CLUSTAL format seed alignment for MF_01818

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNZ_NOSS1       ----MQITFLGTSSGVPTRARNVSSVALRLP-QRAE-LWLFDCGEGTQHQILRSDLKVSQ
RNZ_SYNY3       ----MEITFLGTSSGVPTRNRNVSSIALRLP-QRAE-LWLFDCGEGTQHQFLRSEVKISQ
RNZ_PROMM       ----MQVTFLGTSSGVPTRARNVSAVALRLP-QRAE-LWLFDCGEGTQHQFLRSDLRLSQ
RNZ_PARMW       ----MQVTFLGTSSGVPTRARNVSAVALRLP-QRSE-MWLFDCGEGTQHQFLRSDLRLSQ
RNZ_PROMA       ----MQITFLGTSSGVPTRSRNVSALALRLP-QRSE-LWLFDCGEGTQHQFLRSDLRTSQ
RNZ_PROMP       ----MNITFLGTSSGVPTLTRNVSSLALKLS-QTAE-VWLFDCGEGTQHQLMKSNIKSSQ
RNZ_GLOVI       ----MLLTFLGTSSGTPTRSRNVTSIALQLP-QRSS-LWLFDCGEGTQHQVLRTPLRLSQ
RNZ_BACAN       ----MEFVFLGTGAGVPSKGRNVSAIALQLLEERGQ-TWLFDCGEATQHQILHTSVRPRR
RNZ_BACCR       ----MEFVFLGTGAGVPSKGRNVSAIALQLLEERGQ-TWLFDCGEATQHQILHTSVRPRR
RNZ_BACSU       ----MELLFLGTGAGIPAKARNVTSVALKLLEERRS-VWLFDCGEATQHQILHTTIKPRK
RNZ_LISIN       ----MELVFLGTGAGVPSRGRNVTSIALSMLNERNA-IWLFDCGEATQHQVLRSHIKLSK
RNZ_LISMO       ----MELVFLGTGAGVPSRGRNVTSIALSMLNERNT-IWLFDCGEATQHQIMRSQIKLSK
RNZ_OCEIH       ----MELVFLGTGAGLPSKTRNVSAVALNMTQEINE-VWLFDCGEATQHQILHTNLKPRK
RNZ_ENTFA       ----MEIQFLGTGAGVPAKHRNVTGIALKLLDERNA-VWLFDCGEGTQLQILKSSIRPRK
RNZ_LACPL       ----MQLEFLGTGAGSPGKFRNVTSTALRLLDERNE-VWLFDVGEGTQHQILRTTLKPRK
RNZ_STRA3       ----MEIQFLGTGAGQPAKARNVSSLVLKLLDEINE-VWMFDCGEGTQRQILETTIKPRK
RNZ_STRP1       ----MELQFLGTGAGQPAKQRNVSSLALKLLDEINE-VWMFDCGEGTQRQILETTIKPRK
RNZ_STRPN       ----MDIQFLGTGAGQPSKARNVSSLALKLLDEINE-VWLFDCGEGTQNRILETTIRPRK
RNZ_STRMU       ----MEIQFLGTGAGQPAKARNVSSLVLKLLDELNE-IWMFDCGEGTQRQILETTIKPRK
RNZ_LACLA       ----MEIQFLGTGAGQPSKSRNTQAIALKMLDERNE-IWLFDCGEATQHQILNTTIKPRK
RNZ_ALKHC       ----MEFHFFGTGSGVPSIERNVSACAVRFLQQRGK-QWLFDCGEATQHQILRSSIALGK
RNZ_STAAM       ----MEVTFFGTSAGLPTKERNTQAIALNLEPYSNS-IWLFDVGEGTQHQILHHAIKLGK
RNZ_STAES       ----MEVTFFGTSAGLPTKERNTQSIALNLEPYSNS-IWLFDVGEGTQHQILRHSIKLGK
RBN_ECOLI       ----MELIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGK
RBN_SALTY       ----MELIFLGTSAGVPTRSRNVTAILLHLQHPTQPGVWLFDCGEGTQHQMLNTAFHPGK
RNZ_PSEPK       ----MDLLFLGTSAGVPTKARNVSATAVIEA--SGSHWYLVDCGEGTQHRLLHTPLSIRD
RNZ_BACTN       -MEKFELHILGCGSALPTTRHFATSQVVNLR----EKLFMIDCGEGAQMQLRRSRLKFSR
RNZ_PORGI       -MAAFSVHILGCGSALPTTHHHPSSQVIDLR----DKLYMIDCGEGVQRQFRHEKLHFGR
RNZ_METAC       ---MLRITFLGTGGSLPTRNRNPSAVMINREGE----LMLFDCGEGTQQQMMRAKTGMMS
RNZ_METMA       ---MLRIIFLGTGGSLPTRNRNPSAVIVNLKGE----LLLFDCGEGTQQQMMRAKTGMMS
RNZ_ARCFU       --MLFKITFLGTSGTIPSVERNSPAIFVQFGGQ----RMLFDCGEGTQRQMMIAKTGFRN
RNZ_HALSA       --MTLEVTFLGTSGAVPTTERNPSSVFVRRNGD----AFLFDAGEATQRQMMRYKTGF-G
RNZ_METJA       -MIIMKLIFLGTGAAVPSKNRNHIGIAFKFGGE----VFLFDCGENIQRQMLFTEVSPMK
RNZ_METTH       ---MMEVTFLGTSSAVPSKNRNHTSIALRIPGE----IFLFDCGEGTQRQMALAGISPMK
RNZ_PYRAB       ---MIEVIFLGTGGIKPTPERNVPSIAIKVEGE----LILFDVGEGTLRQMEIAGLSPMK
RNZ_PYRFU       ---MIEVIFLGTGGIKPTPERNVPSIAIRIGSE----IVLFDVGEGTLRQMEIAGLNPMR
RNZ_SACS2       ---MIQIFFLGTGAGSPSKKRKLPAFLVRREGV----NILLDCGEGTQYTLMNYKLGINS
RNZ_SULTO       ---MITVYFIGTGGGAPNK-RGLPAIMVRREGF----DALFDCGEGTQWRMMEHNLSFMK
RNZ_THEAC       MASNIRIIFYGTGGSWPTPLRAMPGVGVKIDDV----LNLFDCGEGTQKQIMKSSTSFMD
RNZ_THEVO       MASNIKIVFFGTGGSWPTPIRAMPGVGIQIDDV----FNLFDCGEGTQKQIMKSKWSFMS
