH_STRT1       VSKSIKALVEE----KGEPDYFLLHQANIRILDTMAKKIDVSRDKFLANMMSY-GNTSAA
FABH_STRTD       VSKSIKALVEE----KGEPDYFLLHQANIRILDTMAKKIDVSRDKFLANMMSY-GNTSAA
FABH_STRT2       VSKSIKALVEE----KGEPDYFLLHQANIRILDTMAKKIDVSRDKFLANMMSY-GNTSAA
FABH_STRS2       VTATMAELLEQADMTVDCVDYFLLHQANIRILDKMARKLGVAREKFPANMDKY-GNTSAA
FABH_STRSY       VTATMAELLEQADMTVDCVDYFLLHQANIRILDKMARKLGVAREKFPANMDKY-GNTSAA
FABH_ENTFA       VSQNILSLVTD-----ETVDYLLLHQANVRIIDKIARKTKISREKFLTNMDKY-GNTSAA
FABH1_LACPL      VPEQMRGLIASAQLTPSDLQYVICHQANLRIIEKIAANLALPMTKFPHNVDHY-GNTSSA
                                       . *.** *:                       .*    

FABH1_BACAN      SIPIAMVEELQNGRIQDG--DLIILVGFGGGLTWGAVALRWGK-----------------
FABH1_BACCR      SIPIAMVEELQNGRIQDG--DLIILVGFGGGLTWGAVALRWGK-----------------
FABH1_BACSU      SIPISLVEELEAGKIKDG--DVVVMVGFGGGLTWGAIAIRWGR-----------------
FABH_BACP2       SIPISLCEEIEAGKIHDG--DVIVMVGFGGGLTWGAIAMRWGR-----------------
FABH_GEOKA       SIPISLVEELEAGKIHDD--DLIIMVGFGGGLTWGAIALRWGR-----------------
FABH1_BACHD      SIPMAMVDELKDGKIKDG--DLLVLVGFGAGLVWGSLALRWGR-----------------
FABH_OCEIH       SIPMALSEAVKEGKIKDN--DLIVLVGFGGGLTWGAVALRWGK-----------------
FABH_LISIN       SIALALVDAVEEGRIKDN--DNVLLVGFGGGLTWGALIIRWGK-----------------
FABH_LISW6       SIALALVDAVEEGRIKDN--DNVLLVGFGGGLTWGALIIRWGK-----------------
FABH_LISMF       SIALALVDAVEEGRIKDN--DNVLLVGFGGGLTWGALIIRWGK-----------------
FABH_LISMO       SIALALVDAVEEGRIKDN--DNVLLVGFGGGLTWGALIIRWGK-----------------
FABH1_STAES      SIPLSINQELQNGKIKDD--DTLVLVGFGGGLTWGAIVIKWGK-----------------
FABH_STAEQ       SIPLSINQELQNGKIKDD--DTLVLVGFGGGLTWGAIVIKWGK-----------------
FABH_STAAM       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAN       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAR       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAA9       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAB       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAA1       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAA2       SIPLSIDQELKNGKLKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAA3       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAE       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAA8       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAC       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAW       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAS       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAAT       SIPLSIDQELKNGKIKDD--DTIVLVGFGGGLTWGAMTIKWGK-----------------
FABH_STAHJ       SIPLSISQELENGRIKDD--DTLVLVGFGGGLTWGAMVIKWGK-----------------
FABH_STAS1       SIPLSIGQELENGRIKDD--DVLVLVGFGGGLTWGAVTLRWGK-----------------
FABH_DEIDV       TVPLVLREGLDDGRIRDG--QQLLLIAFGGGLSWVAGTMKWWGGAPSLQP--DRAAEHSA
FABH_DEIGD       SLPLALREAVDDGRIQDG--QQLLLVAFGGGLSWGACTVKWWAGAPSLTA--AQQAEVTA
FABH1_DEIRA      TVPLALYEAVNDGRIQGG--QQLLMVVFGGGLSWAACTMKWWGGRPSLHAQVAQPAEVPA
FABH2_DEIRA      SIPLALAEAQAQGRFKDG--DQLLLAGFGGGLSWGAAALKWWSGPTGKQSS---------
FABH2_BACAN      SIPLALDLARKKGKLNNG--DTLLLYGFGGGLTHLGLIVEWDLS----------------
FABH2_BACCR      TIPLALNLAIKEGKLNNG--DTLLLYGFGGGLTHLGLIVEWNLI----------------
FABH2_BACSU      SIVLALDLAVKAGKLKKD--QIVLLFGFGGGLTYTGLLIKWGM-----------------
FABH2_BACHD      TIPLALDIGVREGKLKHG--DNVLLYGFGGGLAHAGLILRWTVPTEKN------------
FABH2_STAES      TIPLSIDLAIKEGKIKKD--DLILLVGFGGGLAYASTLIRWTI-----------------
FABH_ACHLI       SIPFLLDEHKTNNPEVK----RVILVGFGGGFTWGAAILNV-------------------
FABH_FUSNN       SVGIALGEAIEKGLVKKG--DNIALTGFGGGLTYGSTIIKWAY-----------------
FABH_CLOAB       TIPLAIDEMNKKGLLKRG--AKIVVVGFGGGLTWGSMVLKWTK-----------------
FABH_CLONN       SIPIALDEMNEKNMLKKG--DKIILVGFGGGLTFGAHLIQWN------------------
FABH_CLOB1       SIPIALDEMNKRGLLNKQ--DKIILVGFGGGLTFGGVAIVWSI-----------------
FABH_CLOBH       SIPIALDEMNKRGLLNKQ--DKIILVGFGGGLTFGGVAIVWSI-----------------
FABH_CLOBJ       SIPIALDEMNKRGLLNKK--DKIILVGFGGGLTFGGVAIVWSI-----------------
FABH_CLOBL       SIPIALDEMNKRGLLNKQ--DKIILVGFGGGLTFGGVAIVWSI-----------------
FABH_CLOBM       SIPIALDEMNKRGLLNKQ--DKIILVGFGGGLTFGGAAIVWSI-----------------
FABH_CLOB6       SIPIALDEMNKKGLLNKQ--DKIILVGFGGGLTFGGVAIVWSI-----------------
FABH_CLOBK       SIPIALDEMNKKGLLNKQ--DKIILVGFGGGLTFGGVAILWSI-----------------
FABH_CLOK1       SVGIALDEVYKKNLVEKG--DKVLIIGFGGGLTYGGLLINVI------------------
FABH_CLOK5       SVGIALDEVYKKNLVEKG--DKVLIIGFGGGLTYGGLLINVI------------------
FABH_CLOTE       SIPIALAEVDEKGLLKKG--DNVILVGFGAGLTWAASLIKWI------------------
FABH_CLOB8       TVPIALNEMYEKGLLNKG--DKIILVAFGGGLTYAATLLEW-------------------
FABH_CLOP1       SIPIALCESINEGNLKKG--DNIIMVGFGGGLTWGAALIKL-------------------
FABH_CLOPE       SIPIALCESIDEGNLKKG--DNIIMVGFGGGLTWGAALIKL-------------------
FABH_CLOPS       SIPIALCESINEGNLKKG--DNIIMVGFGGGLTWGAALIKL-------------------
FABH_CLOD6       SIPVALDEAYREGKIKKG--DNVVLVGFGGGLTWGASVVKWTL-----------------
FABH_CALS4       SVAIALDEAYRKGLIKKG--DIILTVAFGAGLTWASSVIKWSK-----------------
FABH_DESHD       SIPVALDEAARSGRLNYG--DIMVMVGFGGGLTWGAAVVKWSKRGV--------------
FABH_DESHY       SIPVALDEAARSGRLNYG--DIMVMVGFGGGLTWGAAVVKWSKRGV--------------
FABH_SYMTH       SIPVALTEALTEGRVRDG--DLVVCVSFGAGLVWGALALRWGR-----------------
FABH_NATTJ       SIPVALDEAIEENLIKED--DLVALVGFGGGLTWGSCLIKW-------------------
FABH_SYNWW       CIPVGLSMAEEAGKLKKG--DLVLMVAFGAGLSYGGILLRWGRDQDVF------------
