CLUSTAL format seed alignment for MF_01820

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSGA1_NOSS1      -------------------------------------MRVFTTGQLLGTVVAVQANFYKV
RSGA_SYNY3       ----------------------------------------MTKATDEGTVIAVQANYYWV
RSGA_THEEB       ------------------------------------------MSHLVGLVRAVQANYYRV
RSGA_PROMA       -------------------------------------MLEINKDRIKGIVLALKANYYIV
RSGA_BACAN       --------------------------------------------MPEGKIVKALSGFYYV
RSGA_BACC1       --------------------------------------------MPEGKIVKALSGFYYV
RSGA_BACCR       --------------------------------------------MPEGKIIKALSGFYYV
RSGA_BACSU       --------------------------------------------MPEGKIIKALSGFYYV
RSGA_BACHD       --------------------------------------------MPKGTIVKALSGFYYV
RSGA2_OCEIH      --------------------------------------------MAEGRIIKALSGFYYV
RSGA1_LISMF      --------------------------------------------MLEGQIIKALSGFYYV
RSGA2_LISMO      --------------------------------------------MLEGQIIKALSGFYYV
RSGA2_LISIN      --------------------------------------------MLEGQIIKALSGFYYV
RSGA_ENTFA       ------------------------------------------MVYLKGQIRKALSGFYYV
RSGA1_LACPL      --------------------------------------------MKIGQIRQSLSGFYDV
RSGA_STRA3       ---------------------------------------------MQGRIVKSLAGFYYV
RSGA_STRA5       ---------------------------------------------MQGRIVKSLAGFYYV
RSGA_STRP1       ---------------------------------------------MQGKIIKSLAGFYYV
RSGA_STRP3       ---------------------------------------------MQGKIIKSLAGFYYV
RSGA_STRP6       ---------------------------------------------MQGKIIKSLAGFYYV
RSGA_STRP8       ---------------------------------------------MQGKIIKSLAGFYYV
RSGA_STRPN       ---------------------------------------------MQGQIIKALAGFYYV
RSGA_STRR6       ---------------------------------------------MQGQIIKALAGFYYV
RSGA_STRMU       ---------------------------------------------MQGKIIESLAGFYYV
RSGA_LACLA       -------------------------------------------MIKNGRIVKSLAGFYDV
RSGA_STAAM       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAAN       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAAS       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAAW       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAAC       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAAR       --------------------------------------------MKTGRIVKSISGVYQV
RSGA_STAHJ       --------------------------------------------METGRIIKLISGVYQV
RSGA_STAES       --------------------------------------------MKTGRIVKLISGVYQV
RSGA_STAEQ       --------------------------------------------MKTGRIVKLISGVYQV
RSGA_STAS1       --------------------------------------------MKTGRIIKSISGVYRV
RSGA_LACJO       ------------------------------------------MKKAEGTIISAISGYYDV
RSGA_MYCPU       ---------------------------------------------MIGRVYQVISGFYDI
RSGA_MYCPE       ---------------------------------------------MNAKILFKIANSFLL
RSGA_UREPA       ---------------------------------------------MRAKIISVVANNFYV
RSGA_MYCGA       ---------------------------------------------MIARILSINANDLFC
RSGA_MYCGE       -----------------------------------------MPDSNFGIVLQSLAKQCKV
RSGA_MYCPN       -----------------------------------------MSIRKTGIVFQRFGKQFKV
RSGA_CLOAB       ---------------------------------------------MQGIIIKGIAGFYYV
RSGA_CLOPE       ---------------------------------------------MEGIIIKGIGGFYYI
RSGA_CLOTE       ---------------------------------------------MQGIITKGIGGFYYI
RSGA_CALS4       ------------------------------------------MERIQGRIVRGIAGFYYV
RSGA_FUSNN       -------------------------------------------------MINKIQGFYYV
RSGA_AQUAE       ---------------------------------------MGKKELKRGLVVDREAQMIGV
RSGA_THEMA       ---------------------------------------MNLR--RRGIVVSFHSNMVTV
RSGA_BORBU       ------------------------------------------MNYLEFEVIWGVNNIYSI
RSGA2_BACTN      ---------------------------------------------MKGLVIKNTGSWYQV
RSGA_PORGI       ---------------------------------------------MDGVVIKNTGSQYLV
RSGA_CHLTE       -----------------------------------------MKETLSGVVTRVTGASYIV
RSGA_BORPE       --------------------MSSNQ--------------------AEGLIIAAHGRHYTV
RSGA_BORBR       --------------------MSSNQ--------------------AEGLIIAAHGRHYTV
RSGA_BORPA       --------------------MSSNQ--------------------AEGLIIAAHGRHYTV
RSGA_RALSO       ------MTRGKPGRAGHDRRHASTG--------------------EHGLVIAAHGRHYLV
RSGA_NEIMA       ----MPSEHPFSDGISTPNPKETMN--------------------DTAQITASYGRRYIV
RSGA_NEIMB       ----MPSEHPFSDGIPTPNPKETMN--------------------DTAQITASYGRRYIV
RSGA_NITEU       ------------MSVGADRKKTGTS--------------------LTGKVVAAYGRHFEV
RSGA_ECO57       MSKNK-LSKGQQRRVNANHQRRLKT-----SKEKPDYDDNLFGEPDEGIVISRFGMHADV
RSGA_SHIFL       MSKNK-LSKGQQRRVNANHQRRLKT-----SKEKPDYDDNLFGEPDEGIVISRFGMHADV
RSGA_ECOLI       MSKNK-LSKGQQRRVNANHQRRLKT-----SKEKPDYDDNLFGEPDEGIVISRFGMHADV
RSGA_ECOL6       MSKNK-LSKGQQRRVNANHQRRLKT-----SKEKPDYDDNLFGEPDEGIVISRFGMHADV
RSGA_SALTI       MSKNK-LSKGQQRRVNANHQRRLKT-----SAEKADYDDNLFGEPAEGIVISRFGMHADV
RSGA_SALTY       MSKNK-LSKGQQRRVNANHQRRLKT-----SAEKADYDDNLFGEPAEGIVISRFGMHADV
RSGA_YERPE       MSKNK-LSKGQQRRVQANHQRRLRT-----DR-KPELDDSQLGDAQEGIVISRFGQHADV
RSGA_PECAS       MSKKK-LSKGQQRRVSANHQRRLKK-----TESKVEWEDSQLGDAQEGIIISRFGMHADV
RSGA1_VIBVU      MAKKKKLTQGQVRRVRDNQQKRLKK-----QADTIQWDEAMLGDSRRGLVITRFGQHADI
RSGA1_VIBVY      MAKKKKLTQGQVRRVRDNQQKRLKK-----QADTIQWDEAMLGDSRRGLVITRFGQHADI
RSGA1_VIBPA      MAKKKKLTKGQVRRVRSNQQKRLKK-----QEESIQWDENMLGASKQGLVITRFGQHADI
RSGA_VIBCH       MTKKKKLTHGQVRRVRNNQHKKLK------QEESIVWDEALLGSAQPGLVITRFGQHADI
RSGA_SHEON       MSKKKPLSQGQLRRMRANHEKRLNRDSG--DKNTPELQDSSLGPEQSGTVISRFGQHADI
RSGA_HAEIN       MAKRK-LTQNQTRRIQSNNAKTLHRHK----KKEIEWSDEMLGESQEGVVVTRYSIHADV
RSGA_PASMU       MSKRK-LTQNQKRRIQSNNEKTLHRHQRR-EKKEIDWQDDMLGESQDGIVVTRYSVHADV
RSGA_HAEDU       MSKHR-LTQNQQRRINANHHKKITRSK-------FEWQDDMLGEIQAGTIVTRHAKHADV
RSGA_PSEPK       MAKRQ-LNRRQNWRIEKIQGERAARAAKREQHALQELEGGDLGPEQLGLVIAHFGVQVEV
RSGA_PSESM       MAKRQ-LNRRQNWRIEKIQGERAARAAKRESVTLETLEGGDLGPEQTGLVIAHFGVQVEV
RSGA_PSEAE       MAKRH-LTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEV
RSGA2_NOSS1      ---------------------MNLDLLGWSDFFTHSFVPYRQQGFSVGRVAIEYRNTYIV
RSGA1_OCEIH      ---------------------MNLNEFQQKYAYRKE-INYDGQIDLLARVVMEQKERYIL
RSGA2_LACPL      ---------------------MTINLIKYGLTTAVQADLTKENGQILGRIIGQHRDWYQV
RSGA2_LISMF      ---------------------MTLEQYGFTNFFKEQ---KIAATSSYGRVTAVFRDYYRV
RSGA1_LISMO      ---------------------MILEQYGITSFFKEQ---KIAATSSYGRVTAVFRDYYRV