RNZ_BORBU       --MGFNINIIGTGGTRPLHNRYLSSVLIEYDGD----NFLFDCGEGTQMSLRKQKISWQK
RNZ_TREPA       MHMNLEAFILGCGGMVPLPHRHLTSVLLRREGE----LFLFDAGEGTQVSLRRLSLRWKK
RNZ_CLOPE       ---MLNVTLLGTGGGMPMPNRFLSSVVMNFNGR----KILLDCGEGTQVSMRVNGTGFKS
RNZ_CLOTE       ---MIDITLLGTGGGMPTPERNLSAAILNYKGR----KILIDCGEGTQVSMKISKTGFKN
RNZ_CLOAB       ---MLDICLLGCGGSLPTSDRNLTSLLISYNGR----KILIDCGEGTQVSMKEIAWGFKD
RNZ_CHLPN       -MSSRELIILGCSSQQPTRTRNQGAYLFRWNGE----GLLFDPGEGTQRQFIFANIAPTT
RNZ_CHLTR       -MSYRGLTILGCSSQQPTRHRNHGAYLLRWNGE----GLLFDPGEGTQRQFIYANIAPTV
RNZ_STRAW       -MSVRELVVLGTASQVPTRHRNHNGYLLRWDGE----GILFDPGEGTQRQMLRAGVAAHD
RNZ_STRCO       -MSVRELVVLGTASQVPTRHRNHNGYLLRWDGE----GILFDPGEGTQRQMLRAGVAAHD
RNZ_BRADU       ---MFALTFLGTSASVPSAERNHPALLVEAAGK----RILIDCGEGTQRQLLRSGAGFRR
RNZ_MYCBO       ---MLEITLLGTGSPIPDPDRAGPSTLVRAGAQ----AFLVDCGRGVLQRAAAVGVGAAG
RNZ_MYCTU       ---MLEITLLGTGSPIPDPDRAGPSTLVRAGAQ----AFLVDCGRGVLQRAAAVGVGAAG
RNZ_AERPE       -MGRIDITILGSGSAVPSLHRWHPSILVKDWMGN---TVLLDAGEGVQIRLRKVGVSPSS
RNZ_PYRAE       -MPIVKLVILGSGGAVPKADRMLPAIYLEDWLGH---RVLLDAGEGVQYRLLQIGISPSS
                        . * ..  *   :   .  .           :.* *.               

RNZ_NOSS1       LSRIFITHLHGDHIFGLMGLLASCGLAGNV---QRVDIYGPSGLNDYIQSASRYSHTHFS
RNZ_SYNY3       LTRIFITHLHGDHIFGLMGLLASSGLAGSG---QGIEIYGPEGLGDYLEACCRFSSTHLG
RNZ_PROMM       LRRVFVSHMHGDHVFGLPGLLASLGLSGNS---NGVDLYGPDPLESYLQGVLRNSSTRIG
RNZ_PARMW       LRRVFVTHMHGDHVFGLPGLLASLGLSGSCQ--DGVDLYGPDPLESFLKGALNTSSTRIG
RNZ_PROMA       LKKIFITHMHGDHIYGLPGLMASLGLAGNS---LGLDLYGPSALKGFLDGILKSSSSRIS
RNZ_PROMP       IKKIFITHMHGDHIYGLPGLLATLGLSGNS---NGIEIYGPSELKSFVTSALESSFCKLS
RNZ_GLOVI       LEKVFFTHLHGDHLFGLVGLLASRALGSAGT--TPVKLYGPPGLQEYVRATLRYSDTHIN
RNZ_BACAN       IEKIFITHLHGDHIFGLPGLLGSRSFQGGTT---PLTVYGPKGIKQFIEVALSVSTTHVK
RNZ_BACCR       IEKIFITHLHGDHIFGLPGLLGSRSFQGGTT---PLTVYGPKGIKQFIEVALSVSTTHVK
RNZ_BACSU       IEKIFITHMHGDHVYGLPGLLGSRSFQGGED---ELTVYGPKGIKAFIETSLAVTKTHLT
RNZ_LISIN       LEKIFITHMHGDHIFGLPGLLSSRSFQGGDS---DLTIYGPAGIAEYVETSLRLSGTRLT
RNZ_LISMO       LEKIFITHMHGDHIFGLPGLLSSRSFQGGDS---NLTIYGPAGIAEYVETSLRLSGTRLT
RNZ_OCEIH       ITKIFITHLHGDHIYGLPGFLSSRSFQSGENQ--PLCIYGPIGIKEFVESTLRLSQTNLT
RNZ_ENTFA       IEKIFITHLHGDHIFGLPGLLSSRSFQGGTE---PLEIYGPVGIADFVKTSLRVSQSRLS
RNZ_LACPL       IAKIFITHLHGDHIFGLPGLLSSRSFQGGDE---PLTIYGPVGVRDFVQTALRVSGTHLS
RNZ_STRA3       VKKIFITHMHGDHVFGLPGFLSSRAFQANEEQ-TDLDIYGPVGIKSFVMTGLRTSGSRLP
RNZ_STRP1       IRKIFITHLHGDHIFGLPGFLSSRSFQASEEQ-TDLDIYGPIGIKTYVLTSLKVSGARVP
RNZ_STRPN       VSKIFITHLHGDHIFGLPGFLSSRAFQANEEQ-TDLEIYGPQGIKSFVLTSLRVSGSRLP
RNZ_STRMU       IRKIFITHLHGDHVFGLPGFLSSRAFQANDEQ-TDVDIYGPVGIKHLVMASIRTSGAHLP
RNZ_LACLA       ITKIFITHLHGDHIFGLPGFLSSRSFQSSDEQ-TDLELYGPVGIKDFVLTALRISGSRLA
RNZ_ALKHC       IERIFITHLHGDHIFGLPGLLGSRSFQGGEN---PLFLYGPKGIRSFVETALQVSNTHVK
RNZ_STAAM       VTHIFITHMHGDHIFGLPGLLSSRSFQGGEQK--PLTLVGPKGIKAYVEMSMNLSESHLN
RNZ_STAES       IDHIFITHMHGDHIFGLPGLLTSRSFQGGENK--PLTIIGPKGIQNYIETSLQLSESHLN
RBN_ECOLI       LDKIFISHLHGDHLFGLPGLLCSRSMSGIIQ---PLTIYGPQGIREFVETALRISGSWTD
RBN_SALTY       LERIFISHLHGDHLFGLPGLLCSRSMAGNPH---PLTVYGPQGVREFIATTLRLSGSWTD
RNZ_PSEPK       LRAIFITHVHGDHCFGLPGLLASAGMSGRTQ---PLEVILPAVLHDWVRQGLVASDTFLP
RNZ_BACTN       LNHIFISHLHGDHCFGLLGLISTFGLLGRTA---DLHIHSPKGLEELFAPLLSFFCKTLA