FABH_CALS8       SIPIALDEAVEEGRIKKG--DKVVLVGFGGGLTWASTVIKWV------------------
FABH_CHLCV       SVCIALDELLQLHVINSG--EYLLLVAFGGGLSWGAVVLRQVEG----------------
FABH_CHLPN       SVGIALDELVHTESIKLD--DYLLLVAFGGGLSWGAVVLKQV------------------
FABH_CHLTA       SVGIALDELLRTHDIHVA--ERLLLVAFGGGLSWGAVILQQV------------------
FABH_CHLTR       SVGIALDELLRTHDIHVA--ERLLLVAFGGGLSWGAVILQQV------------------
FABH_CHLMU       SVGIALDELLRTHDIHSK--ERLLLVAFGGGLSWGAVILQQM------------------
FABH_DESPS       SVPIALDEAVRGGKIESG--DLVLLCSFGGGFTWGASLIRW-------------------
FABH_DESVH       SIPLALADARAQGRIRPG--MRVLLTTFGGGFTWGAALLRF-------------------
FABH_DESVV       SIPLALADARAQGRIRPG--MRVLLTTFGGGFTWGAALLRF-------------------
FABH_DESVM       SVPLAIADARAKGVLRPG--MRVLLATFGGGFTWGAALLHF-------------------
FABH_DESAG       SVPLALADADSKNLLPPG--RTVLLTTFGGGFTWGAVLLRT-------------------
FABH_ROSCS       SIPIALVEAVEQQRLRKG--DYALLTSFGGGLTWASAVIRWSAG----------------
FABH_ROSS1       SVPIALVEAVEQQRLRKG--DYALLTAFGGGLTWASAVIRWTA-----------------
FABH_RUBXD       SIPLSYPDIFD--GLEPG--KYIITVGFGFGLTWAANLYRI-------------------
FABH1_VIBVU      TVPTALDEAVRDGRIQRG--QTLLLEAFGGGFTWGSALVRF-------------------
FABH1_VIBVY      TVPTALDEAVRDGRIQRG--QTLLLEAFGGGFTWGSALVRF-------------------
FABH1_VIBPA      TVPTALDEAVRDGRIKRG--QTLLLEAFGGGFTWGSALVKF-------------------
FABH1_VIBCH      TVPTALDEAVRDGRIQRG--QMLLLEAFGGGFTWGSALVKF-------------------
FABH_ALIF1       TVPTALDEAVRDGRIQRG--QTLLLEAFGGGFTWGSALVKF-------------------
FABH_PSEA6       TVPTALDEAIRDGRIKRG--QNLLLEAFGGGFAWASALVRY-------------------
FABH_SHEON       SVPIALDEAVRDGRIQRG--QLLLLEAFGAGFAWGSALVRF-------------------
FABH_PSYIN       SVPLALDEGVRSGKIKPG--QLILLEAFGGGFTWGSALVRM-------------------
FABH_ACTP2       TVPVALDEAVRDGRIQRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_HAEDU       TVPVALDEAVRDGRIQRG--QLLLLEAFGGGWTWGSGLVRF-------------------
FABH_HAEI8       TVPVALDEAIRDGRIQRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_HAEIG       TVPVALDEAIRDGRIQRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_HAEIN       TVPVALDEAIRDGRIQRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_ACTSZ       SVPISLDEAVRDGRIRRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_HAES1       TVPVALDEAVRDGRIKRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_HISS2       TVPVALDEAVRDGRIKRG--QLLLLEAFGGGWTWGSALVRF-------------------
FABH_PASMU       SIPSALDEAVRDGRIQRG--QLLLLEAFGGGLTWGSALVRF-------------------
FABH_BAUCH       SIPLALDEAVRDGRIKTD--QLLLLEAFGGGLTWGSALLRF-------------------
FABH_SODGM       SVPLALDEAVRDGRIQPG--HLVLLEAFGGGFTWGSALLRF-------------------
FABH_BLOFL       SIPLALDEAVRDGRIKSN--QLLLLEAFGAGLTWGSVLLRF-------------------
FABH_BLOPB       SVPLALDEAVRDGRIKSG--QLVLLEAFGAGFTWGSALLRF-------------------
FABH_SALCH       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_SALPB       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_SALTY       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_SALTI       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_SALPA       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_SALAR       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALIRF-------------------
FABH_CITK8       SVPCALDEAVRDGRIKAG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECO24       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SHISS       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECO57       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOLI       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOUT       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOK1       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOL5       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOL6       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SHIBS       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SHIF8       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SHIFL       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOHS       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_ECOLC       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SHIDS       SVPCALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSVLVRF-------------------
FABH_KLEP7       SVPCALDEAVRDGRIQRG--QLILLEAFGGGFTWGSALVRF-------------------
FABH_ENT38       SVPCAFDEAVRDGRIKRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_CROS8       SVPCALDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERP3       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERPS       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERPA       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERPE       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERPN       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERPP       SVPSAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_YERE8       SVPAAFDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_SERP5       SVPAALDEAVRDGRIQRG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_PECAS       SVPSALDEAVRDGRIKPG--QLVLLEAFGGGFTWGSALVRF-------------------
FABH_PHOLL       SVPTAFDEAVRDGRIKRG--QLILIEAFGGGLTWGSALIRF-------------------
FABH_MARHV       SIPLALDEAVRDGRIQRG--QVVLLEAFGGGFTWGSALLRY-------------------
FABH_THISH       SIPLALDVAVRDGRVRPG--DLLMMEAFGGGFTWGSALLRF-------------------