RSGA1_LISIN      ---------------------MILEKYGFTSFFEEQ---KIAATSSYGRVTAVFRDFYRV
RSGA2_VIBVU      ----------MTS-----SQPYTLTQLGWKPFFQQQLTLEDYENTQICRIVAHHRSGYQL
RSGA2_VIBVY      ------MNNTMTS-----SQPYTLTQLGWKPFFQQQLTLEDYENTQICRIVAHHRSGYQL
RSGA2_VIBPA      ------MNQTHTFCDTLISTSNPLKQLGWKPFFQQQLTLDDYDNTIFARVIAHHRSGYLL
RSGA_RHILO       ----------MPLVEAVTASSPSLADLGWSEFFGDQLEASD-ANLIPTRIAMVHRDRLSG
RSGA_XANAC       --------MSDTSPDYPTLQSIGWPWLGPPEEAAWQAVFAAHPQALPARVVEQHRTGYVV
RSGA_XANCP       --------MSDTSPNYHTLQSIGWPWPGPPEDPAWQAIFAAHPQALPARVVEQHRTGYVV
RSGA_XYLFA       --------MIEPVVGYRMLQAIGWPWPGPPADAAWQAMCAVYSQCRPARVIEQHRSGYVV
RSGA_XYLFT       --------MIEPVVGYRMLQAIGWPWPGPPADSAWQAMCAMYSQCRPARVIEQHRSGYVV
RSGA_STRAW       -------MSLSSLPGSFSSSSHPLVPYGWDADWEAEFAPYDSEGLLAGRVIRVDRGQCDV
RSGA_STRCO       -------MTSTSSHSNHSA----LSSYGWDDSWADAFAPYAAEGLLPGRVVRVDRGQCDV
RSGA_LEPIC       ----MSQPNSILMSY------------GWDPSIYLE-EPKLLEGLKPGRVLAVYGEYSKI
RSGA_LEPIN       ----MSQPNSILMSY------------GWDPSIYLE-EPKLLEGLKPGRVLAVYGEYSKI
RSGA_METAC       ----MNNHSETESSGHNSVHGNNDNIPGWNEELELA-FSAYKGLYLAGRISSRHKTVCEV
RSGA_METMA       ----MNNHSEAESSG----HGDNDTIPGWNEELELA-FSAYKGSYVPGRVASRHKTVCDV
RSGA1_BACTN      ----------------MSNENNNLSLYGWSDNLFRQKQISQYKDMSHGRIIVTHKTCYEV
RSGA_RHOBA       -------------------------------------MSVDEDNLLQGRVLSVHGLQSKV
                                                                  :          

RSGA1_NOSS1      QLDQEVREQGSRGAGEEVHLDSPLPLCPLSLLLCTRRTRLKKIGQQVMVGDRVVVEEPD-
RSGA_SYNY3       RLRNVTSQP----------------------LLCTRRTRLKKVGQKVMVGDQVRVELPPS
RSGA_THEEB       RLREPSNGVEE--------------------LLCVRRARLKKMGQQVCVGDWVVVSHPD-
RSGA_PROMA       QIDTINLIPELFKKKIGDHN---------FRLLCTKRSRLSYKGHSVSVGDFVLIEAID-
RSGA_BACAN       QHE-------------------------EGITQCRGRGVFRKNKITPLVGDQVVFQADNP
RSGA_BACC1       QHE-------------------------EGITQCRGRGVFRKNKITPLVGDQVVFQADNP
RSGA_BACCR       QHE-------------------------EGVTQCRGRGVFRKNKITPLVGDQVVFQADNP
RSGA_BACSU       LDESE---------------------DSDKVIQCRGRGIFRKNKITPLVGDYVVYQAEND
RSGA_BACHD       QNE-------------------------DGLFQCRGRGNFRNRNIKPLVGDEVVFEAENK
RSGA2_OCEIH      QSD-------------------------NQQFVCKGRGLFRNKKITPLVGDYVEFEPKDD
RSGA1_LISMF      FSE-------------------------GKVYQCRARGNFRKRNISPLVGDDVEFQIENK
RSGA2_LISMO      FSE-------------------------GKVYQCRARGNFRKRNISPLVGDDVEFQIENK
RSGA2_LISIN      FSE-------------------------GKIYQCRARGNFRKRNISPLVGDDVEFQVENK
RSGA_ENTFA       YAD-------------------------GETYQTRARGNFRNRKITPLVGDEVLFESDNL
RSGA1_LACPL      YAD-------------------------GQMYRTRARGNFRKRRITPLVGDNVEFDAATP
RSGA_STRA3       ESD-------------------------GVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQ
RSGA_STRA5       ESD-------------------------GVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQ
RSGA_STRP1       ESE-------------------------GQVYQTRARGNFRKRGETPYVGDIVDFSAEDN
RSGA_STRP3       ESE-------------------------GQVYQTRARGNFRKRGETPYVGDIVDFSAEDN
RSGA_STRP6       ESE-------------------------GQVYQTRARGNFRKRGETPYVGDIVDFSAEDN
RSGA_STRP8       ESE-------------------------GQVYQTRARGNFRKRGETPYVGDIVDFSAEDN
RSGA_STRPN       ESD-------------------------GQVYQTRARGNFRKKGHTPYVGDWVDFSAEEN
RSGA_STRR6       ESD-------------------------GQVYQTRARGNFRKKGHTPYVGDWVDFSAEEN
RSGA_STRMU       ESD-------------------------GQIYQTRARGNFRKKGHKPYVGDEVDFSAKEN
RSGA_LACLA       ESE-------------------------GEVYQTRARGNFRKKGMKPVVGDFVEFSTEEN
RSGA_STAAM       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFEVQNI
RSGA_STAAN       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFEVQNI
RSGA_STAAS       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFEVQNI
RSGA_STAAW       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFEVQNI
RSGA_STAAC       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFEVQNI
RSGA_STAAR       DVN-------------------------GERFNTKPRGLFRKKKFSPVVGDIVEFDVQNI
RSGA_STAHJ       DVD-------------------------GTLYDTKPRGLFRKKKFSPIVGDIVDFEIQNT
RSGA_STAES       DVE-------------------------GERFDTKPRGLFRKKKFSPVVGDIVDFEVQNT
RSGA_STAEQ       DVE-------------------------GERFDTKPRGLFRKKKFSPVVGDIVDFEVQNT
RSGA_STAS1       DVD-------------------------GEMYDTKPRGLFRKNKFSPIVGDVVDFEVENV
RSGA_LACJO       EID-------------------------NKVVRTRARGVFRDRKQKPLVGDRVVVQLDDQ
RSGA_MYCPU       KCE-------------------------DKFYRVRAIGNLRNLKLNPVVGDLVVFDES--
RSGA_MYCPE       YDLST---------------------KSQFNAVIRKKLKQEDRIIT--VGDNVEFVKDQ-
RSGA_UREPA       HLYDL---------------------KIQIKAIPKGIFKHNSHELKPMVGDDVEVELIG-
RSGA_MYCGA       EVNHE---------------------LKKLHAPGRWKHQKINLAPN-------DLLELN-
RSGA_MYCGE       FWNNQ---------------------IITAFPQKKLQWKNDFKLMV-------GDRVQL-
RSGA_MYCPN       FVENQ---------------------TLVAFAQKKLQWKRDFKLLV-------GDKVTL-
RSGA_CLOAB       KVEEE-----------------------IYECKARGKFRL--GELSPIVGDKVDITVIN-
RSGA_CLOPE       KTDEG-----------------------IIECKARGKFRY--NSLKPMVGDRVTIKVEN-
RSGA_CLOTE       KTEDG-----------------------LYECKARGKFRL--DELTPMVGDKVEIEIDNN
RSGA_CALS4       ATERG-----------------------IIECRARGKFRK--DNIIPLVGDIAEVQLVNE
RSGA_FUSNN       ESNGQ-----------------------VFECKLRGILKKTNNKYNCVVGDRVEISEDN-
RSGA_AQUAE       YLFED-----------------------GKTYRGIPRGK-VLKKTKINAGDYVWGEVVDP
RSGA_THEMA       EDEET-----------------------GERILCKLRGKFRLQNLKIYVGDRVEYTPDET
RSGA_BORBU       LELNSKLIY-------------------EGIFKGKVLETGCKEYSPLVPGDIVLGYIYSS
RSGA2_BACTN      KTDDGQ--------------------FIECKIKGNFRLKGIRSTNPVAVGDRVQIILN-Q
RSGA_PORGI       RCTDGT--------------------ELYCMAKGNLRLKGIRSTNPVTVGDRVEIVPASQ
RSGA_CHLTE       ETGDGL---------------------KVRCRTVPGTVSENEGSNLVAVGDRVEFRPKAS
RSGA_BORPE       ELAD----------------------------GSLRQCFPRGKKNGPAVGDRVRITPQGR
RSGA_BORBR       ELAD----------------------------GSLRQCFPRGKKNGPAVGDRVRITPQGR
RSGA_BORPA       ELAD----------------------------GSLRQCFPRGKKNGPAVGDRVRITPQGR
RSGA_RALSO       ERKG----------------------------GGLLQCFPRGKRSECAVGDRVIFEATAV
RSGA_NEIMA       RTPD----------------------------GTTYEASTRKKRVDFACGDRVRISPVNA
RSGA_NEIMB       RTPD----------------------------GTTYEASTRKKRVDFACGDRVRISPVNA
RSGA_NITEU       EVAG----------------------------GTIYSCVVRGKKKGVVCGDEVEILPATG
RSGA_ECO57       ESAD----------------------------GDVHRCNIRRTIRSLVTGDRVVWRPGKP
RSGA_SHIFL       ESAD----------------------------GDVHRCNIRRTIRSLVTGDRVVWRPGKP
RSGA_ECOLI       ESAD----------------------------GDVHRCNIRRTIRSLVTGDRVVWRPGKP
RSGA_ECOL6       ESAD----------------------------GDVHRCNIRRTIRSLVTGDRVVWRPGKP
RSGA_SALTI       ESAD----------------------------GEVHRCNIRRTIRSLVTGDRVVWRPGKA