RNZ_PORGI       LIHIFISHLHGDHCFGLPGFISTLGLLGRTG---TLHVHGPEGIERFLSPILEQFCHRMP
RNZ_METAC       LSSIFVSHFHADHFLGIPGLIQTMSFMGRK---DPLMIYGPAGTREFTELFKALGYFNLK
RNZ_METMA       LSSIFVSHFHADHFLGIPGLIQTMSFLGRK---EPLTIYGPEGTKEFTEVFKVLGYCNLK
RNZ_ARCFU       LDNIFITHLHTDHFIGLFGLIETMSLNERS---RELNVYSPR-AEVLRALFEAFGYDQLN
RNZ_HALSA       VSDVFITHGHGDHVFGLPGLVHTWDFNDRT---DPLTIHVPRGLRGDIEDLVFSAGGDVG
RNZ_METJA       INHIFITHLHGDHILGIPGLLQSMGFFGRE---KELKIFGPEGTKEIIENSLKLGTHYIE
RNZ_METTH       VTRIFITHLHGDHILGIPGMIQSMGFRGRE---EPLDIYGPPGIHELHECIMKMGYFTLD
RNZ_PYRAB       IRRIFITHFHGDHYLGLPALIQTMNLWKRK---EPLHIYGPENSIEFIKNLLNSGYFAPS
RNZ_PYRFU       IKRIFITHFHGDHYLGLAAIIQTMNLWDRR---ETLHIYGPENSGEFISNFLKSGYFAPG
RNZ_SACS2       IKIIGISHMHGDHVFGLLGVIASMGLLDRK---ETLYILGPRKLKDFLYTSFEYSKFNPS
RNZ_SULTO       IKLIGITHMHGDHVLGLPGMIETMGMYSRK---ESLLLMGPKELKEFLEDIFKKTYFYPN
RNZ_THEAC       IDNIFITHFHGDHFLGLLGLVQSMSFNNRT---KQLNIFGPHGAIKILSNALNVGYYTLH
RNZ_THEVO       IDNIFITHFHGDHFLGLIGLVQSMSFNNRT---KDLNIFGPRGAIGIISNAINIGYYTLR
RNZ_BORBU       IKMICITHLHADHITGLLGIVMLMSQSGETRK-EPLIIAGPVGIKNYTQANINMLKIYKN
RNZ_TREPA       ISAIFISHTHADHITGLPGLLMLSSQVARS---EPLYIIGPPRTAEYVETSRRILDMYIN
RNZ_CLOPE       IDIICISHLHGDHIYGLPGLLSTIGNSGRV---EDIYIIGPNGIKEVIE-GFLITLPYLP
RNZ_CLOTE       IDIICITHWHGDHIVGLPGLLATMGNSGRK---EPLTIIGPVGIGEIIK-GLTVIVPYIP
RNZ_CLOAB       IDVICFTHYHADHVMGLTGLLLTIANSGRI---DPLTIIGPEGLREVVK-GLTVVAPFFP
RNZ_CHLPN       VNRIFVSHFHGDHCLGLGSMLMRLNLDKVS---HPIHCYYPASGKKYFDRLRYGTIYHET
RNZ_CHLTR       VSRIFISHFHGDHCLGLGSMLMRLNLDRVL---HPIHCYYPASGKKYFDRLRYSTIYHET
RNZ_STRAW       LHRICVTHFHGDHSLGLAGVIQRINLDRVP---HEITAHYPGSGQRFFERLRYATAYRET
RNZ_STRCO       LNRICVTHFHGDHSLGLAGVIQRINLDRVP---HEITAHYPRSGQRFFERLRYATAYRET
RNZ_BRADU       LDRILLTHAHLDHVLGIPGLFSTLGLRQSS---DVMTIHGGPGTLDIVIRMLAGLWGAGR
RNZ_MYCBO       LSAVLLTHLHSDHIAELGDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGH---
RNZ_MYCTU       LSAVLLTHLH-------GDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGH---
RNZ_AERPE       IDVLAITHPHGDHINGVAGLLMTMSLQSRR---KPLTIISTSESLEFISETLEATRENLG
RNZ_PYRAE       LTLIAVTHMHEDHILGLPGLVITSKFLGGR-----LKVLAPKSMHGALSKLGVEVAD--S
                :  : .:* *         ..              :                        

RNZ_NOSS1       YPIKVHTVR--------P-GVIYENDE-------FTVTCGLLHHRITAFGYRVAEKDRAG
RNZ_SYNY3       KRLKVHTVR--------ENGLIYEDKD-------FQVHCGLLKHRIPAYGYRVEEKQRPG
RNZ_PROMM       YPLKVHRVRDAAE----QNLIVFEDKD-------ILVRCTPLTHRVPAYAYRVEQKPKPG
RNZ_PARMW       YPLQVHRSRPAAE----QGTLLFEDDE-------LTVRCTPLTHRVPAYAYRVDQKPLAG
RNZ_PROMA       YPMKIHGLELESA----ENKIIFEDND-------FLVTCTPLIHRVPAFAYRVDEKAKPG
RNZ_PROMP       FPLRFRAVEDFAS----LNKILFENDK-------LKVHCACLKHRLPAYGYRVSEKDKPG
RNZ_GLOVI       YPIHFQTVEP---------GLVLSEEG-------FTVLANALKHRISAFGYSVIEHDQPG
RNZ_BACAN       YPLEIVEIT--------EEGTVFEDNE-------FHVETKRLSHGIECFGYRIIEKDIQG
RNZ_BACCR       YPLEVVEIT--------EEGTVFEDNE-------FYVETKRLSHGIECFGYRIVEKDIQG
RNZ_BACSU       YPLAIQEI---------EEGIVFEDDQ-------FIVTAVSVIHGVEAFGYRVQEKDVPG
RNZ_LISIN       YKINFEEI---------EPGVIFEDEM-------FLVTADDLDHGVRSFGYRIVEKDKQG
RNZ_LISMO       YKINFEEI---------EPGVIFEDKM-------FIVTADDLDHGVRSFGYRIVEKDKQG
RNZ_OCEIH       YPITIKEIT--------EDGNLFETNE-------MMVETKKLQHGIDSYGYRIKEKDKPG