FABH_ALKEH       SIPMALDTAIRDGRIKRG--DLLLLEAFGGGFTWGSALIRY-------------------
FABH_XANAC       SVPLALDEAVRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_XANC5       SVPLALDEAVRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_XANOM       SVPLALDEAVRSGRVQRG--QLLLLEAFGGGFAWGSALLRY-------------------
FABH_XANC8       SVLLALDEAVRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_XANCP       SVPLALDEAVRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_XYLFA       SVPLALDEAIRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_XYLFT       SVPLALDEAIRSGRVQRG--QLLLLEAFGGGFTWGSALLRY-------------------
FABH_METCA       SIPLAFDEAVRDGRIKRG--QTVLMEAFGGGFAWGSALLRY-------------------
FABH_THIDA       SVPLAFDAAVRDGRIKRG--QIVLMEAFGGGFTWGSALLRY-------------------
FABH_ACIET       SIPLALDHGVRNGQVQPG--QTVLLEGVGGGFTWGAVLLKM-------------------
FABH_ACISJ       SIPLALDHGVRNGQVQPG--QTVLLEGVGGGFTWGAVLLKM-------------------
FABH_DELAS       SIPLALDHGVRNGQVKPG--QTVLLEGVGGGFTWGAVLLKM-------------------
FABH_ACIAC       SIPLALDHAVRSGQARPG--QNLLLEGVGGGFTWGAVLLTL-------------------
FABH_VEREI       SIPLALDHAVRMGRVKPG--QTLLLQAVGGGFTWGAVLLKL-------------------
FABH_POLNA       SIPLALDEAVRSGKVKKG--DILMLEGVGGGFTWGAVLLKY-------------------
FABH_POLSJ       SIPLALDASVRSGKVKKG--DTLMLEGVGGGFTWGAVLLNY-------------------
FABH_VARPS       SIPLALDEAVRSGKVKKG--ETVMLEGVGGGFTWGAVLLNL-------------------
FABH_RHOFT       SIPLALDAAVRSGKVKAG--ELLLLEGVGGGFTWGAVLLNL-------------------
FABH_BURCC       SIPLALDAAVRDGRIQRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURCH       SIPLALDAAVRDGRIQRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURCA       SIPLALDAAVRDGRIQRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURL3       SIPLAFDTAVRDGRIQRG--QHVLIEGVGGGFTWGASVFRY-------------------
FABH_BURVG       SIPMALDVAVRDGRIQRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURM7       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURM9       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURMA       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURMS       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURP1       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURPS       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURP6       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURP0       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRF-------------------
FABH_BURTA       SIPLALDVAVRDGRIKRG--QHVLIEGVGGGFTWGASVFRY-------------------
FABH_PARP8       SIPLALDVAVRDGRIQRG--HNVLIEGVGGGFTWGASVIRY-------------------
FABH_CUPNH       SIPLALDVAVRDGRIRAG--QTVLMEGVGGGFTWGAVLLRM-------------------
FABH_CUPTR       SIPLALDVAVRDGRIRPG--HTVLMEGVGGGFTWGAVLLRM-------------------
FABH_CUPPJ       SIPLALDAAVRDGRIRPG--QTVLMEGVGGGFTWGAALLRM-------------------
FABH_RALPJ       SIPLALDVAVRDGRIQRG--QHVMLEGVGGGFTWGAALLRF-------------------
FABH_RALSO       SIPLALDAAVRDGRIQKG--HHVLLEGVGGGFTWGAALLRF-------------------
FABH_HERAR       SIPMALDVGVRDGRIKPG--QNVMMEGVGGGFTWGAVLARM-------------------
FABH_JANMA       SIPMALDVGVRDGRIKPG--QNVMMEGVGGGFTWGAVLARM-------------------
FABH_POLNS       SIPLALDSGVRSGQIKRG--QHLLLEGVGGGFAWGAVAIKY-------------------
FABH_POLAQ       SIPLALDCGIRSGQIQRG--QHLLLEGVGGGFAWGAVALKY-------------------
FABH_AROAE       SIPLALDLAVRDGRIRPG--HRFIIEGVGGGFTWGAALLQF-------------------
FABH_AZOSB       SIPLALDLAVRDGRIRPG--QRVVVEGVGGGFTWGAALIDF-------------------
FABH_BORBR       SVPLALDVARRDGRVKPG--QLVLMQGVGGGFTWGSVLARM-------------------
FABH_BORPA       SVPLALDVARRDGRVKPG--QLVLMQGVGGGFTWGSVLARM-------------------
FABH_BORPE       SVPLALDVARRDGRVKPG--QLVLMQGVGGGFTWGSVLARM-------------------
FABH_BORPD       SVPLALDAARRDGRIKPG--QLVLMQGVGGGFTWGSVLARM-------------------
FABH_BORA1       SVPLALDAARRDGRIKPG--QHVLMQGVGGGFTWGSVLARM-------------------
FABH_CHRVO       SIPLALDVAVRDGRIRRG--QTVMLEGIGGGFAWGAVLLTF-------------------
FABH_LARHH       SVPLALDAAVRDGRIRRG--ELLLLEGIGGGFAWGSALLHY-------------------
FABH_NEIG1       SIPLALDAGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NEIG2       SIPLALDAGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NEIM0       SIPLALDTGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NEIMF       SIPLALDTGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NEIMB       SIPLALDTGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NEIMA       SIPLALDTGIRSGQIKRG--QNLLLEGIGGGFAWGAVLLQY-------------------
FABH_NITEC       SVPLALDQAVRDGRVQSG--QHVVLEGVGGGFTWGSVLVRW-------------------
FABH_NITEU       SVPLALDQAVRDGRIQPD--QHIVLEGVGGGFTWGSVLVRW-------------------
FABH_NITMU       SIPLALDIAARDGRIKSG--QHVLLEGVGGGFTWGAALIRW-------------------
FABH_VESOH       SIPLALDTAVRDGRIKRG--DHLLFEGIGAGFSWGSILIQF-------------------
FABH_DICNV       SVPLALDYGVQNGIIKRG--DNLLLEAFGGGFTWGGCILTY-------------------
FABH_COXB2       SIPLALDAAVRAGKIKRG--DTLLLEAFGAGLAWGAALLKL-------------------
FABH_COXBU       SIPLALDAAVRAGKIKRG--DTLLLEAFGAGLAWGAALLKL-------------------
FABH_COXBR       SIPLALDAAVRAGKIKRG--DTLLLEAFGAGLAWGAALLKL-------------------
FABH_COXBN       SIPLALDAAVRAGKIKRG--DTLLLEAFGAGLAWGAALLKL-------------------
FABH_COXB1       SIPLALDAAVRAGKIKRG--DTLLLEAFGAGLAWGAALLKL-------------------
FABH_ACICJ       SIPLALDEAVRDGRIRRG--HLVLIEALGGGLTWGSALIRF-------------------