RSGA_SALTY       ESAD----------------------------GEVHRCNIRRTIRSLVTGDRVVWRPGKA
RSGA_YERPE       EAVD----------------------------GTQHRCNIRRTIKSLVTGDRVVWRPGLQ
RSGA_PECAS       EATD----------------------------GVVRRCNIRRTISSLVTGDRVVWRPGHE
RSGA1_VIBVU      EDAET---------------------------GLIERCNLRRGIESLVSGDKVIWRKGLE
RSGA1_VIBVY      EDAET---------------------------GLIERCNLRRGIESLVSGDKVIWRKGLE
RSGA1_VIBPA      EDLET---------------------------GEVQRCNLRRGIESLVSGDRVLWREGLE
RSGA_VIBCH       EDPVT---------------------------GEIHRCNLRRGIESLVSGDNVLWRPGAE
RSGA_SHEON       ETED----------------------------GHIVRCNIRRTITSLVTGDKVIVRLAIE
RSGA_HAEIN       ENEQ----------------------------GEIYRCNLRRTLSSLVVGDKVVWRKGNE
RSGA_PASMU       EDAA----------------------------GEIFRCNLRRTLSSLVVGDRVIWRKGNA
RSGA_HAEDU       EAEN----------------------------GEIIRCNLRRTLKNVVVGDHVSWRKGSQ
RSGA_PSEPK       EAQDGET------------------------AGQVFRCHLRANLPALVTGDRVVWRAGNQ
RSGA_PSESM       EAQEGED------------------------VGKVFRCHLRANLPALVTGDRVVWRAGNQ
RSGA_PSEAE       ESADG----------------------------QVSRCHLRANLPALVTGDQVVWRAGNQ
RSGA2_NOSS1      YSKQGELA---------------------AKVTGKLRHQATQPQDFPAVGDWVIIQTRES
RSGA1_OCEIH      QTINGFKP---------------------AVVKGKMRHEAISREDYPAVGDWVVLQEKDF
RSGA2_LACPL      ITTAGERS---------------------AQVTGKLAYEAASPAAFPAVGDWVCLSS-SA
RSGA2_LISMF      ITENEEFL---------------------ASLKRGNFYELSS-TSLPAVGDFVEVSS---
RSGA1_LISMO      ITENEEFL---------------------ASLKRGNFYELSS-TSLPTVGDFVEISG---
RSGA1_LISIN      ITENGEFL---------------------ATLKRGNFYELSP-SNLPAVGDFVEVSN---
RSGA2_VIBVU      CSEQGR-----------------------------FHLAIHHAQPKMTVGDWVLLDE---
RSGA2_VIBVY      CSEQGR-----------------------------FHLAIHHAQPKMTVGDWVLLDE---
RSGA2_VIBPA      ATEAGQ-----------------------------VHLNVHHSLPNMTVGDWVILNE---
RSGA_RHILO       LSQTGQT---------------------------DLSLAPQATTGDYAVGDWVLVEP---
RSGA_XANAC       ADTPEASVK--------------------AESLPEWQRPRFPSHERAAVGDWVLME----
RSGA_XANCP       ADTPEASLK--------------------AESLPEWQRPRFPSHERAAVGDWVLME----
RSGA_XYLFA       AEAPEVPIK--------------------VESLPAWQRRGFPRHERAVVGDWVLLD----
RSGA_XYLFT       AEAPEVPIK--------------------VESLPAWQRRSFPPHERAVVGDWVLLD----
RSGA_STRAW       VTPGGMLR------------------------ADTAFVTPHDPMRVVCTGDWVAVEP--A
RSGA_STRCO       VTADGVLR------------------------ADTAFVTPHDPLRVVCTGDWVAVEP--G
RSGA_LEPIC       IIEQGEKK-------------------------GIFSGALMASGESIVTGDWVLIREIEG
RSGA_LEPIN       IIEQGEKK-------------------------GIFSGALMASGESIVTGDWVLIREIEG
RSGA_METAC       LVPGAVVQ-------------------------AGISGALQRIGKQPVVGDFVVLLDQPE
RSGA_METMA       LLPAAVVQ-------------------------AGISGALQKIGKQPVVGDFVVVLDQPE
RSGA1_BACTN      VAEDGVYL----------------------CELTGNMIYGRVPDEYPCTGDWVIFQP-FD
RSGA_RHOBA       LGDNG--------------------VLYACAVRQVLKSLSTSQRNVIVAGDRVWFRSESR
                                                                             

RSGA1_NOSS1      ---------------WAGGRGAIADVLSRQTQLDRPP--------------IANADQILL
RSGA_SYNY3       LLLHGRSNTAPVPMVAEGDLGAIAKVYPRRTVLERPP--------------VANAEQICL
RSGA_THEEB       ---------------WPGQRGAIAEILPRRNQLSRPA--------------IANVDQILL
RSGA_PROMA       ---------------WTAETGVISFVEPRKNLITRPP--------------VANVTDVII
RSGA_BACAN       ------------------SEGYVLEVFDRKNELVRPP--------------IANVDQAIL
RSGA_BACC1       ------------------SEGYVLEVFDRKNELVRPP--------------IANVDQAIL
RSGA_BACCR       ------------------TEGYVLEVFDRKNELVRPP--------------IANVDQAIL
RSGA_BACSU       ------------------KEGYLMEIKERTNELIRPP--------------ICNVDQAVL
RSGA_BACHD       ------------------TDGYVLEIMERKNELLRPP--------------IANVDRAIL
RSGA2_OCEIH      ------------------NEGYIMEIKERSNELVRPP--------------IANIDQAII
RSGA1_LISMF      ------------------TDGYILDVMSRENALVRPP--------------VANIDIAIL
RSGA2_LISMO      ------------------TDGYILDVMSRENALVRPP--------------VANIDIAIL
RSGA2_LISIN      ------------------TDGYILDVLSRENALVRPP--------------VANIDIAIL
RSGA_ENTFA       ------------------TDGYVLEILPRRNELVRPP--------------VANVDLGVV
RSGA1_LACPL      ------------------QEGYVLNILDRQTQLVRPP--------------VANVDLGIV
RSGA_STRA3       ------------------SEGYILSIEERKNSLVRPP--------------IVNIDQAVV
RSGA_STRA5       ------------------SEGYILSIEERKNSLVRPP--------------IVNIDQAVV
RSGA_STRP1       ------------------SEGYILAIHPRKNSLVRPP--------------IVNIDQAVV
RSGA_STRP3       ------------------SEGYILAIYPRKNSLVRPP--------------IVNIDQAVV
RSGA_STRP6       ------------------SEGYILAIHPRKNSLVRPP--------------IVNIDQAVV
RSGA_STRP8       ------------------SEGYILAIHPRKNSLVRPP--------------IVNIDQAVV
RSGA_STRPN       ------------------SEGYILKIHERKNSLVRPP--------------IVNIDQAVV
RSGA_STRR6       ------------------SEGYILKIHERKNSLVRPP--------------IVNIDQAVV
RSGA_STRMU       ------------------SEGYILAIHERKNSLVRPP--------------IVNIDQAVV
RSGA_LACLA       ------------------SEGYILKIGERKNSLIRPS--------------IANIDQAVI
RSGA_STAAM       ------------------NEGYIHQVFERKNELKRPP--------------VSNIDTLVI
RSGA_STAAN       ------------------NEGYIHQVFERKNELKRPP--------------VSNIDTLVI
RSGA_STAAS       ------------------NEGYIHQVFERKNELKRPP--------------VSNIDTLVI
RSGA_STAAW       ------------------NEGYIHQVFERKNELKRPP--------------VSNIDTLVI
RSGA_STAAC       ------------------NEGYIHQVFERENELKRPP--------------VSNIDTLVI
RSGA_STAAR       ------------------NEGYIHQVYERKNELKRPP--------------VSNIDTLVI
RSGA_STAHJ       ------------------SEGYIHHVHERHNELKRPP--------------VSNIDGLII
RSGA_STAES       ------------------KEGYIHHVHDRNNELKRPP--------------VSNIDELVI
RSGA_STAEQ       ------------------KEGYIHHVHDRNNELKRPP--------------VSNIDELVI
RSGA_STAS1       ------------------TEGYIHHVHERKNEIKRPP--------------VSNVDHLII
RSGA_LACJO       ------------------GMNYLIEILPRINEIGRPA--------------VANVSRVLL
RSGA_MYCPU       ----------------------LTKIEPRKNILIRPK--------------VANIDQAII
RSGA_MYCPE       ------------------YEYVIEKIDERKNLLIRPK--------------VANIDTLII
RSGA_UREPA       ------------------NTYLITKIYERYNQLIRPK--------------VANIDIVLI
RSGA_MYCGA       ------------------DQGEIIKLIERKNYLNRPK--------------VANLDHVVL
RSGA_MYCGE       ------------------EDGAITKVLARKNELTRPR--------------VANVDQIVL
RSGA_MYCPN       ------------------ENGVIVAVEERKNTLVRPK--------------VVNVDQVVI
RSGA_CLOAB       ------------------GKGVIEKIHPRTNKLIRPP--------------VSNVTQAFI
RSGA_CLOPE       ------------------GKGVIEDIHERSSELIRPT--------------VANVTQAFV
RSGA_CLOTE       ------------------SKGTIEKIFERKNKLIRPA--------------VSNISQAII
RSGA_CALS4       ------------------KEGYILEILPRKNQLVRPP--------------VANVDQAII
RSGA_FUSNN       ---------------------SIVEIFKRDNLLIRPI--------------VANVDYLAI