RNZ_ENTFA       YPLKFIELTK-------ENDVIFKDKQ-------FTVRCNILDHGITSFGYRIEEAAHEG
RNZ_LACPL       YPLKFHEITK-------A-ETVFEDAT-------FKVSCEPLDHRIACFGYRVEEADHPG
RNZ_STRA3       YRIHFHEFDES------SLGKIMETDK-------FTVYAEKLDHTIFCMGYRVVQKDLEG
RNZ_STRP1       YQIHFHEFDDK------SLGKIMETDK-------FEVYAERLAHTIFCMGYRVVQKDLEG
RNZ_STRPN       YRIHFHEFDQD------SLGKILETDK-------FTVYAEELDHTIFCVGYRVMQKDLEG
RNZ_STRMU       YHIHFHEFDAK------HLGKILETDK-------FMVYAEKLDHTIFCVGYRVVQKDLEG
RNZ_LACLA       YRINFHEID--------SAGKIFEDDS-------FEVHTDLLDHTIFCLGYRVVEKNRIG
RNZ_ALKHC       YELTIEEFS--------EPGLLFHEEG-------FKVETILLDHVMPCYAFKVTEDDRPG
RNZ_STAAM       YPITYIEI---------DDHLTYHHDG-------FTVEAHLLNHGIPSYGYRVMAPETTG
RNZ_STAES       YPITYIEI---------NQQLAYHHNG-------FTVQAEMLNHGIPSFGYRIEAPIMPG
RBN_ECOLI       YPLEIVEI---------GAGEILDDGL-------RKVTAYPLEHPLECYGYRIEEHDKPG
RBN_SALTY       FPLQIEEI---------SAGDILDDGL-------RKVTAFRLEHPLECYGYRVVEHDKPG
RNZ_PSEPK       FELRLLPV---------EELIAWRSET-------LQVTTVQLSHRVPSVGFVFTEINPEP
RNZ_BACTN       YKVFFHEFETK------EPTLIYDDRS-------VAVTTIPLRHRIPCCGFLFEEKQRPN
RNZ_PORGI       YQVEIHTIDAS------RHALVHEDKS-------VKVYSIPLSHRIPAVGYLFEEKCRAR
RNZ_METAC       YEIHGMELKPGD--------VVE-GEG-------YVVRALETEHSTPSLGYALIENPRPG
RNZ_METMA       YEVRGVELSPGD--------IVE-GKN-------YVVRALKTEHSTPSLGYSLIENPRPG
RNZ_ARCFU       YDIRVRELKDGE--------EVK-FDG-------FKVVAFRTEHIVKSVGYAIIENDRRG
RNZ_HALSA       YPVRITEATPGA--------VVRSHDD-------YEVRAFETAHSTASVGYALVEDDRTG
RNZ_METJA       FPIKVYEIYTKEPI------TIYKEEN-------YEIIAYPTEHGIPSYAYIFKEI-KKP
RNZ_METTH       FDINVHEVRGG---------TVVEEDD-------YRVTSAPASHSVFNLAYCFEEK-KRP
RNZ_PYRAB       FDVTVHELPGK---------ARLQFEK-------YEVWAFEVSHGVPALGYVFKEKDRRG
RNZ_PYRFU       FDVVVHEITGK---------ARLQFEN-------YEIWTFEVSHGIPALGYVFKEKDRRG
RNZ_SACS2       FKIEFIDNYND--------------EN-------ITISTFKTCHTIESQGYLIMEK-DRV
RNZ_SULTO       FEIQIIDKYED--------------EN-------IKISTFETCHTIESQGYLFEEK-DRL
RNZ_THEAC       FPLKIYELEPDR--------T-YDLGK-------FLIRTMLNDHPVPALSYSIEER-DLV
RNZ_THEVO       FRINVYELEPDK--------T-YDLGK-------FLLKTTLNDHPVPALSYTIEEK-DII
RNZ_BORBU       YEIIYKEIII-----D-KTEKIIYEDK-T-----KKIEYTKLKHSIECVGYLFIEKDKPG
RNZ_TREPA       YEIIVKEVI---------EPQVVYRGK-D-----FQVRCFCLDHTKPCMGYTLEEQDRPG
RNZ_CLOPE       YKLNILEDA-SNLEFMVKKEKIELVELNEKISSDLTIETLGLDHSSPCLGYSFNIRRGR-
RNZ_CLOTE       YELNVIEATKESLCFTINKENLLLSSKGE-----IIINTLEVEHSSPCIAYRFDVKRKP-
RNZ_CLOAB       YEIELIELD--SKCSDNFLDKVFKIEDVE-------IFALPVDHSIECLSYSVRVNRKR-
RNZ_CHLPN       IQVVEHPIS--------EEGIVEDFGS-------FRIEAQRLQHQVDTLGWRITEPDTI-
RNZ_CHLTR       IKVIEHPID--------REGIVEDFGN-------FRIESRQLDHLVDTLGWRITEPDTT-
RNZ_STRAW       VALTEAPVA--------ADGVIADTPA-------YVLETRRLSHPVESFGYRLVEPDGR-
RNZ_STRCO       VALTEVPVA--------ADGPLAVTPA-------YTLDARRLSHPVESYGYRLTEPDGR-
RNZ_BRADU       APIPVEFAALS-------EGQVIDAGG-------FTIDCFPVRHRDTDSFGFVFQSPARR
RNZ_MYCBO       -----------------------------------------------DIGYRIAHHAD--
RNZ_MYCTU       -----------------------------------------------DIGYRIAHHAD--
RNZ_AERPE       FEVMLVDARESG----VLDVGRPSGDR-------LTIEWERACHNIESLAFKLVWTLRP-
RNZ_PYRAE       YE----------------------EER-------FKIKCVEVCHTVDACGWLIQWDVGY-
                                                                    .       