FABH_GRABC       SIPLALNEAVQDGRIQPG--SVVLMEALGGGLTWGSAILRM-------------------
FABH_AGRFC       SIPLALAVAASDGRIKKG--DLVMLEAMGGGFTWGAVLLRW-------------------
FABH_RHIL3       SIPLALATAAGDGRIKKG--DLVMLEAMGGGFTWGAVLLRW-------------------
FABH_RHIME       SIPLALDAAASDGRIKKG--DLVMLEAMGGGFTWGSVLLRW-------------------
FABH_SINMW       SIPLALDAAATDGRIKRG--DLVMLEAMGGGFTWGSVLLRW-------------------
FABH_AGRRK       SIPLALAVAAGDGRIKRG--DLVMLEAMGGGFTWGAVLLRW-------------------
FABH_AGRVS       SIPLAISVAVADGRIKQG--DLVLLEAMGGGFTWGALLLRW-------------------
FABH_BRUA1       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUA2       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUAB       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUME       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUC2       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUSU       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUMB       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUO2       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_BRUSI       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_OCHA4       SVPLALATAVADGRIKKG--DLVLLEAMGGGFTWGAVLLRW-------------------
FABH_RHILO       SVPLALSVAVADGRIKKG--DLVLLEAMGGGFTWGAVLVRW-------------------
FABH_CHESB       SVPLALNHAVSQGKIQKG--DLVLLEAMGGGFTWGAVLLRW-------------------
FABH_BARHE       SVPLALTMAICDGKIKKG--DLVMLEAMGGGFTWGAILIRW-------------------
FABH_BARQU       SVPLALTTAICDGRIKKG--DLVMLEAMGGGFTWGAILIRW-------------------
FABH_BART1       SVPLALTTALCDGRIKRG--DLIMLEAMGGGFTWGAILIRW-------------------
FABH_BARBK       SVPLALATAVQDGRIKEG--DLVLLEAMGGGFTWGAVLIRW-------------------
FABH_BRASB       SIPLALDVAVKDGRIKKG--DVVLLEAMGGGFTWGSALVRW-------------------
FABH_BRASO       SIPLALDVAVKDGRIKKG--DVVLLEAMGGGFTWGSALVRW-------------------
FABH_BRADU       SIPLALAVARKDGRIKRG--DLILLEAMGGGFTWGSALVRW-------------------
FABH_ERYLH       SVPLAFDTAVRDGRIKPG--DLVMFEAMGGGFTWGASLVRY-------------------
FABH_NOVAD       SVPLAYDTAVRDGRIKPG--DLVMFEAMGGGFTWGASLARV-------------------
FABH_SPHAL       SVPLALDLAVRDGRIKRG--DLVVLEAMGGGFTWGAAVLRV-------------------
FABH_SPHWW       SVPLALDVAVRDGRIKPG--DLLVLEAMGGGFTWGAAAIRY-------------------
FABH_RHOCS       SIPLALCEAVHDGRVQRG--DIVLLEAMGGGFTWGAALVRW-------------------
FABH_RHORT       SVPLALCEARRDGRIQPG--QLILLEAMGGGFTWGSALVRL-------------------
FABH_MAGSA       SIPLALTEAVGDGRIKPG--QLVLLEAMGGGFTWGSALVRM-------------------
FABH_CAUVC       SIPLAFAHGIKDGRIKKG--DLLLLEAMGGGLTWGACVVRL-------------------
FABH_HYPNA       SIPLALDHVVRSGRAKPG--DLILSEAMGGGFSWGASLFRL-------------------
FABH_RHOS1       SIPLALSVGKARGQIKEG--DLLVTEAIGGGLAWGSVVLRW-------------------
FABH_RHOS4       SIPLALSVGKARGQIKEG--DLLVTEAIGGGLAWGSVVLRW-------------------
FABH_RHOS5       SIPLALSVGKARGQIKEG--DLLVTEAIGGGLAWGSVVLRW-------------------
FABH_RUEPO       SIPLALSVGKARGQIKTG--DLVVTEAIGGGLAWGAVVLRW-------------------
FABH_RUEST       SIPLALSVGVERGQIKPG--DLIVTEAIGGGLAWGAVVLRW-------------------
FABH_ROSDO       SIPLALSVGHARGQIKQG--DLVVTEAIGGGLAWGAVVLRW-------------------
FABH_DINSH       SIPMALSVGVARGQIKPG--DLVVTEAIGGGLSWGSVVLRW-------------------
FABH_JANSC       SIPLAMSVGVGDGRIQPG--HLLVTEAIGGGLAWGAVVMRW-------------------
FABH_PARDP       SIPLALSVANAEGRFKPG--DLLVAEAIGGGLAWGSVVLRW-------------------
FABH_RHOCA       SIPLALSTARARGQIKAG--DLIVTEAIGGGLAWGSVVLRW-------------------
FABH_EHRCJ       SIPLALYYARSSGKLKKH--DVAVLAAIGGGLTWGTCLVRI-------------------
FABH_EHRCR       SIPLALSYAKSSGKLKKH--DIAILAAIGGGFTWGTCLVRI-------------------
FABH_EHRRG       SIPLALSYAKNSGKLKQD--DLVILAAIGAGITWGVCLVRM-------------------
FABH_EHRRW       SIPLALSYAKNSGKLKQD--DLVVLAAIGAGITWGVCLVRM-------------------
FABH_WOLPM       SIPLALDYAIQESKIKSG--NLVLLISIGAGLTWGSVLLHY-------------------
FABH_WOLPP       SIPLALDYAIQESKIKSG--NLVLLISIGAGLTWGSVLLRY-------------------
FABH_WOLTR       SIPLALDYAIQKPKIKPG--SLGILVAIGAGLTWGSVLLRY-------------------
FABH_ANAMM       SIPLAMYEAKRAGRIKKG--NLVLFAAIGAGITWGVSLLRL-------------------
FABH_RICRO       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSAFIRW-------------------
FABH_RICRS       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSAFIRW-------------------
FABH_RICCN       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSAFIRW-------------------
FABH_RICM5       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSAFIRW-------------------
FABH_RICFE       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSALIRW-------------------
FABH_RICAH       SIPLALSTLKASGKIKKG--DILLFSAIGAGLTWGSALIRW-------------------
FABH_RICCK       SIPLALSTLKGLGKIKKG--DILLFSAIGAGLTWGSALIRW-------------------
FABH_RICPR       SIPLALSALKESGKIKKG--DILLFSAIGAGLTWGGALIRW-------------------
FABH_RICTY       SIPLALSTLKESGKIKKG--DILLFSAIGAGLTWGSALIRW-------------------
FABH_RICB8       SIPLALSTIKASGKIKKG--DIILFSAIGAGLTWGSALLRW-------------------
FABH_RICBR       SIPLALSTLKASGKIKKG--DIILFSAIGAGLTWGSALLRW-------------------
FABH_NEOSM       SIPITLAYMDSHGSIRKG--AKILFAAMGAGFTYGVTIFEY-------------------
FABH_AQUAE       SIPIALHEAIKEGKVKRG--DLILMTAMGGGLTWGAVLLRY-------------------
FABH_PERMH       SIPIAFYEAWKEGKIDKG--DHILLTAFGGGLTWGAIVLKF-------------------
FABH_SULDN       SIPMAINDIYESGKLKAG--ELMLLDAFGGGLTWGSALVPFSPLK---------------
FABH_SULNB       SIPMAINEIWESGRLKTG--DLMLLDTFGGGLTWASALLPFAGESVQR------------