RSGA_AQUAE       ------------------NTFAIEEVEERKNLLIRPK--------------VANVDRVII
RSGA_THEMA       ------------------GSGVIENVLHRKNLLTKPH--------------VANVDQVIL
RSGA_BORBU       RK---------VYIDKRLSRKNILWRYNKKADLRQTI--------------VSNIDNVLI
RSGA2_BACTN      EG-----------------TAFINEIEDRKNYIIRRSSNLSKQSH----ILAANLDQCML
RSGA_PORGI       DGQ----------------PAYIKRIHPRRNYIIRRASNLSKESH----ILGANLDAAVL
RSGA_CHLTE       ETD--------------MAEGVITRVEERRTALVRRREVRRNRSKEKEQVIVANIDQLVL
RSGA_BORPE       DE------------------GAIEAVLPRRNLLFRSD------EMR-VKQFAANVDQLLI
RSGA_BORBR       DE------------------GAIEAVLPRRNLLFRSD------EMR-VKQFAANVDQLLI
RSGA_BORPA       DE------------------GAIEAVLPRRNLLFRSD------EMR-VKQFAANVDQLLI
RSGA_RALSO       DQ------------------GVVVRVEERRNLLHRSD------QFK-SKQLAANIDQVLI
RSGA_NEIMA       EQ------------------VVIEDFLPRQSLLYRQD------AWK-TKLIAANVTQLLI
RSGA_NEIMB       EQ------------------VVIEDFLPRQSLLYRQD------AWK-TKLIAANVTQLLI
RSGA_NITEU       DQ------------------GIIETTLPRTSLFYRSE------IFR-EKLIAANATQLVF
RSGA_ECO57       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_SHIFL       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_ECOLI       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_ECOL6       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_SALTI       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_SALTY       AAEGVNV------------KGIVEAVHERTSVLTRPD------FYDGVKPIAANIDQIVI
RSGA_YERPE       AQEGVRV------------KGIVEAVHERTSVLTRPD------LYDGVKPIAANIDQIVI
RSGA_PECAS       SLAGIS--------------GIVEAVHPRHSVLTRPD------YYDGIKPIAANIDQIVI
RSGA1_VIBVU      SMAGIS--------------GVVEAVEPRTSVLTRPD------YYDGLKPVAANIDQMVI
RSGA1_VIBVY      SMAGIS--------------GVVEAVEPRTSVLTRPD------YYDGLKPVAANIDQMVI
RSGA1_VIBPA      SMAGIS--------------GVVEAVEPRTSMLTRPD------YYDGLKPVAANIDQMVI
RSGA_VIBCH       TLAGIS--------------GVVEAVEARSSVLVRPD------YYDGLKPVAANVDQMVI
RSGA_SHEON       SQANSGI------------AGIVEAVHPRHSSLSRPD------LYDGVKIIASNIDQILI
RSGA_HAEIN       QLQGVS--------------GVIEAIHPRENEISRPD------YYDGLKPIAANIDRIII
RSGA_PASMU       QLQGVS--------------GVIEAIKPRQNEIARPD------YYDGLKVIAANIDRIII
RSGA_HAEDU       QLQGIS--------------GVIEAVYPRHNELSRPD------YYDGIKVMASNIDQIII
RSGA_PSEPK       GI------------------GVIVAQMPRSTELCRPN------NHGQLKPVAANVDLIVI
RSGA_PSESM       GI------------------GVIVAQLPRTTELRRPD------SRGQLKPVAANVDLIVI
RSGA_PSEAE       GI------------------GVIVAQLPRRSELCRPD------MRGLLKPVAANVDRIVI
RSGA2_NOSS1      E-----------------GCATIHGILPRKSKFSRKTVGS-----KTEEQIVAANVDTVF
RSGA1_OCEIH      N-----------------DIVIIDQVLPRFSSIVRKVAGL-----RTDAQIVASNVTKVF
RSGA2_LACPL      D-----------------NQAQIEAIAPRQSVLARGAVN------RQDGQIIATNINTIF
RSGA2_LISMF      -------------------DAQILSVLERKTVFSRMNKD-------SEEQLIAANFDYAL
RSGA1_LISMO      -------------------DLQILSVLERKTVFSRMNKD-------SAEQLIAANFDYAL
RSGA1_LISIN      -------------------EKQILSVLQRKTIFSRMTKD-------SEEQLIAANFDYAL
RSGA2_VIBVU      ------------------QQQ-FKRLLERQSELSRKAAGS-----KIAEQLIATNVDTLF
RSGA2_VIBVY      ------------------QQQ-FKRLLERQSELSRKAAGS-----KIAEQLIATNVDTLF
RSGA2_VIBPA      ------------------DQQ-FVRLLDRLSLFSRKAAGS-----KVAEQLIAANVDTVF
RSGA_RHILO       ------------------HSHLVQRRLTRKTVLERRVQGG-----R-GPQLAAANVDTLF
RSGA_XANAC       -------------------GKRIVALLPRRTSIKRGAAGE-----HYHQQVIAANIDTVF
RSGA_XANCP       -------------------GKRIVALLPRRTSIKRGAAGE-----HYHQQVIAANIDTVF
RSGA_XYLFA       -------------------GRRIVALLPRRTVIKRLAAGE-----HYRQQLIAANLDTAF
RSGA_XYLFT       -------------------GRRIVALLPRRTVIKRLAAGE-----HYRQQLIAANLDTAF
RSGA_STRAW       G-----------------DPRYVRTYLPRRSAFVRSTSSK-----RSEGQILAANVDYAV
RSGA_STRCO       G-----------------NPRYVRTYLPRRTAFVRSTSSK-----RSEGQILAANVDHAV
RSGA_LEPIC       D-----------------ELCIVEKILPRKTFLRRSNPGK-----RKGSQAIASNIDLLL
RSGA_LEPIN       D-----------------ELCIVEKILPRKTFLRRSNPGK-----RKGSQAIASNIDLLL
RSGA_METAC       T-----------------GSRMVVNILPRRTCLSRGAAGD-----GGGEQLIAANLDTIF
RSGA_METMA       L-----------------GSRMIVNILPRKTCLSRGAAGD-----GGGEQVIAANIDTIF
RSGA1_BACTN      A-----------------NKGIIVDILPRERALYRKKNGR-----VADRQAIASYVDKAF
RSGA_RHOBA       DG----------VSLKSEADGMIERVEPRTGMISRTSRGR-------QHVLVSNIDAMLI
                                       .     :   : :                        .

RSGA1_NOSS1      VFAVADPPLEPYQLSRFLVKAETTGLDVVLCLNKSDLVSPEIQQQ---------------
RSGA_SYNY3       VFALTDPPLEEWQLSRFLVQAEATGLEISLCFNKQDLVQETDVKF---------------
RSGA_THEEB       LFALADPPADVHPITRFLLTAEGLNVEIQVVFTKADLVSPQEQQQ---------------
RSGA_PROMA       VVSLLDPSFDLNQVSRFLMKAEETGLKVTIVLTKRDLIDEKILEK---------------
RSGA_BACAN       VFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLV-DEKMRET-----------VEA
RSGA_BACC1       VFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLV-DEKMRET-----------VES
RSGA_BACCR       VFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLV-DEKMKAT-----------VEA
RSGA_BACSU       VFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDTEDT-----------IQA
RSGA_BACHD       VFSAAEPTFSPLLLDRFLVHVEANGIEPLIVISKIDLL-TEEELET-----------IKQ
RSGA2_OCEIH      VSSAVDPDFTTLLLDRFLVLIESKHIQPIILITKVDLL-NEDQLEN-----------IKL
RSGA1_LISMF      VFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLA-SESEKEQ-----------IAV
RSGA2_LISMO      VFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLA-SESEKEQ-----------IAV
RSGA2_LISIN      VFSAVEPDFSTNLADRFLVAIEKEDIQPVICISKMDLA-TDAEKEQ-----------IAV
RSGA_ENTFA       VMSMVSPNFSFNLLDRFLVSLEYKDIEPVIYLTKVDLL-DEPQRQQ-----------VTE
RSGA1_LACPL      VTATTEQEFSTNLLDRQLVALAVAGIEPLLYFAKTDLL-TDEVYQQ-----------RLT
RSGA_STRA3       IMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKLDLLDDLVV--------------IDD
RSGA_STRA5       IMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKLDLLDDLVV--------------IDD
RSGA_STRP1       IMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEE--------------IKA
RSGA_STRP3       IMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEE--------------IKA
RSGA_STRP6       IMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEE--------------IKA
RSGA_STRP8       IMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEE--------------IKA
RSGA_STRPN       IMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGE--------------LDF
RSGA_STRR6       IMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGE--------------LDF
RSGA_STRMU       IISAKEPDFNHNLLDRFLILLEHRKISPIIYLSKTDLLEDLDE--------------FKK
RSGA_LACLA       IMSTVSPNFSLNLLDRFLVFLEHKNIHPMIYISKLDLLTEMQEGSDKNKKTFNQLTDYEQ
RSGA_STAAM       VMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFE------------INE