RNZ_NOSS1       RFDIEKAK-ELQIPPGRIYGQLKRGETVTLEDGRVINGAELCGPTEIGRKMAYCTDTIYC
RNZ_SYNY3       RFNVEQAE-ALGIPFGPIYGQLKQGKTVTLEDGRRIRGQDLCEPPEPGRKFVYCTDTVFC
RNZ_PROMM       HFNLERAQ-SLGIPPGPVYAALKRGEQVSLDDGRVVDGRDFCGPDRPGASIVFCTDTVFS
RNZ_PARMW       RFDIDKAR-SLGIPPGPVYAQLKRGESVTLEDGRVIDGTTLCGPERPGVSVMICTDTVFC
RNZ_PROMA       RFDVEKAK-ALRIPPGPIYSQLQKGQIVKLKDGRIFNGNDFCGPQRKGASFVYCTDTMFA
RNZ_PROMP       VFDIKKAE-DSNIPPGPIYSELQAGKTVQLKDGRSFNGQDFCGPPRKGESFVYCTDTVFS
RNZ_GLOVI       RFDAERAA-QLGIPFGPLYGQLKAGRTVALPDGRTVDGRTLVGPERKGRKLTYCSDTIYT
RNZ_BACAN       ALLVDKLL-EIGVKPGPLFKRLKDGEVVELENGTILNGNDFIGPPQKGRVITILGDTRYC
RNZ_BACCR       ALLVDKLL-EMGVKPGPIFKRLKDGEVVELEDGTILNGNEFIGPPQKGRIITILGDTRYC
RNZ_BACSU       SLKADVLK-EMNIPPGPVYQKIKKGETVTLEDGRIINGNDFLEPPKKGRSVVFSGDTRVS
RNZ_LISIN       ALNAEKLK-ADGVEAGPVFQKLKNGEIVTLADGRVIDGKNYIGEPQKGKIISIFGDTKET
RNZ_LISMO       ALNAEKLK-ADGVEAGPVFQKLKNGEIVTLADGRVIDGKNYIGEPQKGKIISIFGDTRET
RNZ_OCEIH       ELLVDKLK-QIGIAPGPIYQQIKENEITTLDNGSIIYRNDVLGPAKKGKVISILGDTRYS
RNZ_ENTFA       ELQVEKLQ-ALGIPSGPLYGKLKRGETIVF-DGQEINGQAFVGERKPGRIVTILGDTRKT
RNZ_LACPL       ELQADRLK-ALNIPSGPVYGQLKAGKTVTLPDGRTINGQDYIAAPQKGRTVTILGDTRRT
RNZ_STRA3       TLDAEALK-LAGVPFGPLFGKVKNGENVTLEDGREIIAKDYISEPKKGKVITILGDTRKT
RNZ_STRP1       TLDAEALK-AAGVPFGPLFGKIKNGQDVELEDGRLICAKDYISAPKKGKIITIIGDTRKT
RNZ_STRPN       TLDAEKLK-AAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKT
RNZ_STRMU       TLDAEKLK-AAGLPFGPLFGRVKNGQDVVLEDGTTIIAKDYISAPKKGKVITILGDTRKT
RNZ_LACLA       ELDANALK-EAGLPFGPLFGKIKKGE-IVQYEGKTFDPKDYIGADKAGKIVTILGDTRKS
RNZ_ALKHC       ELLVDRLK-AKGVPPGPLYRKIQQGETVELPTGERLEANAFLGPPKRGRSFVLAGDTRPV
RNZ_STAAM       TINVEALK-NIGLEPGPKYQEVKSHDTFEH-NGQVYQSKDFRGESKQGPVVAIFGDTKPC
RNZ_STAES       TINVEALR-GIGLEPGPKYQEVKLQETFEY-KGLIYNSDDFKGKAKPGPIISIFGDTKPC
RBN_ECOLI       ALNAQALK-AAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPC
RBN_SALTY       ALNARALK-AAGVTPGPLFQALKAGKTVTLADGRQINGADYLAPAVAGKSVAIFGDTAPC
RNZ_PSEPK       RLDIQRLD-AEGITRGPLWGELAKGLTVTY-DGQLLNGNDYLRPSRPPRRVIVCGDNDKP
RNZ_BACTN       HIIRDMVD-FYKVPVYE-LNRIKNGADFVTPEGEVIPNHRLTRPSAPARKYAYCSDTIYR
RNZ_PORGI       HLNKAAAE-FYNIPLAE-YPLIIEGSDYTTPDGRIIPNRHLTTPGTPPRRYAYCSDTEFC
RNZ_METAC       RFNREKAV-ALGVPPGPLFSKLQKGNPVEAG-GKVVRPEEVMGTPRPGRTIVYSGDTRPC
RNZ_METMA       RFNREKAV-ELGVLPGPLFAKLQKGNPVEVN-GKLVKPEEVVGAPRPGRTVVYSGDTRPC
RNZ_ARCFU       KFNREKAEKELGIPPGPLYAKLARGESIVWK-GRTITPDMVLGEKRRGRKVVYTGDSRPT
RNZ_HALSA       RFDRARAE-ELGVPVGPKFSTLHDGQPVELDDGTVVSPEQVVGDPRPGRTLVYTGDTRPH
RNZ_METJA       RLDIEKAK-KLGVKIGPDLKKLKNGEAVKNIYGEIIKPEYVLLPPKKGFCLAYSGDTLPL
RNZ_METTH       RFLREKAI-ALGLKPGPAFGKLHRGIPVR-VGDRIIMPEEVLGSPRKGVKVCYSGDTRPC
RNZ_PYRAB       SFDLEKIK-NLGLEPGPWMKELEEKKVIN-IGGRTIRLSEVTGPKKRGAKIVYTGDTEPC
RNZ_PYRFU       NFDLEKIK-SLGLTPGPWMKELEKRKIIK-IGERVIRLSEVTGPKKRGAKVVYTGDTEPI
RNZ_SACS2       KIDEEKLE-KEKIRDWRVIRKLKEGKTVEYN-GKLLKPEDYLVIKR-GSKVAYTGDTMPC
RNZ_SULTO       KIDIDKLR-KEGIKDWRIIRMLKEGKRVEIN-GKVLLPEDYLIVKK-GIRIAYTGDTGPC
RNZ_THEAC       RIDPEKAR-EKNIPSRIIEKIRENGSYVYKG-NEYRIDDIAGGVRK-GRRIVYTGDTRPM
RNZ_THEVO       RVDPQKAK-ELGIPSKIIEKIRDNGTYEYRG-RKYSIDEISGGIRK-GRKIVYTGDTKPM
RNZ_BORBU       KFNTEKAE-ELNIPKGPIRKALQDGKE-ILVNGKIIKPSEILGKSKKGLKVAYITDTGYF
RNZ_TREPA       SFDPRAAQ-DLHVPCGALWSQLQSGVAVQSAQGVTVYPEQVMGPARPGRKVSFVTDTKYL
RNZ_CLOPE       KFNVEKAL-MNKVPK-ELWSKLQRNEE-VSLNGVKYYSYMVLGDERKGIKLSYTTDTRPT
RNZ_CLOTE       KFNLEKAL-DNKVPK-VIWNLLQRGGN-VEFEGNLYESSMVLGEERKGIKFSFVTDTLPI
RNZ_CLOAB       KFDVNKAK-ANEVPL-KIWNELQRGKE-ITYENKLYVPDMVLGESRKGIKITYCTDTRPV