FABH_ARCB4       SIPMAMNYAFEQGKIKAG--DTILFDAFGGGLTWGSALFKFAPIKR--------------
FABH_HELP2       SIPMAMGEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGG-----------------
FABH_HELPG       SIPMAMGEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGG-----------------
FABH_HELPY       SIPMAMGEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGGS----------------
FABH_HELPS       SIPMAMCEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGGS----------------
FABH_HELPJ       SIPMAMCEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGGI----------------
FABH_HELPH       SIPMAMCEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGG-----------------
FABH_HELAH       SIPMAMGEAYEEGRLKKG--DLMLLDAFGGGLTWGSALVYFGGS----------------
FABH_HELHP       SIPMAMNDLYEEKKLKYG--DLMLLDALGGGLTWGSALVHFGGTN---------------
FABH_CAMC1       SIPMAINDAYEDGRIKNG--SVLLLDAFGGGFTWGSAILKFGGRNFSDL-----------
FABH_CAMC5       SIPMAINDAYESGRIKNG--STLLLDAFGGGFTWGSAILKFGGKNFYQI-----------
FABH_CAMFF       SIPMAMNDAYEDGRLKQG--SLILLDAFGGGFTWGSALLRFGGK----------------
FABH_CAMHC       SIPIALNEAYENGRLKNG--SLILLDAFGGGFTWGSALIRFGL-----------------
FABH_CAMJE       SIPMAMNDAYEEGRLKKG--NLILLDAFGGGFTWGSALLKFGGENF--------------
FABH_CAMJJ       SIPMAMNDAYEEGRLKKG--NLILLDAFGGGFTWGSALLKFGGENF--------------
FABH_CAMJ8       SIPMAMNDAYEEGRLKKG--DLILLDAFGGGFTWGSALLKFGGENF--------------
FABH_CAMJR       SIPMAMNDAYEEGRLKKG--NLILLDAFGGGFTWGSALLKFGGENF--------------
FABH_CAMJD       SIPMAMNDAYEEGRLKKG--NLILLDAFGGGFTWGSALLKFGGENF--------------
FABH2_BACTN      TLPLCIWDF--EDKLKKG--DNIIFTAFGAGFTWGAVYVKWGYDGKKES-----------
FABH_BACV8       TLPLCLWDY--EKQLKKG--DNLIFTAFGAGFTYGAVYVKWGYDGSKR------------
FABH1_BACTN      TLPLCIWDF--EKKLKKG--DNLIFTAFGAGFAWGAVYVKWGYDPKEDA-----------
FABH_PARD8       TIPICLWEW--ENQLKKG--DNLILAAFGAGFTWGAVYLKWGYDGKKA------------
FABH_PORG3       TIPICLWEW--EHKLKKG--DVLVMTSFGAGFTWGAVYVKWAYDGSTVR-----------
FABH_PORGI       TIPICLWEW--EHKLKKG--DVLVMTSFGAGFTWGAVYVKWAYDGSTVR-----------
FABH_AZOPC       SIPLCLCEW--ESKLHKG--DKMIFTAFGAGFTWGATYLKWGYDSH--------------
FABH_PELLD       TIPICLSELDDGGHLEHG--SNLVLVSFGAGYTWGGVYVKWQ------------------
FABH_CHLPM       TIPICLAELDEENKLHPG--SNLVLCSFGAGYTWGGVYVKWQ------------------
FABH_CHLCH       TIPICLAELDANNKLKHG--DNLVLVSFGAGYTWGGIYVKWQ------------------
FABH_CHLPD       TIPICLAELNEQEQLKTG--SNLVLVSFGAGYTWGGIYIKWQ------------------
FABH_CHLTE       TVPICLAELDEQGKLHKG--SNLVLVSFGAGYTWGGVYVRWQ------------------
FABH_KORVE       TIPLAMQTALDEGKLKKG--SNVLLAAVGAGFTSGATLLRWAF-----------------
FABH_SOLUE       TLPLATRDAISEGRLKKG--DLVLFAAVGAGYTVGASLWRWAF-----------------
FABH2_VIBVU      TVPIALCEAVEQGHIKAG--DNILLAAFGAGLTWGAGLVKWGQRVEAISESDAALPECDK
FABH2_VIBVY      TVPIALCEAVEQGHIKAG--DNILLAAFGAGLTWGAGLVKWGQRVEAISESDAALPECDK
FABH2_VIBPA      TVPIALCEAVEQGRVNPG--DNMLLAAFGAGLTWGAAVLKWGDRVTPIGESDAALPECEQ
FABH2_VIBCH      TVPIALCEALEQGKIKPH--DDLLVAAFGAGLTWGAGHIRWGERITPLGKSDAQLPSCDH
FABH_PSET1       TIAIALCEAVEQGLIKPH--SNIMSAAFGAGLTWAASYIKWGERVTPISVSDAQLPPCDK
FABH_TRIV2       SIPLALDEAVREGKIKPN--DIIATSGFGAGLTWGAAIFQWGR-----------------
FABH_NOSS1       SIPLALDEAVREGKIKPN--DIIATSGFGAGLTWGAAIFQWGR-----------------
FABH_TRIEI       SIPLALDEVVREGLVKSG--DIIAASGFGAGLSWGAVIFQWN------------------
FABH_ACAM1       TIPLALDATVRKGHIKPG--DTIAASGFGAGLSWGAAIFQWQR-----------------
FABH_SYNE7       TIPLVLDEAVKAGKIQSG--DLIAASGFGAGLSWGAALFRWGTVV---------------
FABH_SYNP6       TIPLVLDEAVKAGKIQSG--DLIAASGFGAGLSWGAALFRWGTVV---------------
FABH_MICAN       SIPLALDEAVRSGKVKKG--DIIASSGFGAGLTWGGIIFRWGD-----------------
FABH_SYNY3       SIPLALDQAVREGKIKEG--DLIALAGFGAGLTWAASIVRW-------------------
FABH_THEEB       SIPLALSKPIQQGHIQPG--DLIATAGFGAGLTWGAALFRWQ------------------
FABH_GLOVI       SVPLILQEWVQDGRIRAG--DRVVLAGFGAGLSWGVLLARWGRL----------------
FABH_PROM0       TIPLVIDEAIRSNRIKQN--DIIATSGFGAGLSWGAALIKWG------------------
FABH_PROM9       TIPLVMDEAIRNNRIKQN--DIIATSGFGAGLSWGAALIKWG------------------
FABH_PROM2       TIPLMIDEAIRNHSIKQN--DIIATSGFGAGLSWGAALIKWG------------------
FABH_PROM5       TIPLMLDEAIRNKKIKEN--DIIATSGFGAGLSWGAALIRWG------------------
FABH_PROMP       TIPLMLDEAIRNKKIKEN--DIIATSGFGAGLSWGAALIRWG------------------
FABH_PROMA       TIPIMLDEAVRDGKVQSG--HLIASSGFGAGLSWGVALFRWHGPF---------------
FABH_PROMT       TIPLMLDEAVRDKRIKSG--DLIACSGFGAGLSWGAALFYWHGPY---------------
FABH_PROMM       TIPLMLDEAVQDGRIKPG--QLIASSGFGAGLSWGAALIRWHGPI---------------
FABH_SYNR3       TIPLMLHEAVSDGRIQSG--QLIASSGFGAGLSWGAALLRWDGPTS--------------
FABH_SYNPW       TIPLMLDEAVRDGRVSSG--DLLASSGFGAGLSWGAALLRWQGPT---------------
FABH_PORPU       SIPLALDEAIKEKKIQPG--QVVVLAGFGAGLTWGAIVLKWQ------------------
FABH_PORUM       SIPLALDEAIKEKKIQPG--QVVVLAGFGAGLTWGAIVLKWQ------------------
FABH_PYRYE       SIPLALDEAIQSNKIQPG--QIIVLSGFGAGLTWGAIVLKW-------------------
FABH_GRATL       SIPLALDEAWQNNQIAKE--DIIVISGFGAGLTWGTVVIKWKC-----------------
FABH_RHOBA       SIPLALDEAARAGRLKEG--DLVLLCGFGAGLAWGTALFRW-------------------
FABH1_STRCO      SIPLAMERLLATGDARSG--DTALVIGFGAGLVYAATVVTLP------------------
FABH_STRGA       SIPLAMERLLATGEAKSG--DTALVIGFGAGLVYAASVVTLP------------------
FABH_KOCRD       SIPLATHRLLAEHPELSG--KPSLQIGFGAGLVYGAQVVLLP------------------
FABH_MYCA1       SIPLAMAEVLATGAAKAG--DLALLIGYGAGLSYAAQVVRLPPG----------------