RSGA_STAAN       VMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFE------------INE
RSGA_STAAS       VMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFE------------INE
RSGA_STAAW       VMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFE------------INE
RSGA_STAAC       VMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIEKQFE------------INE
RSGA_STAAR       VMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIEKQFE------------INE
RSGA_STAHJ       VMSAVEPDFSTQLLDRFLVIAHSYDLEPSILVTKKDLASENEIEQ------------INA
RSGA_STAES       VMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDLASEQEILK------------IKD
RSGA_STAEQ       VMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDIASEQEILK------------IKD
RSGA_STAS1       VMSAVEPDFSTQLLDRFLVIAHSYHMRPRILVTKKDLTSLEKQHD------------IEK
RSGA_LACJO       VISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKSDITSSERLKD------------IQT
RSGA_MYCPU       VISLDQPKFSSFLLDKFLSIIEFQKIKVVIIFTKADLNTKEDIGY---------------
RSGA_MYCPE       VNSVKEPDFSSYGLNKFLAFYEARNINNVIIYFSKMDLLNKQESK-----------NMNQ
RSGA_UREPA       VVSIVQPDLNTLSLNKYLAFYEARNIKNVLIGLSKYDLANNHLKQ-----------KINK
RSGA_MYCGA       VFSIKDPQLNLKQLFKFMVYFESQLGFKPLIVFSKLDLDHDQ--N-----------EFKK
RSGA_MYCGE       IQSLVQPKINWIQLLKLLVYFNAKLIDEIPILITKTDLDFDP--------------MEKQ
RSGA_MYCPN       VQSLIEPKINWQQLFKLLIHFHAQNVARLVLVITKNDLEFEP--------------AEKA
RSGA_CLOAB       VFSIVNPEFSSDLLNKFLILCEFNNIKVKVCINKIDLVNEELL---------------TP
RSGA_CLOPE       VFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTEEEK---------------EN
RSGA_CLOTE       VFAFKNPNINLDLLNKFLLQCEYNEINAVVAFNKVDLVENPEK---------------EE
RSGA_CALS4       VFAISKPEINRVLLDKMIVVAEINKIEPVVCINKVDMEKREEV---------------EN
RSGA_FUSNN       QFAAKHPNIDFERINLLLLTAFYYKIKPIVIVNKIDYLTEEELVEL------------KE
RSGA_AQUAE       VETLKMPEFNNYLLDNMLVVYEYFKVEPVIVFNKIDLLNEEEKKEL------------ER
RSGA_THEMA       VVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKV------------RE
RSGA_BORBU       VSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQKAQE---------------
RSGA2_BACTN      VVTVNYPETSTIFIDRFLASAEAYRVPVKLVFNKVDAYNEDELRYL------------DA
RSGA_PORGI       VCTINDPVTTTVFIDRFLATAEAYRVPVILVFNKIDCYTQEDRLQL------------DR
RSGA_CHLTE       ITSFDDPPFNSRLVDRYLVFAESEKLPLLIVVNKIDLDEEGMVEED--------------
RSGA_BORPE       VVAVE-PTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARA--------------
RSGA_BORBR       VVAVE-PTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARA--------------
RSGA_BORPA       VVAVE-PTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARA--------------
RSGA_RALSO       MLGTE-PGFSEDLLGRALVAAESLGITPLILLNKIDLTARLETARA--------------
RSGA_NEIMA       VTAAV-PSPSVRLLQRALLAAEAAGIRAVIVLNKADLPETALWR---------------E
RSGA_NEIMB       VTAAV-PSPSVRLLQRALLAAEAAGIEAVIVLNKADLPETALWR---------------E
RSGA_NITEU       VLAVV-PSCNLELLDRCLVAAESQGIRPLILLNKIDLIGQDEQRQAV-----------AH
RSGA_ECO57       VSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDD-EGMAFV-----------NE
RSGA_SHIFL       VSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDD-EGMAFV-----------NE
RSGA_ECOLI       VSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDD-EGMAFV-----------NE
RSGA_ECOL6       VSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDD-EGMEFV-----------NE
RSGA_SALTI       VSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDD-EGMDFV-----------NE
RSGA_SALTY       VSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDD-EGMDFV-----------NE
RSGA_YERPE       VSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDA-DGRKFV-----------DG
RSGA_PECAS       VSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDE-KSRQLV-----------DK
RSGA1_VIBVU      VSSVL-PELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQE-AELATY-----------RE
RSGA1_VIBVY      VSSVL-PELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQE-AELATY-----------RE
RSGA1_VIBPA      VSSVL-PELSLNIIDRYLVAAETLNIAPLLVLNKVDLLEV-DDRAMY-----------EE
RSGA_VIBCH       VSSVL-PELSLNIIDRYLIASETLGIAPLIVLNKIDLLSP-ELREQY-----------ST
RSGA_SHEON       VSSVL-PSFTTQIIDRYLVAAEDTDIPPIIILNKIDLLTP-EEAPAI-----------EE
RSGA_HAEIN       VSAVL-PTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLAQ-EQRQEI-----------ED
RSGA_PASMU       VSSVL-PTLSLNIIDRYLVICENAQIPAVIVVNKVDLLSD-QERAEV-----------EA
RSGA_HAEDU       ISAVM-PVLSLNIIDRYLVICENAGIPALIVLNKIDLLSE-QERQHV-----------QQ
RSGA_PSEPK       VFAPA-PEPHPNLIDRYLVAAEHAGLRPLLLLNKADLIND-ENGPGL-----------HA
RSGA_PSESM       VFAPM-PEPHANLIDRYLVAAEHAGIHPLLLLNKADLIDE-QNAPAL-----------NA
RSGA_PSEAE       VFAPR-PEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDE-SNAEGI-----------DA
RSGA2_NOSS1      LVCGLDGDFNPRRIERYLILAWESGANPVIVLNKADLCNSLDEC--------------IS
RSGA1_OCEIH      IVISADEDLNERKLERYLTAVWESGASPHIVFSKVDLASDMDSI--------------IE
RSGA2_LACPL      ICMSLNADFNVRRLERYLTIAWDSGALPVIVLTKADLCTDLATK--------------LR
RSGA2_LISMF      IVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVEDLTAF--------------AQ
RSGA1_LISMO      IVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVEDLSFY--------------AQ
RSGA1_LISIN      IVMSLNHDFNLNRLERYLTVAWDSGATPIIILTKADLVDDLTPF--------------TM
RSGA2_VIBVU      IVCSLNDDFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQN--------------IT
RSGA2_VIBVY      IVCSLNDDFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQN--------------IT
RSGA2_VIBPA      IVCSLNHDFNLSRIERYLALVHEADVEPVIVLSKADLCDDVDEL--------------KS
RSGA_RHILO       IVTSCNADFNIARLERYLALANEAGTTPVILLTKADTAEDAEAY--------------RK
RSGA_XANAC       IVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEYAEDA--------------LA
RSGA_XANCP       IVCGLDADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEYAEDA--------------LA
RSGA_XYLFA       IVCGLDGDFNPRRIERYCVLIGSGGVEPVVVLTKVDLCADVGAA--------------VA
RSGA_XYLFT       IVCGLDGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCVDVAAA--------------VA
RSGA_STRAW       VAVSLAVELDLGRVERFLALAWESGAQPVVVLTKADLVPDATTL--------------SY
RSGA_STRCO       VAVSLAVELDLARIERFLALAWESGAQPLVVLTKADLVPDPVTL--------------AY
RSGA_LEPIC       VIMGLDNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDPENK--------------FM
RSGA_LEPIN       VIMGLDNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDPENK--------------FM
RSGA_METAC       IVTSVGKDLNLRRLERYLAIVYSSGASPVILLNKIDLADDPARL--------------VE
RSGA_METMA       IVTATGKDLNLRRLERYLAIVYSSGARPVILLNKIDLEDNPIRL--------------VE
RSGA1_BACTN      IVQSLDDNFNVRRAERFIAQVMEEKIKPVLVLNKADLGCDRQKI--------------DE
RSGA_RHOBA       IASAEQPGIKPALIDRMILTAHQCQIEPIVIINKVDLIDLVDLQP---------------
                                                  .                          