RNZ_CHLPN       KFLPKELE-SRGIR-GLIIQDLIRDQE--ISIGGSTVYLSDVSYVRKGDSIAIIADTLPC
RNZ_CHLTR       KFIPEKIK-AAGLK-GPIMQELINKGQ--VKVNDTIVHLDDVSYTRKGDSIAVVADSLPC
RNZ_STRAW       RMLPERLA-AHGIK-GPDVGRIQREG----AIGG--VSLEDVSEVRHGQRFAFVMDTRLC
RNZ_STRCO       RMLPERLA-AHGIT-GPDVGRIQRDG----SLGG--VALDEVSEVRRGQRFAFVMDTRLC
RNZ_BRADU       HLLPDRLA-SLGVPDGPLRGELAQGRPVVIEDGRTIDPEDVLGPATGGRKLVVIGDTETT
RNZ_MYCBO       LTTPPPIE-VHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPC
RNZ_MYCTU       LTTPPPIE-VHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPC
RNZ_AERPE       RIDARILE-RLDLKAGPWIRELIEKGR-AHVEGRIVTLKDISASGERKYSVAYTGDTSPC
RNZ_PYRAE       KLDLSKTS---GLPKWA-LTELIKGKPVKIGDRIITPEEVADPAHKRFKYLLYTGDTAPC
                                                                       *.   

RNZ_NOSS1       DGAVELAQ--DADVLIHEATFAHQD-SEM-----AFQRLHSTTTMAAQTALAAGVRRLLM
RNZ_SYNY3       EEAIALAQ--EADLLVHEATFAHQD-AQL-----AFDRLHSTSTMAAQVALLANVKQLIM
RNZ_PROMM       EAAVSLAA--GADLLIHEATFAHSE-AEM-----AYQKQHSTSTMAAQTAAEAGVGKLVL
RNZ_PARMW       DAAVELAR--GVDLLIHESTFAHAE-AEM-----AFQKQHSTSTMAAQTAAEAGVGQLAI
RNZ_PROMA       QTALKLAN--GADLLIHEATFSHED-SDL-----AYQRQHSTSTMAAQIASEANVGQLVL
RNZ_PROMP       KSAVNLSK--NADLLVHESTFSKED-EKM-----AYEKLHSTTIMAAKTALLSNVKKLII
RNZ_GLOVI       PSAIELAL--GADVLIHEATYCEAD-LNL-----AERGLHSTAAMAARVAREAKVRQLIL
RNZ_BACAN       EASRELAQ--DADVLVHEATFAAED-EQQ-----AYDYFHSTSKQAASIALQANAKRLIL
RNZ_BACCR       EASRELAQ--DADVLVHEATFAAED-EQQ-----AYDYFHSTSKQAASIALQANAKRLIL
RNZ_BACSU       DKLKELAR--DCDVLVHEATFAKED-RKL-----AYDYYHSTTEQAAVTAKEARAKQLIL
RNZ_LISIN       VSELELAM--NADILVHEATFEGDK-AKM-----AGEYMHSTTLQAANLAKAANVKKLIL
RNZ_LISMO       SSELELAL--NADILVHEATFEGDK-AKM-----AGEYMHSTTLQAAKLAKTANVKKLIL
RNZ_OCEIH       IDHIPFIK--FSDILVHESTFTQDK-ELL-----AFEYNHSTNVQAAKLAKEANINKLYL
RNZ_ENTFA       KNSVTLAR--RADVLVHESTFNKHE-AKM-----AKAYFHSTSQQAAEVAKEAQVKQLIL
RNZ_LACPL       PHAVSLAQ--DADALVHESTFGKDE-GKL-----AHNYYHSTSTQAAQVAQQAGVKQLLL
RNZ_STRA3       DASIRLAL--GADVLVHESTYGKGD-ERI-----AKSHGHSTNMQAADIAKQANAKRLLL
RNZ_STRP1       SASVKLAK--DADVLVHESTYGKGD-ERI-----ARNHGHSTNMQAAQIAHEAGAKRLLL
RNZ_STRPN       GASVRLAV--NADVLVHESTYGKGD-EKI-----ARNHGHSTNMQAAQVAVEAGAKRLLL
RNZ_STRMU       DASIRLAL--GADVLVHESTYSKGD-ENL-----ARRHGHSTNTEAARVAKAASVKKLLL
RNZ_LACLA       NVAVRLAY--GADLLVHEATYEANE-SKM-----AKAHGHSTTKQAADVAKEAGVNRLLL
RNZ_ALKHC       KELIPFAK--NVNVLIHEATFLDDK-KGH-----AHEYGHSTMADAIQLAKQANVDHLIL
RNZ_STAAM       SNERVISR--DADVMVHEATYIDGE-KHL-----ANNYHHSHIEDVFALIKEANVKRTLI
RNZ_STAES       ENEYELAK--NSDLMIHEATYIEGD-KKL-----ANNYHHSHIDDVFNLIKQANVNKSLI
RBN_ECOLI       DAALDLAK--GVDVMVHEATLDITM-EAK-----ANSRGHSSTRQAATLAREAGVGKLII
RBN_SALTY       EAALALAQ--GVDVMVHETTLDASM-EEK-----ANARGHSSTRQTATLAREAAVGRLIM
RNZ_PSEPK       ELLAAVAR--GADVLVHEATFTQAVVERT-----GGTFGHSTAAEVARFAEAAGVRNLVL
RNZ_BACTN       PEIVEQIK--GIDLLFHEATFAQTE-QVR-----AKETHHTTAAQAAQIALNAEVKQLVI
RNZ_PORGI       PSIVPIIQ--GVDLLYHEATFMEED-RAR-----AKETFHSTAKEAAEIARQAGAKRLLI
RNZ_METAC       EAVLEASR--DADLLIHDGSFADEMA-EW-----AEESMHSTAGEVAALAKEAGVRKLVL
RNZ_METMA       EAVLEASR--DADVLIHDGSFADEMA-GW-----AEESMHSTAGEVASLAKEAGVRQLVL
RNZ_ARCFU       KRTVEIAR--NADILIHDASFKEELK-DW-----AIESGHSTAKEAAEVAREANVKKLIL
RNZ_HALSA       DPVVSAAE--DADLLIHDATFANDAS-ER-----AAETGHSTAGEAADVATEAGAKALAL
RNZ_METJA       EDFGKYLKELGCDVLIHEATFDDSAK-DA-----AKENMHSTIGDAVNIAKLANVKALIL
RNZ_METTH       ESVIKLAE--GAELLIHESTLEAGSE-DK-----AAESGHSTAREAAEVARSAGVKRLIL