FABH_MYCPA       SIPLAMAEVLATGAAKAG--DLALLIGYGAGLSYTAQVVRLPPG----------------
FABH_MYCMM       SIPLAMAELLATGAAKPG--DLALLIGYGAGLSYAAQVVRMPNS----------------
FABH_MYCUA       SIPLAMAELLATGAAKPG--DLALLIGYGAGLSYAAQVVRMPNS----------------
FABH_MYCTA       SIPLAMAELLTTGAAKPG--DLALLIGYGAGLSYAAQVVRMPKG----------------
FABH_MYCTU       SIPLAMAELLTTGAAKPG--DLALLIGYGAGLSYAAQVVRMPKG----------------
FABH_MYCBO       SIPLAMAELLTTGAAKPG--DLALLIGYGAGLSYAAQVVRMPKG----------------
FABH_MYCBP       SIPLAMAELLTTGAAKPG--DLALLIGYGAGLSYAAQVVRMPKG----------------
FABH_MYCBT       SIPLAMAELLTTGAAKPG--DLALLIGYGAGLSYAAQVVRMPKG----------------
FABH_MYCA9       SVPLAMETLLSTGAAKPG--DLALLIGYGAGLSYAAQVVRMPPVPFE-------------
FABH_STRLI       SVALALDRLVRSGAVPGG--GPALMIGFGAGLSYAGQALLLPDPPSTPA-----------
FABH2_STRAW      SIPLAFSKLVERGEISTG--DPVLLFGFGGNLSYAGQVIRCP------------------
FABH4_STRCO      SIPLALSKLAERGEITTG--DPALLFGFGGNLSYAGQVVRCP------------------
FABH2_STRCO      SIPLALADAAAQGRIGSG--DRLLLTAFGGGLTWGSAAVVWSGAEPVQDQRS--------
FABH5_STRCO      SIPLALSRACGEGLLSPG--DRVLLSAFGGGLTWGSTALLWPDITAL-------------
FABH3_STRCO      SIPLALDHAHARGTLRPG--DRVLLTAFGGGLTWGAAALTWPAVDPV-------------
FABH_PSEA8       SIPLALAHGLRQGILRDG--GNMVLTGFGAGLTWGSVALRWPKIVPTMD-----------
FABH_PSEAB       SIPLALAHGLRQGILRDG--GNMVLTGFGAGLTWGSVALRWPKIVPTMD-----------
FABH_PSEAE       SIPLALAHGLRQGILRDG--GNMVLTGFGAGLTWGSVALRWPKIVPTMD-----------
FABH_LACBA       SEPLLLNQLVTSHVIKRG--DVLALSGFGGGLTIGTMILRY-------------------
FABH_LACH4       SEPILLDQLVKQKIIKRG--DVIALSGFGGGLTVGTMIMKY-------------------
FABH2_LACPL      SEPILFAEMVAQKQVQRG--DKLVFTGFGGGLSVGSAVIEY-------------------
FABH_OENOB       SIPLLLDEMVTGNIVKSG--QLLTLSGFGAGLSVGSIVYKY-------------------
FABH_LACDA       SEAILLAELAEEGKAQAG--DLVVLAGFGGGLTAAAQLVRL-------------------
FABH_LACDB       SEAILLAELAEEGKAQAG--DLVVLAGFGGGLTAAAQLVRL-------------------
FABH_LACRD       SEPILLTQAVAHELVKPG--NIIAMSGFGGGLSTGTIILNY-------------------
FABH_LACRJ       SEPILLTQAVAHELVKPG--NIIAMSGFGGGLSTGTIILNY-------------------
FABH_LACSS       SIPLLLAEQVETNQIKRG--DLCVLCGFGGGLTIGIQIIRY-------------------
FABH_LACLM       SIPILLSESVKNGIFSLDGQTKVVLTGFGGGLTWGTAIINL-------------------
FABH_LACLS       SIPILLSESVKNGIFSLDGQTKVVLTGFGGGLTWGTAIINL-------------------
FABH_LACLA       SIPILLSESVKNGIFSLDGQTKVVLTGFGGGLTWGTAIINL-------------------
FABH_STRA1       SIPILLSESYENGLLKLDGNQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRA3       SIPILLSESYENGLLKLDGNQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRA5       SIPILLSESYENGLLKLDGNQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRE4       SIPILLSESVQNGQLKLDGSQHILLSGFGGGLTWGSLIVKI-------------------
FABH_STRS7       SIPILLSESVQNGQLKLDGSQHILLSGFGGGLTWGSLIVKI-------------------
FABH_STREM       SIPILLSESVQNGQLKLDGSQHILLSGFGGGLTWGSLIVKI-------------------
FABH_STRP1       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVRI-------------------
FABH_STRPG       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVRI-------------------
FABH_STRP3       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPM       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRP8       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPQ       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPB       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPC       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPD       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRP6       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPZ       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRPF       SIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVKI-------------------
FABH_STRU0       SIPILLSESVEKGLILLDGSQKVLLSGFGGGLTWGSLIVKI-------------------
FABH_STRGC       SIPILLSECVEQGLVKLDGSQKILLSGFGGGLTWGTLIVTI-------------------
FABH_STRSV       SIPILLSECVEQGLIKLNGNQTILMSGFGGGLTWGTLIVTI-------------------
FABH_STRP7       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRPS       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRP2       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRPI       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRR6       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRPJ       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRPN       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRZJ       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRZT       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRP4       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRZP       SIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI-------------------
FABH_STRMU       SIPILLAECVENGTIELNGSHTVLLSGFGGGLTWGSLIVKI-------------------
FABH_STRT1       SIPILLSENVANETLKLGSDQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRTD       SIPILLSENVANETLKLGSDQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRT2       SIPILLSENVANETLKLGSDQTILLSGFGGGLTWGSLIVKI-------------------
FABH_STRS2       SLPILLSECVESGMLRLDGSQTILMAGFGGGLTWGTLLLQL-------------------
FABH_STRSY       SLPILLSECVESGMLRLDGSQTILMAGFGGGLTWGTLLLQL-------------------
FABH_ENTFA       SIPILLDEAVENGTLILGSQQRVVLTGFGGGLTWGSLLLTL-------------------
FABH1_LACPL      GVAMALANVFDTL------TGPVLLTAFGGGLAYGSVLIKK-------------------
                                             * .                             