RSGA1_NOSS1      ISDRLLAWGYQPLFISVENQI-NIDQIAKYLSN-KITVVAGPSGVGKSSLINALIP--NI
RSGA_SYNY3       WGDRLAAWGYAPIIISVENRW-GVEKLQEKLRS-RISLMAGPSGVGKSSLINLLVP--GV
RSGA_THEEB       WRDRLQQWGYRCHVLSLTQGI-AWQALRPHLAN-KITVVCGPSGVGKSSLIRHLTP--RE
RSGA_PROMA       YDKKLQTWGYQPIPISIVNGE-GIQKLSARLKSMKLGVLCGPSGVGKSSLINYLLP--KI
RSGA_BACAN       YANDYREMGYDVLFTSIN-TS-ESIDILKPFLEGCVSVVAGQSGVGKSSMLNVLRP--EL
RSGA_BACC1       YANDYREMGYDVLFTSIN-TS-ESIDILKPFLEGCVSVVAGQSGVGKSSMLNVLRP--EL
RSGA_BACCR       YANDYREMGYDVLFTSIN-TS-ESIDILKPYLENCVSVVAGQSGVGKSSMLNVLRP--EL
RSGA_BACSU       YAEDYRNIGYDVYLTSSK-DQ-DSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISP--EL
RSGA_BACHD       YRNDYEQLGYKVYLTSTI-EQ-LGLDAIRKEFDDHVSVIAGQSGVGKSSLLNAINP--AL
RSGA2_OCEIH      YKQHYEKIGYRVELVSSK-NQ-DLLPELEPYFDEKVSVFAGQSGVGKSSLINVLDP--SL
RSGA1_LISMF      YKDIYEAIGYDVFVTN---DE-PDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNS--DL
RSGA2_LISMO      YKDIYEAIGYDVFVTN---DE-PDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNS--DL
RSGA2_LISIN      YKEVYETIGYDVFVTN---DE-PDKEAIKDYISGKTAVIAGQSGVGKSTLLNSLNS--DL
RSGA_ENTFA       IKQIYEALGYAVIASEDV----EATKELERFFPERLTVFMGQSGAGKSTLLNQISP--EL
RSGA1_LACPL      LADAYRQIGYQVICERTAFSP-AALAAVKTALAGHVAVVMGQTGAGKSTLLNHLQP--GL
RSGA_STRA3       IREHYQNIGYVFCYSQ---------EELLPLLADKVTVFMGQTGVGKSTLLNKIAP--EL
RSGA_STRA5       IREHYQNIGYVFCYSQ---------EELLPLLANKVTVFMGQTGVGKSTLLNKIAP--EL
RSGA_STRP1       IGRQYQAIGYDFVTSL---------EELLPLLADKITVFMGQTGVGKSTLLNRIAP--EL
RSGA_STRP3       IGRQYQAIGYDFVTSL---------EELLPLLADKITVFMGQTGVGKSTLLNRIAP--EL
RSGA_STRP6       IGRQYQAIGYNFVTSL---------EELLPLLADKITVFMGQTGVGKSTLLNRIAP--EL
RSGA_STRP8       IGRQYQAIGYNFVTSL---------EELLPLLADKITVFMGQTGVGKSTLLNRIAP--EL
RSGA_STRPN       YQQTYGDIGYDFVTSK---------EELLSLLTGKVTVFMGQTGVGKSTLLNKIAP--DL
RSGA_STRR6       YQQTYGDIGYDFVTSK---------EELLSLLTGKVTVFMGQTGVGKSTLLNKIAP--DL
RSGA_STRMU       VQKQYQKIGYYFVYYL---------EDLTPLLKDKITVFMGQTGVGKTTLLNTLAP--DL
RSGA_LACLA       IKSDYEQIGYDVFFDA---------EHLVSNLAGKVTVFMGQTGAGKTTLLNKIAP--EM
RSGA_STAAM       LLKIYENIGYETEFIGND----DDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAAN       LLKIYENIGYETEFIGND----DDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAAS       LLKIYENIGYETEFIGND----DDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAAW       LLKIYENIGYETEFIGND----DDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAAC       LLKIYENIGYETEFIGND----DDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAAR       LLKIYENIGYETEFIGND----DDRKKIVEAWSAGLIVLSGQSGVGKSTFLNHYRP--EL
RSGA_STAHJ       WLKIYEEIGYNTQFVGKH----TSQQEVVATWPKGLIVLSGQSGVGKSTFINAFKP--EL
RSGA_STAES       TIKIYQKIGYATQFIGKD----SNYTATVDEWSDGLIVLSGQSGVGKSTFLNSYQP--QL
RSGA_STAEQ       TIKLYQKIGYATQFIGKD----SNYTATVDEWSDGLIVLSGQSGVGKSTFLNSYQP--QL
RSGA_STAS1       LLEVYENMSYKTQFISIN----EDIEQVFSSWGDGLAVLSGQSGVGKSTLLNKYFP--NI
RSGA_LACJO       ELEYYQRIGYPVFEDAEK----LENELPKMIDKDQIWTLAGQSGAGKSTLLNQLES--EA
RSGA_MYCPU       YLKTYQSYLTSLDDEN-------SYKKLNDIFEKKISVLVGQSGVGKTTILNKVSL--N-
RSGA_MYCPE       IISQYEQNGYIVLNSLDKE---KNKEKILNMIKNNVVCFAGQSGVGKSTLINFLIP--DL
RSGA_UREPA       LILDYKKNNYAVF-ILTKE---NDILLLKEKIKSKTLCLAGNSGVGKSTLINKLDP--SI
RSGA_MYCGA       IVEALEQINYQVF-KLNEP---DDFLRLKNLLFNKVTIFCGHSGVGKSTLLKRLDN--SL
RSGA_MYCGE       KLIDLKQFNYQLFFVSKNE---PLPSELIDIFSKKLSVFTGQSGVGKSSLINRLDP--SL
RSGA_MYCPN       RLSELTSFGYQLFFTAPNA---DLPLTLFTELQNRFSVFMGQSGVGKSSLINRLDS--QI
RSGA_CLOAB       IKNLLNNTGYELKFLNAK-SK-IGINELKESLKDNITVVCGPSGVGKSTLMNSIAG--SN
RSGA_CLOPE       LKELINDIGYEVLFINAK-EG-KGFDALKERLEHNITVLCGPSGAGKSTLLNSFID--RE
RSGA_CLOTE       VVDIIKSAGYEVIYLNAK-EG-MGIEKIREKLKGNLNVLCGPSGAGKSTIINKLVG--KD
RSGA_CALS4       LINVYRKIGYKAVGTSAV-TG-EGMEELKSYLKDKISFFAGPSGVGKSSLINLIQS--NI
RSGA_FUSNN       KLSFLERISVPMFLISCY-QN-IGLEEVENFLKDKITVIGGPSGVGKSSFINFLQS--ER
RSGA_AQUAE       MDSIYRDAGYDVLKVSAK-TG-EGIDELVDYLEGFICILAGPSGVGKSSILSRLT---GE
RSGA_THEMA       LEEIYSGL-YPIVKTSAK-TG-MGIEELKEYLKGKISTMAGLSGVGKSSLLNAINP--GL
RSGA_BORBU       FSEIYENLGYKVLKTSVK-TY-EGIKEVKEVLKNSRTSFIGQSGVGKSSLINLIDS--RA
RSGA2_BACTN      LINLYTHIGYPCFKVSAK-EG-TGVDAIKKDLEGKITLFSGHSGVGKSTLINAILP--GT
RSGA_PORGI       LSAVYTAIGYPCCHVSAI-TG-EGLPDLKSLLDGKLTLLAGHSGVGKSSLINALIP--HA
RSGA_CHLTE       -LEVYRQLDCNICLVSAE-DG-RGIEELRELLRDRVSAFSGHSGVGKSTLINLLVG--CE
RSGA_BORPE       RLEPLRRLGVPVIELSAQDHA-MVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVP--HA
RSGA_BORBR       RLEPLRRLGVPVIELSAQDHA-MVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVP--HA
RSGA_BORPA       RLEPLRRLGVPVIELSAQDHA-MVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVP--HA
RSGA_RALSO       RLALYRALGYAVVELSVHAAPEAAHAVLAAHVAGRSSILIGQSGMGKSSLLNLLIP--GV
RSGA_NEIMA       KLKFYETLGYPVIETRALENA----GSLRPALQGHSNILLGQSGMGKSTLTNALLG--SQ
RSGA_NEIMB       KLKFYETLGYPVIETRALENA----GSLRPALQGHSNILLGQSGMGKSTLTNALLG--SQ
RSGA_NITEU       HLMFYRELGYPVLEISAKISV----QPLIPLLSGQTSLLAGQSGVGKSTLLNALVP--RA
RSGA_ECO57       QMDIYRNIGYRVLMVSSHTQD--GLKPLEEALTGRISIFAGQSGVGKSSLLNALLG-LQK
RSGA_SHIFL       QMDIYRNIGYRVLMVSSHTQD--GLKPLAEALTGRISIFAGQSGVGKSSLLNALLG-LQK
RSGA_ECOLI       QMDIYRNIGYRVLMVSSHTQD--GLKPLEEALTGRISIFAGQSGVGKSSLLNALLG-LQK
RSGA_ECOL6       QMDIYRNIGYRVLMVSSHTQD--GLKPLEEALTGRISIFAGQSGVGKSSLLNALLG-LQK
RSGA_SALTI       QMNIYRNIGYRVLMVSSHTQD--GLKPLEEALTGRISIFAGQSGVGKSSLLNALLG-LQN
RSGA_SALTY       QMDIYRNIGYRVLMVSSHTQD--GLKPLEEALTGRISIFAGQSGVGKSSLLNALLG-LQN
RSGA_YERPE       MMDIYRRIGYDVLEVSSQTRE--GMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDN
RSGA_PECAS       SMDIYRALKYRVLMVSSHTQQ--GIPELEQALTDRISIFAGQSGVGKSSLLNALLALGEK