RNZ_PYRAB       ENVIQFSR--RANLLIHEATYLNS---ED-----RGESYHTTVEEACEIWKKSKAFNLAL
RNZ_PYRFU       DDIVEFSK--RADLLIHEATYISS---EH-----RKDSYHTTIEEAYEMFKSSKARHLAL
RNZ_SACS2       QSVVDSVK--GVDILIHDSTFLD--E-PS-----AYTYGHSNVTDAAKIALEASVKLLAL
RNZ_SULTO       EKVINAVK--DVDLLIHDSTFID--E-KE-----AYKYGHSNSYDAAYVALKANVKRLAL
RNZ_THEAC       DRMIEFAR--NADVLIHDTTTDSSFE-PM-----VNEFGHSSSRQAARIARQARVGRLYL
RNZ_THEVO       QKMADFAK--HADVLIHDTTTDSSFE-PA-----VNQFGHSSAKQAARIARDAGVSRLFL
RNZ_BORBU       KELIQQIK--NFNLVIIESTFKNELKKE------ADKKLHLTAGGAANIVKQAKVLQTGL
RNZ_TREPA       QSIAAEVR--NSDFFVCEGMFEKGMEKD------AAEKKHMTCVQAATIARDARVRLMAL
RNZ_CLOPE       EDIPGFIK--ESDLYICEGTYGSEEDMHK-----AIKNKHMTFKEAANLAKKGQVKELLL
RNZ_CLOTE       PELIPFVK--KSDLLICESNYGQDSDVDK-----AIKNKHMTFSQAAQIAKSGEVKELIL
RNZ_CLOAB       DSLHKFAY--KSDLFVCEGMYGEEEKKEK-----AVDKKHMIFSEAAGIAKAAEVKELWL
RNZ_CHLPN       QAAIDLAK--NSCMMLCESTYLEQH-RHL-----AESHFHMTAKQAATLAKRAATQKLIL
RNZ_CHLTR       QAIVDLAR--NARILLCESTYLEEH-SHL-----AKSHYHMTAKQAAEQAKRAEVQQLIL
RNZ_STRAW       EGVHALAE--GCDMLVIESTFLDGD-HQL-----AEDHGHLTAGQAGRVAKDAGVRHLVL
RNZ_STRCO       EGVHALAE--DSDLLVIESTFLDED-ETL-----ATDHGHLTAGQAARVARDAGVRHLVL
RNZ_BRADU       EGLSQYVA--DADMLVIEATFLDRD-ASI-----ARDYGHLTAAEAAAFAAANNVGQLVL
RNZ_MYCBO       DSLDQLAA--GADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVM
RNZ_MYCTU       DSLDQLAA--GADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVM
RNZ_AERPE       TRVAKFLH--GSDILIHDSTLDSSL--ARE----AAERGHSTSLDAARNALTSGAKLLIL
RNZ_PYRAE       PEMWKKVG--SVDVLIHEATFADDVSPSK-----AHEEGHSTVADAIEAARALNAQVLIL
                                                       *     .             :

RNZ_NOSS1       THFSPRYAPGNTIE-LKDLLQEAR--AIFPRTDMAYDFMTYEVPRRREPVFSSVSSSSV-
RNZ_SYNY3       THFSPRYAPGNPLQ-LENLLAEAQ--AIFPNTRLARDFLTVEIPRRTADPAIAMSTPQAS
RNZ_PROMM       THLSPRYAPGNPVT-PNDLLREAQ--AIFSNTILAKDFLSFEVAPRCNSS----------
RNZ_PARMW       THLSPRYVPGNPVS-PDDLLKEAQ--AIFPNTVLAKDFLSLDVKPCCNSS----------
RNZ_PROMA       THLSPRYAPGNRIS-PNDLLSEAK--SIFPNTLLAKDFLQIEIQKHATVRDT--------
RNZ_PROMP       THLSPRYTQRSSIK-PSDLLKEAQ--KIFPNTYLAKDFLTAEIK----------------
RNZ_GLOVI       THFSPRYEAG-----LAALRTEAE--AIFPNVRMAEDFWRYEIKAVEAQLPKALVEQ---
RNZ_BACAN       THISSRYQGDT----YKELLKEAR--ELFSNTEIATDLKSFPVDR---------------
RNZ_BACCR       THISSRYQGDT----YKELLKEAR--ELFSNTEIATDLKSFPVEK---------------
RNZ_BACSU       THISARYQGDA----SLELQKEAV--DVFPNSVAAYDFLEVNVPRG--------------
RNZ_LISIN       THISSRYDRDA----SKELLIEAK--TVFENTEIAYDLAVFQVGE---------------
RNZ_LISMO       THISSRYDRDA----SKELLIEAK--TIFENTEIAYDLAVFQVGE---------------
RNZ_OCEIH       THVSSRYQAED----IDSIIEEAR--KIFPSTWLANDFSVYEI-----------------
RNZ_ENTFA       THISARYLTKE----AYQLQEEAQ--EIFPNTKIVKDMDIIEIPFANEGGA---------
RNZ_LACPL       THISARYTGKL----SKELQKQAQ--KVFSHSKVVRDFDVIDIPLPEKG-----------
RNZ_STRA3       NHVSARFMGRD----CWQMEEDAK--TIFSNTHLVRDLEEVGI-----------------
RNZ_STRP1       NHVSARFLGRD----CRQMEKDAA--TIFENVKMVQDLEEVII-----------------
RNZ_STRPN       NHISARFLSKD----ISKLKKDAA--TIFENVHVVKDLEEVEI-----------------
RNZ_STRMU       NHISARFLSHD----ISRMRDDAQ--EIFTDVHIVRDLEEVKL-----------------
RNZ_LACLA       THISARYVGPL----VGQLVREAQ--TVHSNTFVVKDFYEEKIG----------------
RNZ_ALKHC       THISSRYH-DM----SDELQKKAQ--NAFANAVVAHDFYVFHLPLAKG------------
RNZ_STAAM       THLSNRYNTED----INEIYQILIQNEDTPNFNFVKDFDSFKV-----------------
RNZ_STAES       THISNRYNIDE----VTSIYNELSLDQTSPHFYFVKDFDTFKI-----------------
RBN_ECOLI       THVSSRYDDKG----CQHLLRECR--SIFPATELANDFTVFNV-----------------