FABH1_BACAN      ---------------------
FABH1_BACCR      ---------------------
FABH1_BACSU      ---------------------
FABH_BACP2       ---------------------
FABH_GEOKA       ---------------------
FABH1_BACHD      ---------------------
FABH_OCEIH       ---------------------
FABH_LISIN       ---------------------
FABH_LISW6       ---------------------
FABH_LISMF       ---------------------
FABH_LISMO       ---------------------
FABH1_STAES      ---------------------
FABH_STAEQ       ---------------------
FABH_STAAM       ---------------------
FABH_STAAN       ---------------------
FABH_STAAR       ---------------------
FABH_STAA9       ---------------------
FABH_STAAB       ---------------------
FABH_STAA1       ---------------------
FABH_STAA2       ---------------------
FABH_STAA3       ---------------------
FABH_STAAE       ---------------------
FABH_STAA8       ---------------------
FABH_STAAC       ---------------------
FABH_STAAW       ---------------------
FABH_STAAS       ---------------------
FABH_STAAT       ---------------------
FABH_STAHJ       ---------------------
FABH_STAS1       ---------------------
FABH_DEIDV       GVQG-----------------
FABH_DEIGD       ---------------------
FABH1_DEIRA      ---------------------
FABH2_DEIRA      ---------------------
FABH2_BACAN      ---------------------
FABH2_BACCR      ---------------------
FABH2_BACSU      ---------------------
FABH2_BACHD      ---------------------
FABH2_STAES      ---------------------
FABH_ACHLI       ---------------------
FABH_FUSNN       ---------------------
FABH_CLOAB       ---------------------
FABH_CLONN       ---------------------
FABH_CLOB1       ---------------------
FABH_CLOBH       ---------------------
FABH_CLOBJ       ---------------------
FABH_CLOBL       ---------------------
FABH_CLOBM       ---------------------
FABH_CLOB6       ---------------------
FABH_CLOBK       ---------------------
FABH_CLOK1       ---------------------
FABH_CLOK5       ---------------------
FABH_CLOTE       ---------------------
FABH_CLOB8       ---------------------
FABH_CLOP1       ---------------------
FABH_CLOPE       ---------------------
FABH_CLOPS       ---------------------
FABH_CLOD6       ---------------------
FABH_CALS4       ---------------------
FABH_DESHD       ---------------------
FABH_DESHY       ---------------------
FABH_SYMTH       ---------------------
FABH_NATTJ       ---------------------
FABH_SYNWW       ---------------------
FABH_CALS8       ---------------------
FABH_CHLCV       ---------------------
FABH_CHLPN       ---------------------
FABH_CHLTA       ---------------------
FABH_CHLTR       ---------------------
FABH_CHLMU       ---------------------
FABH_DESPS       ---------------------
FABH_DESVH       ---------------------
FABH_DESVV       ---------------------
FABH_DESVM       ---------------------
FABH_DESAG       ---------------------
FABH_ROSCS       ---------------------
FABH_ROSS1       ---------------------
FABH_RUBXD       ---------------------
FABH1_VIBVU      ---------------------
FABH1_VIBVY      ---------------------
FABH1_VIBPA      ---------------------
FABH1_VIBCH      ---------------------
FABH_ALIF1       ---------------------
FABH_PSEA6       ---------------------
FABH_SHEON       ---------------------
FABH_PSYIN       ---------------------
FABH_ACTP2       ---------------------
FABH_HAEDU       ---------------------
FABH_HAEI8       ---------------------
FABH_HAEIG       ---------------------
FABH_HAEIN       ---------------------
FABH_ACTSZ       ---------------------
FABH_HAES1       ---------------------
FABH_HISS2       ---------------------
FABH_PASMU       ---------------------
FABH_BAUCH       ---------------------
FABH_SODGM       ---------------------
FABH_BLOFL       ---------------------
FABH_BLOPB       ---------------------
FABH_SALCH       ---------------------
FABH_SALPB       ---------------------
FABH_SALTY       ---------------------
FABH_SALTI       ---------------------
FABH_SALPA       ---------------------
FABH_SALAR       ---------------------
FABH_CITK8       ---------------------
FABH_ECO24       ---------------------
FABH_SHISS       ---------------------
FABH_ECO57       ---------------------
FABH_ECOLI       ---------------------
FABH_ECOUT       ---------------------
FABH_ECOK1       ---------------------
FABH_ECOL5       ---------------------
FABH_ECOL6       ---------------------
FABH_SHIBS       ---------------------
FABH_SHIF8       ---------------------
FABH_SHIFL       ---------------------
FABH_ECOHS       ---------------------
FABH_ECOLC       ---------------------
FABH_SHIDS       ---------------------
FABH_KLEP7       ---------------------
FABH_ENT38       ---------------------
FABH_CROS8       ---------------------
FABH_YERP3       ---------------------
FABH_YERPS       ---------------------
FABH_YERPA       ---------------------
FABH_YERPE       ---------------------
FABH_YERPN       ---------------------
FABH_YERPP       ---------------------
FABH_YERE8       ---------------------
FABH_SERP5       ---------------------
FABH_PECAS       ---------------------
FABH_PHOLL       ---------------------
FABH_MARHV       ---------------------
FABH_THISH       ---------------------
FABH_ALKEH       ---------------------
FABH_XANAC       ---------------------
FABH_XANC5       ---------------------
FABH_XANOM       ---------------------
FABH_XANC8       ---------------------
FABH_XANCP       ---------------------
FABH_XYLFA       ---------------------
FABH_XYLFT       ---------------------
FABH_METCA       ---------------------
FABH_THIDA       ---------------------
FABH_ACIET       ---------------------
FABH_ACISJ       ---------------------
FABH_DELAS       ---------------------
FABH_ACIAC       ---------------------
FABH_VEREI       ---------------------
FABH_POLNA       ---------------------
FABH_POLSJ       ---------------------
FABH_VARPS       ---------------------
FABH_RHOFT       ---------------------
FABH_BURCC       ---------------------
FABH_BURCH       ---------------------
FABH_BURCA       ---------------------
FABH_BURL3       ---------------------
FABH_BURVG       ---------------------
FABH_BURM7       ---------------------
FABH_BURM9       ---------------------
FABH_BURMA       ---------------------
FABH_BURMS       ---------------------
FABH_BURP1       ---------------------
FABH_BURPS       ---------------------
FABH_BURP6       ---------------------
FABH_BURP0       ---------------------
FABH_BURTA       ---------------------
FABH_PARP8       ---------------------
FABH_CUPNH       ---------------------
FABH_CUPTR       ---------------------
FABH_CUPPJ       ---------------------
FABH_RALPJ       ---------------------
FABH_RALSO       ---------------------
FABH_HERAR       ---------------------
FABH_JANMA       ---------------------
FABH_POLNS       ---------------------
FABH_POLAQ       ---------------------
FABH_AROAE       ---------------------
FABH_AZOSB       ---------------------
FABH_BORBR       ---------------------
FABH_BORPA       ---------------------
FABH_BORPE       ---------------------
FABH_BORPD       ---------------------
FABH_BORA1       ---------------------
FABH_CHRVO       ---------------------
FABH_LARHH       ---------------------
FABH_NEIG1       ---------------------
FABH_NEIG2       ---------------------
FABH_NEIM0       ---------------------
FABH_NEIMF       ---------------------
FABH_NEIMB       ---------------------
FABH_NEIMA       ---------------------
FABH_NITEC       ---------------------
FABH_NITEU       ---------------------
FABH_NITMU       ---------------------
FABH_VESOH       ---------------------
FABH_DICNV       ---------------------
FABH_COXB2       ---------------------
FABH_COXBU       ---------------------
FABH_COXBR       ---------------------
FABH_COXBN       ---------------------
FABH_COXB1       ---------------------
FABH_ACICJ       ---------------------
FABH_GRABC       ---------------------