RSGA1_VIBVU      WLADYEKIGYKILYVSKRSGA--GIAELEAQLQDRINIFVGQSGVGKSSLVNALIPELD-
RSGA1_VIBVY      WLADYEKIGYKILYVSKRSGA--GIAELEAQLQDRINIFVGQSGVGKSSLVNALIPELD-
RSGA1_VIBPA      WLKEYERIGYKVLFVSKNSGE--GISDLEVQLRDRINIFVGQSGVGKSSLVNALMPELEQ
RSGA_VIBCH       WLNDYRAIGYDVLYVSKKTGE--GIADLEVKLRDRTNVFVGQSGVGKSSLVNALLPELEE
RSGA_SHEON       ALKRYQDIGYPVYKVSSKLGE--GLETIKALLKDKVSVFAGQSGVGKSSLVNALLP--EA
RSGA_HAEIN       QLKIYQDIGYEILMISAKSGE--NMEKLTALLAQGTAIFVGQSGVGKSSLINHILP--SV
RSGA_PASMU       QLRIYQQIGYQTLMISALSGE--NMEKLTALFDEGTSIFVGQSGVGKSSLINHILP--EV
RSGA_HAEDU       QLAIYENIGYQTLCLSANTGE--NMDKLDRYLANGTSIFVGQSGVGKSSLINQLLP--EV
RSGA_PSEPK       LLEVYRELGYPLLEVSAHHGD--GMQRLQQQLDGHISVFVGQSGVGKSSLVNSLLP--DA
RSGA_PSESM       LLAVYRTLGYPVLEVSAHQGD--GMQSLQSQLDGHISVFVGQSGVGKSSLVNSLLP--ET
RSGA_PSEAE       LLNVYRTLGYPLIEVSAFNGL--AMDELRGALDGHVSVFVGQSGVGKSSLVNALLP--GV
RSGA2_NOSS1      EVEAVAIG-VPILVLSATNNQGI-DTLKAYLQPGQTVALLGSSGVGKSTITNQLKGASVQ
RSGA1_OCEIH      HADSIAFG-IPLYKWNATNEEGK-EDILANIHEDDSVVLIGSSGAGKSTLINALLTEKVL
RSGA2_LACPL      AVADVSVG-VPTITCSVETGQGL-DELQPYLTTGQTVAFVGSSGVGKSTLINRLLGQDIL
RSGA2_LISMF      QLETVAYG-VPAYYVDNLSHHGF-EALERDLKPNSTLVLLGSSGVGKSSFINSLAGTDLM
RSGA1_LISMO      QLEAVAYG-VPAYYVDNLSHHGF-EALESDLKPNSTLILLGSSGVGKSSFINSLAGTDLM
RSGA1_LISIN      ELETVAYG-VPTYYVDNLSHRGF-EALEADLKPNSTLVLLGSSGVGKSSFINSLAGADLM
RSGA2_VIBVU      QVQQLSAT-LWVEAVNALDPVSV-AALQPWCAKGRTVAFIGSSGVGKSTLTNTLLGEETQ
RSGA2_VIBVY      QVQQLSAT-LWVEAVNALDPASV-SALQPWCTKGRTVAFIGSSGVGKSTLTNTLLGEETQ
RSGA2_VIBPA      QVQKLDPL-LVIETVNGLDAEST-SKLMSWCNEGQTVAFIGSSGVGKSTLVNALLGQQEQ
RSGA_RHILO       QAAALQRE-LAVVTLNPRIPGAA-SALAAWCGAGQTVALIGSSGVGKSTLVNTLAGSAQQ
RSGA_XANAC       VLEELEAQNIPLRAVNAKDPDSV-AALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKM
RSGA_XANCP       VLEELEAQNIALRAVNAKDPESV-AALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKM
RSGA_XYLFA       VLREHSSQALAVVAVDAREAEPV-AALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRM
RSGA_XYLFT       VLREHSSQALAVVAVDARKAEPV-VALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRM
RSGA_STRAW       LVQDVETAAPGVPVLSVSSNLGEGLDVLAAVLSGGTSVLLGQSGAGKSTLANALLGEDVM
RSGA_STRCO       LVQDVETAAPGVPVLPVSAEQGEGLDVLAAVVSGGTAVLLGQSGAGKSTLANALLGEAAM
RSGA_LEPIC       EIKMIAGE-TPIEMISALDLKQT-RTILQWIDPGKTIAFLGSSGAGKSTIINSLLGGEIQ
RSGA_LEPIN       EIKTIAGE-TPIEMISALDLKQT-RTILQWIDPGKTITFLGSSGAGKSTIINSLLGGEIQ
RSGA_METAC       KIRDVTGD-VPVIPLSALSKTGL-DALGPYLNPGETVALVGSSGVGKSTLINAFLGETVQ
RSGA_METMA       KIQSIAGN-VPVIPLSALSKTGL-EALSPHLNPGETVALVGSSGVGKSTLINSLLGETVQ
RSGA1_BACTN      AIKHIARQ-FPVFITSIRQPQTI-LRLRESITKGETVVFVGSSGVGKSSLVNALCGKSVL
RSGA_RHOBA       LIGVYSSLGYRVLPTSAETGQ--NVAYLRALLKDRQTALAGQSGVGKSSLLNAVQPGLGL
                                                       . * :* **:::          

RSGA1_NOSS1      -NLRVGEVSGKLARGRHTTRHVELFELPN----GGLLADTPGFNQPDVD-CSP-EELVHY
RSGA_SYNY3       -EQQVKNVSGKLRKGRHTTRHVELFDLPH----GGLLADTPGFNQPDLA-VEP-AQLIHL
RSGA_THEEB       -DIRVGAVSDHWHRGRHTTRHVELFPLAE----GGWIADTPGFNQPELP-PDP-RQLAAA
RSGA_PROMA       -SIPIGKLSKKLKRGRHTTRHVELFSIYS----DSFIADTPGFNKPEFY-TEP-SQVPQL
RSGA_BACAN       -ELKTNDISSHLGRGKHTTRHVELIAI-G----SGLVADTPGFSSLDFIDIEV-EDLTYC
RSGA_BACC1       -ELKTNDISSHLGRGKHTTRHVELIAI-G----SGLVADTPGFSSLDFIDIEV-EDLTYC
RSGA_BACCR       -ELKTNDISSHLGRGKHTTRHVELIAI-G----SGLVADTPGFSSLDFIDIEV-EDLTYC
RSGA_BACSU       -GLRTNEISEHLGRGKHTTRHVELIHT-S----GGLVADTPGFSSLEFTDIEE-EELGYT
RSGA_BACHD       -DIETNQISSHLGRGKHTTRHVELIPF-G----SGLVADTPGFSSLDFIDMEP-EELSHY
RSGA2_OCEIH      -LLETAEISKSLGRGKHTTRHVELMKI-G----NGLVADTPGFSVLEFREIEA-EELADS
RSGA1_LISMF      -TLKTAEISNALGRGKHTTRHVELMPI-G----DGFVADTPGFSSIEWDDLQP-ETLQFC
RSGA2_LISMO      -TLKTAEISNSLGRGKHTTRHVELMPI-G----DGFVADTPGFSSIEWDDLQP-ETLQFC
RSGA2_LISIN      -TLKTAEISNSLGRGKHTTRHVELMPI-G----DGFVADTPGFSSIEWDDLQP-ETLQFC
RSGA_ENTFA       -QLATAEISQSLGRGKHTTRHVELIPL-Y----DGLVADTPGFSAIDFLEMEA-VELPKQ
RSGA1_LACPL      -ALATGEISQALNRGKHTTRKVSLIPI-A----DGLVADTPGFSSYEVFDIAA-NELTHY
RSGA_STRA3       -KLETGEISDSLGRGRHTTRAVSFYNV-H----KGKIADTPGFSSLDYEVDNA-EDLNES
RSGA_STRA5       -KLETGEISGSLGRGRHTTRAVSFYNV-H----KGKIADTPGFSSLDYEVDNA-EDLNES
RSGA_STRP1       -ALEIGEISDSLGRGRHTTRAVSFYNT-H----GGKIADTPGFSSLDYDIANA-EDLNEA
RSGA_STRP3       -ALETGEISDSLGRGRHTTRAVSFYNT-H----GGKIADTPGFSSLDYDIANA-EDLNEA
RSGA_STRP6       -ALETGEISDSLGRGRHTTRAVSFYNT-H----GGKIADTPGFSSLDYDIANA-EDLNEA
RSGA_STRP8       -ALETGEISDSLGRGRHTTRAVSFYNT-H----GGKIADTPGFSSLDYDIANA-EDLNEA
RSGA_STRPN       -NLETGEISDSLGRGRHTTRAVSFYNL-N----GGKIADTPGFSSLDYEVSRA-EDLNQA
RSGA_STRR6       -NLETGEISDSLGRGRHTTRAVSFYNL-N----GGKIADTPGFSSLDYEVSRA-EDLNQA
RSGA_STRMU       -ALETNEISDSLGRGRHTTRAVTLYNI-Y----GGKIADTPGFSSLDYEITSS-EELNAA
RSGA_LACLA       -QLATGETSEKLGRGRHTTRHVEFFEL-A----GGLIADTPGFSSLDYEVTNR-PDLNAA
RSGA_STAAM       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAAN       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAAS       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAAW       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAAC       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAAR       -NLETNDISKSLNRGKHTTRHVELFER-Q----NGYIADTPGFSALDFDHIDK-DEIKDY
RSGA_STAHJ       -NLETNHISKSLNRGKHTTRHVELFER-E----SGFIADTPGFSALDFGHIDK-DELKHY
RSGA_STAES       -KLETNDISKSLNRGKHTTRHVELYDR-K----GGYIADTPGFSALDFNHIEK-EQLKDF
RSGA_STAEQ       -KLETNDISKSLNRGKHTTRHVELYDR-K----GGYIADTPGFSALDFNHIEK-EQLKDF
RSGA_STAS1       -EIETQHISKALNRGRHTTRHVELFER-A----KGFIADTPGFSALDYDHIQK-DEIKNY
RSGA_LACJO       -KQVTGAISTALNRGKHTTRQVTLFKY-G----SGFIADTPGFSAIDLFKIKV-DDLRNY
RSGA_MYCPU       -NFFTQNISKALGRGKHSTRVVKMIDF-N----NGQIIDTPGFSSIEIQMSQK--DLSKS