RBN_SALTY       THISSRYDDKG----CQRLLAECR--AIFPATELAYDFSVFPV-----------------
RNZ_PSEPK       THFSARYQNDPRRSPHIDNVRDEALAHYSGQLTLAQDLQRYHLGRNGLLEASA-------
RNZ_BACTN       GHFSARYEDES------VLLNEAA--AIFPQTVLARENMCITINNYTDTRDYDPL-----
RNZ_PORGI       GHYSGRYKDVQ------GLLEEAQ--SVFKPTIAANERMRIDL-----------------
RNZ_METAC       THISSRYT--D---DVEPILKDSKKVFE--NVIVAEDLMELEIPYRPE------------
RNZ_METMA       THISSRYT--D---DVGPILNDSRKVFE--NVIVAEDLMELEVPYRPD------------
RNZ_ARCFU       THISTRYS--K---DASPLLEEAKKVFE--NTIIAEDFMSLEVTFDES------------
RNZ_HALSA       THVSSRYA--G---DASEISAGASGFDG--EAFVAHDGLTHEIPFPDAD-----------
RNZ_METJA       THISARYD--K---EEYF-NLYKMNVKQ--YNESFKIIISEDLKSYDIKKDLLG------
RNZ_METTH       THLSTRYK--R---TEVI-LEAARQVFP--VTDVADDLMTVEVKAYDSSPDS--------
RNZ_PYRAB       FHRGPRYS--F---KEY--KEGATKLCP--QAMIPRDFDRIMVKGAEYVIFKVR------
RNZ_PYRFU       FHRAPRYS--Y---QEY--AVAAKELCP--EAYVPRDFDRVFVGGMGNVIFKVR------
RNZ_SACS2       THISPRYE--D---VSEH-LKMARRIFP--KSILPDDLSYITIK----------------
RNZ_SULTO       FHISPRYD--D---TYEM-LIKAKRIFE--KTFVAEPLSYYIIRQKE-------------
RNZ_THEAC       YHYSPRIT--D---TSVL-LEDARKEFQ--ETYESKDLMEYEVKVRRDVD----------
RNZ_THEVO       YHYSPRIT--D---VSPL-VDDARAEFQ--ESYASEDLMEYEVKVKH-------------
RNZ_BORBU       IHFSERYTLRK---DLENLLKEAKLEHPDGEIFLTRDGMRLEANKNNFIIK---------
RNZ_TREPA       IHYSPRYT-DH---ELKRLLKEAQRVFP--HTILSRDQLMVPIAYRE-------------
RNZ_CLOPE       THFSPSIN------DPKEFINNAREVFE--NLHAGSDGEERVLNFKE-------------
RNZ_CLOTE       THFSPAIE------DPEEFIHFAKDIFP--KAQIGKDRMIISIDFQN-------------
RNZ_CLOAB       THFSPALS------EPEKYLENAKEIFE--NTHIGSDRKIKIINFENN------------
RNZ_CHLPN       THFSARYL-N-----LDDFYKEASA--VFPNVSVAQEYRSYPFPKNPLLNK---------
RNZ_CHLTR       THFSARYN-T-----TEEFVQEAGE--IFPNVFAAEEFCSYEFPKNPS------------
RNZ_STRAW       THFSQRYS-D-----PDAFEREARAGGFEGELTVAHDLLRVPVPKRH-------------
RNZ_STRCO       THFSQRYS-D-----PEEFGRQARAAGYAGELTVARDLTRVPVPKRR-------------
RNZ_BRADU       THMSGRYE-------DEEILAEAARIFP--NSRIAADFDHIVV-----------------
RNZ_MYCBO       THYVPAIGPGQ-----EEQWRALAATEFSGRIEVGNDLHRVEVHPRR-------------
RNZ_MYCTU       THYVPAIGPGQ-----EEQWRALAATEFSGRIEVGNDLHRVEVHPRR-------------
RNZ_AERPE       FHVSSRYSGYE----ARLLLKEAR--RVFPNTVLSWDGMKLSITI---------------
RNZ_PYRAE       THVSARYP-D-----KSRHRELASRISPPPYIYIPEDFETLLVKL---------------
                 *                                                          

RNZ_NOSS1       --
RNZ_SYNY3       PA
RNZ_PROMM       --
RNZ_PARMW       --
RNZ_PROMA       --
RNZ_PROMP       --
RNZ_GLOVI       --
RNZ_BACAN       --
RNZ_BACCR       --
RNZ_BACSU       --
RNZ_LISIN       --
RNZ_LISMO       --
RNZ_OCEIH       --
RNZ_ENTFA       --
RNZ_LACPL       --
RNZ_STRA3       --
RNZ_STRP1       --
RNZ_STRPN       --
RNZ_STRMU       --
RNZ_LACLA       --
RNZ_ALKHC       --
RNZ_STAAM       --
RNZ_STAES       --
RBN_ECOLI       --
RBN_SALTY       --
RNZ_PSEPK       --
RNZ_BACTN       --
RNZ_PORGI       --
RNZ_METAC       --
RNZ_METMA       --
RNZ_ARCFU       --
RNZ_HALSA       --
RNZ_METJA       --
RNZ_METTH       --
RNZ_PYRAB       --
RNZ_PYRFU       --
RNZ_SACS2       --
RNZ_SULTO       --
RNZ_THEAC       --
RNZ_THEVO       --
RNZ_BORBU       --
RNZ_TREPA       --
RNZ_CLOPE       --
RNZ_CLOTE       --
RNZ_CLOAB       --
RNZ_CHLPN       --
RNZ_CHLTR       --
RNZ_STRAW       --
RNZ_STRCO       --
RNZ_BRADU       --
RNZ_MYCBO       --
RNZ_MYCTU       --
RNZ_AERPE       --
RNZ_PYRAE       --