FABH_AGRFC       ---------------------
FABH_RHIL3       ---------------------
FABH_RHIME       ---------------------
FABH_SINMW       ---------------------
FABH_AGRRK       ---------------------
FABH_AGRVS       ---------------------
FABH_BRUA1       ---------------------
FABH_BRUA2       ---------------------
FABH_BRUAB       ---------------------
FABH_BRUME       ---------------------
FABH_BRUC2       ---------------------
FABH_BRUSU       ---------------------
FABH_BRUMB       ---------------------
FABH_BRUO2       ---------------------
FABH_BRUSI       ---------------------
FABH_OCHA4       ---------------------
FABH_RHILO       ---------------------
FABH_CHESB       ---------------------
FABH_BARHE       ---------------------
FABH_BARQU       ---------------------
FABH_BART1       ---------------------
FABH_BARBK       ---------------------
FABH_BRASB       ---------------------
FABH_BRASO       ---------------------
FABH_BRADU       ---------------------
FABH_ERYLH       ---------------------
FABH_NOVAD       ---------------------
FABH_SPHAL       ---------------------
FABH_SPHWW       ---------------------
FABH_RHOCS       ---------------------
FABH_RHORT       ---------------------
FABH_MAGSA       ---------------------
FABH_CAUVC       ---------------------
FABH_HYPNA       ---------------------
FABH_RHOS1       ---------------------
FABH_RHOS4       ---------------------
FABH_RHOS5       ---------------------
FABH_RUEPO       ---------------------
FABH_RUEST       ---------------------
FABH_ROSDO       ---------------------
FABH_DINSH       ---------------------
FABH_JANSC       ---------------------
FABH_PARDP       ---------------------
FABH_RHOCA       ---------------------
FABH_EHRCJ       ---------------------
FABH_EHRCR       ---------------------
FABH_EHRRG       ---------------------
FABH_EHRRW       ---------------------
FABH_WOLPM       ---------------------
FABH_WOLPP       ---------------------
FABH_WOLTR       ---------------------
FABH_ANAMM       ---------------------
FABH_RICRO       ---------------------
FABH_RICRS       ---------------------
FABH_RICCN       ---------------------
FABH_RICM5       ---------------------
FABH_RICFE       ---------------------
FABH_RICAH       ---------------------
FABH_RICCK       ---------------------
FABH_RICPR       ---------------------
FABH_RICTY       ---------------------
FABH_RICB8       ---------------------
FABH_RICBR       ---------------------
FABH_NEOSM       ---------------------
FABH_AQUAE       ---------------------
FABH_PERMH       ---------------------
FABH_SULDN       ---------------------
FABH_SULNB       ---------------------
FABH_ARCB4       ---------------------
FABH_HELP2       ---------------------
FABH_HELPG       ---------------------
FABH_HELPY       ---------------------
FABH_HELPS       ---------------------
FABH_HELPJ       ---------------------
FABH_HELPH       ---------------------
FABH_HELAH       ---------------------
FABH_HELHP       ---------------------
FABH_CAMC1       ---------------------
FABH_CAMC5       ---------------------
FABH_CAMFF       ---------------------
FABH_CAMHC       ---------------------
FABH_CAMJE       ---------------------
FABH_CAMJJ       ---------------------
FABH_CAMJ8       ---------------------
FABH_CAMJR       ---------------------
FABH_CAMJD       ---------------------
FABH2_BACTN      ---------------------
FABH_BACV8       ---------------------
FABH1_BACTN      ---------------------
FABH_PARD8       ---------------------
FABH_PORG3       ---------------------
FABH_PORGI       ---------------------
FABH_AZOPC       ---------------------
FABH_PELLD       ---------------------
FABH_CHLPM       ---------------------
FABH_CHLCH       ---------------------
FABH_CHLPD       ---------------------
FABH_CHLTE       ---------------------
FABH_KORVE       ---------------------
FABH_SOLUE       ---------------------
FABH2_VIBVU      SALELLKNAIELCNARRDK--
FABH2_VIBVY      SALELLKNAIELCNARRDK--
FABH2_VIBPA      SALELLERAIKLCNERRRDEV
FABH2_VIBCH      TALDLLSKAIEHCKRHQSE--
FABH_PSET1       TGLELVAPAVKACKEAEPT--
FABH_TRIV2       ---------------------
FABH_NOSS1       ---------------------
FABH_TRIEI       ---------------------
FABH_ACAM1       ---------------------
FABH_SYNE7       ---------------------
FABH_SYNP6       ---------------------
FABH_MICAN       ---------------------
FABH_SYNY3       ---------------------
FABH_THEEB       ---------------------
FABH_GLOVI       ---------------------
FABH_PROM0       ---------------------
FABH_PROM9       ---------------------
FABH_PROM2       ---------------------
FABH_PROM5       ---------------------
FABH_PROMP       ---------------------
FABH_PROMA       ---------------------
FABH_PROMT       ---------------------
FABH_PROMM       ---------------------
FABH_SYNR3       ---------------------
FABH_SYNPW       ---------------------
FABH_PORPU       ---------------------
FABH_PORUM       ---------------------
FABH_PYRYE       ---------------------
FABH_GRATL       ---------------------
FABH_RHOBA       ---------------------
FABH1_STRCO      ---------------------
FABH_STRGA       ---------------------
FABH_KOCRD       ---------------------
FABH_MYCA1       ---------------------
FABH_MYCPA       ---------------------
FABH_MYCMM       ---------------------
FABH_MYCUA       ---------------------
FABH_MYCTA       ---------------------
FABH_MYCTU       ---------------------
FABH_MYCBO       ---------------------
FABH_MYCBP       ---------------------
FABH_MYCBT       ---------------------
FABH_MYCA9       ---------------------
FABH_STRLI       ---------------------
FABH2_STRAW      ---------------------
FABH4_STRCO      ---------------------
FABH2_STRCO      ---------------------
FABH5_STRCO      ---------------------
FABH3_STRCO      ---------------------
FABH_PSEA8       ---------------------
FABH_PSEAB       ---------------------
FABH_PSEAE       ---------------------
FABH_LACBA       ---------------------
FABH_LACH4       ---------------------
FABH2_LACPL      ---------------------
FABH_OENOB       ---------------------
FABH_LACDA       ---------------------
FABH_LACDB       ---------------------
FABH_LACRD       ---------------------
FABH_LACRJ       ---------------------
FABH_LACSS       ---------------------
FABH_LACLM       ---------------------
FABH_LACLS       ---------------------
FABH_LACLA       ---------------------
FABH_STRA1       ---------------------
FABH_STRA3       ---------------------
FABH_STRA5       ---------------------
FABH_STRE4       ---------------------
FABH_STRS7       ---------------------
FABH_STREM       ---------------------
FABH_STRP1       ---------------------
FABH_STRPG       ---------------------
FABH_STRP3       ---------------------
FABH_STRPM       ---------------------
FABH_STRP8       ---------------------
FABH_STRPQ       ---------------------
FABH_STRPB       ---------------------
FABH_STRPC       ---------------------
FABH_STRPD       ---------------------
FABH_STRP6       ---------------------
FABH_STRPZ       ---------------------
FABH_STRPF       ---------------------
FABH_STRU0       ---------------------
FABH_STRGC       ---------------------
FABH_STRSV       ---------------------
FABH_STRP7       ---------------------
FABH_STRPS       ---------------------
FABH_STRP2       ---------------------
FABH_STRPI       ---------------------
FABH_STRR6       ---------------------
FABH_STRPJ       ---------------------
FABH_STRPN       ---------------------
FABH_STRZJ       ---------------------
FABH_STRZT       ---------------------
FABH_STRP4       ---------------------
FABH_STRZP       ---------------------
FABH_STRMU       ---------------------
FABH_STRT1       ---------------------
FABH_STRTD       ---------------------
FABH_STRT2       ---------------------
FABH_STRS2       ---------------------
FABH_STRSY       ---------------------
FABH_ENTFA       ---------------------
FABH1_LACPL      ---------------------