RSGA_MYCPE       -ELRTQEISQALNRGKHTTTSSLMIPF-N----EGFVIDTPGFGSLDLNMTQL--ELANS
RSGA_UREPA       -QQRTQEISHFLNRGKHTTTSTKLISF-A----NGFLVDTPGFGNLEVNLTKN--EMANA
RSGA_MYCGA       -DIWTQAVSAKLKRGKNTTTATKLYKF-L----DGYLVDSPGFSIYDLNLTKQ--QLSCG
RSGA_MYCGE       -KQKIQALSVNKF-GKNTTTKTTLFSF-R----GGFICDTPGFNVISIKNLKI--LAAQH
RSGA_MYCPN       -HQAIQALSAHQF-GKNTTTSTVMFPF-Q----NGFICDTPGFNVIDFPNLKQ--LAAQH
RSGA_CLOAB       -VMKTGDISEKLKRGKNTTRHSELIEVA-----GGFIVDTPGFSSLDLNFIDR-YE-LKD
RSGA_CLOPE       -HMETGSVSEKIGRGKHTTRHSELIDVD-----NGYLVDTPGFTTLDVTFIDR-DS-LKY
RSGA_CLOTE       -VMETGQISEKLKRGKHTTRHSELIEVE-----DGFLVDTPGFSSLSIEDIEK-EE-IQF
RSGA_CALS4       -RLKTGELSEKLGRGRHTTRSVEFLPLDF----GGYVLDTPGFTALEID-IPK-EE-LRN
RSGA_FUSNN       -ILKTGEISERLQRGKHTTRDSNMIKMKA----GGYIIDTPGFSSIEVPNIEN-REELIS
RSGA_AQUAE       -ELRTQEVSEKTERGRHTTTGVRLIPFGK----GSFVGDTPGFSKVEATMFVK-PREVRN
RSGA_THEMA       -KLRVSEVSEKLQRGRHTTTTAQLLKFDF----GGYVVDTPGFANLEINDIE--PEELKH
RSGA_BORBU       -SQSVNEISHKYSRGKHTTVYSISFHS-D----SGIIVDTPGIKEFGIETLPF-ENLKYY
RSGA2_BACTN      -KVKTGEISTYHNKGMHTTTFSEMFSVDG----DGYIIDTPGIKGFGTFDMEE-EEIGHY
RSGA_PORGI       -DLRTGAISQAHHTGMHTTTFSQMIDFPDLS-PGSALIDTPGIKGFGTLEMGE-YEVSHY
RSGA_CHLTE       -ELRTAETSGKTGKGVHTTTSSAMFQLPG----GGYVIDTPGIREFNLAGITR-ENLRFY
RSGA_BORPE       -QAATREYSAALDMGRHTTTSTRLYHLPE---PGGDLIDSPGFQAFGLQHLNG-EQILRG
RSGA_BORBR       -QAATREYSAALDMGRHTTTSTRLYHLPE---PGGDLIDSPGFQAFGLQHLNG-EQILRG
RSGA_BORPA       -QAATREYSAALDMGRHTTTSTRLYHLPE---PGGDLIDSPGFQAFGLQHLNG-EQILRG
RSGA_RALSO       -DAQTREISEKLDSGKHTTTFTRLYHLPSGWGHGGTLIDSPGFQEFGLHHLTE-GMLERA
RSGA_NEIMA       -TARTGDISAALDSGKHTTTHARLYDLNG----ETQLIDSPGLQEFGLHHLQA-ADLPRY
RSGA_NEIMB       -TARTGDISAALDSGKHTTTHARLYDLNG----ETQLIDSPGLQEFGLHHLQA-ADLPRY
RSGA_NITEU       -QQATAEISDALDSGRHTTTHVRLFHFDA----DSSIIDSPGFQEFGLQQLDE-ASLARG
RSGA_ECO57       -EILTNDVSDNSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_SHIFL       -EILTNDVSDNSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_ECOLI       -EILTNDISDNSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_ECOL6       -EILTNDVSDNSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_SALTI       -EILTNDVSNVSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_SALTY       -EILTNDVSNVSGLGQHTTTAARLYHFPH----GGDVIDSPGVREFGLWHLEP-EQITQG
RSGA_YERPE       -EILVNTVSGNSGLGQHTTTAARLYHFQH----GGDVIDSPGVREFGLWHLAP-EQITQG
RSGA_PECAS       -RILVNEVSDNSGLGQHTTTASRLYHFPH----GGDVIDSPGVREFGLWHLEP-EQVTSG
RSGA1_VIBVU      --IEEGEISELSGLGQHTTTAARLYHIPS----GGNLIDSPGVREFGLWHLEP-EEITKA
RSGA1_VIBVY      --IEEGEISELSGLGQHTTTAARLYHIPS----GGNLIDSPGVREFGLWHLEP-EEITKA
RSGA1_VIBPA      -EVEEGAISENSGLGQHTTTAARLYHIPT----GGDLIDSPGVREFGLWHLEA-EEVTKA
RSGA_VIBCH       -DVEEGAISETSGLGQHTTTAARLYHIPS----GGDLIDSPGVREFGLWHLET-DDVTKA
RSGA_SHEON       -ELLVGDVSDNSGLGQHTTTTAKLLHLPS----GGDLIDSPGVREFALWHLPA-QRVGWC
RSGA_HAEIN       -NAQVGDVSETSGLGQHTTTSSRLYHLPQ----GGNLIDSPGIREFGLWHLDA-EQITKG
RSGA_PASMU       -NAQVGDISENSGLGQHTTTSSRLYHLRQ----GGQLIDSPGIREFGLWHLDQ-EQITRG
RSGA_HAEDU       -HAITGAISDISGLGQHTTTASRLYHLPQ----GGNLIDSPGIREFGLWHLTP-EQITLG
RSGA_PSEPK       -GTRVGDLSEWSGQGTHTTTTARLYHFPN----GGDLIDSPGIREFGLGHVSR-DDVEDG
RSGA_PSESM       -DTRVGPLSEVSGQGTHTTTTARLFHFPR----GGDLIDSPGIREFGLGHVSR-ADVEAG
RSGA_PSEAE       -DTRVGDLSTVTGKGTHTTTTARLFHFPG----GGDLIDSPGIREFGLGHVSR-DDVEAG
RSGA2_NOSS1      ---AVQPVRQGDDRGRHTTTNRELILLPT----GGLIVDTPGMREIQIWAGD--ESLQET
RSGA1_OCEIH      ---KTGSVREDDKRGRHTTTHRELFNLPT----GGVIIDTPGMRELQLWTEDG-DTLSHT
RSGA2_LACPL      ---ATKSIRTDDNKGRHTTTSRQLIPLPT----GACVIDTPGMRELQIFMGD----LNQT
RSGA2_LISMF      ---KTAGIREDDSKGKHTTTHREMHLLTN----GWIVIDTPGMREFGVGFNQ--AGLETT
RSGA1_LISMO      ---KTAGIREDDSKGKHTTTHREMHLLSN----GWIVIDTPGMREFGVGFNQ--AGLETT
RSGA1_LISIN      ---KTSEIREDDSKGKHTTTHREMHLLAN----GWIIIDTPGMREFGIGLNQ--AGLETT
RSGA2_VIBVU      ---QTGGIREDDSKGRHTTTARSVHMIPD----GALIIDTPGMRELQLADCS--EGVSET
RSGA2_VIBVY      ---QTGGIREDDSKGRHTTTARSVHMIPD----GALIIDTPGMRELQLADCS--EGVSET
RSGA2_VIBPA      ---STGHIREDDSKGRHTTTSRSIHLLPA----GGILIDTPGMREIQLVDCE--AGVSEA
RSGA_RHILO       SPQQTGAIREHDAKGRHTTTARSLHAIAG----GGWVIDTPGMRTLQVSDVG--YGIDTL
RSGA_XANAC       ---KTNAVRENDSRGRHTTTHRALIPLPS----GACLIDTPGMRELKPTGEE--DLAEGG
RSGA_XANCP       ---KTNAVRENDSRGRHTTTHRALIPLPS----GACLIDTPGMRELKPTGEE--DLAEGG
RSGA_XYLFA       ---KVGEVRQRDSRGRHTTTHRALLPLPS----GACLIDTPGMRELKFTGEE--DLVEE-
RSGA_XYLFT       ---KVGEVRQRDSRGRHTTTHRALLPLPS----GACLIDTPGMRELKFTGEE--DLVEE-
RSGA_STRAW       ---KVHATRDVDGKGRHTTTTRNLLALPG----GGVLIDTPGLRGVGLWDAE--TGVNQV
RSGA_STRCO       ---DVQAIRDVDGKGRHTTTTRNLLALPG----GGVLIDTPGLRGVGLFDAG--NGVDQV
RSGA_LEPIC       ---KTNEVKVSDGTGKHTTTRRELFLLPS----GGVLMDNPGIREVGLFSEGSEDELEEV
RSGA_LEPIN       ---KTNEVKVSDGTGKHTTTRRELFLLPS----GGVLMDNPGIREVGLFSEGSEDELEEV
RSGA_METAC       ---KTADIRKDDEKGRHTTTVRQMFLLPN----GAVLIDNPGIREIQLGD--SAEGLEKA
RSGA_METMA       ---RTGGIREDDEKGRHTTTVRQMFLLPN----GAVLIDNPGIREIQLGD--SAEGIEKA
RSGA1_BACTN      ---NTSDISLSTGKGRHTSTRREMVLMDG----SGVLIDTPGVREFGLAIDN--PDSLTE
RSGA_RHOBA       ---AIGAVSSDNDKGKHTTTASQLIPLAD----GGAVFDTPGIRQFQLWDISA-GEVAGL
                               * :::                 : *.**.                 

RSGA1_NOSS1      FPEARERLAIASCRFNDCSHRDE---PDCAVRGDWERYEHYLEFLADAIARQTQLYQQAD
RSGA_SYNY3       FPEARQQLTGQECFFKDCLHRGE---PDCAVGQDWERYEHYLTFLEEVLAQQNPENSRE-
RSGA_THEEB       FPEIRQRLSQDQCLFDNCRHDQE---PGCCVRGNWERYPLYIEYLHQLETIASAEPSLA-
RSGA_PROMA       FPELRSQLLIKKCKFRNCMHLNE---PDCAISRDWERYSNYKNFLQEMLNYHH-------
RSGA_BACAN       FPELKEAS--QYCKFRGCTHLSE---PKCAVKAAVEEGKITEYRYKNYKQFVEEIR-ERK
RSGA_BACC1       FPELKEAS--QYCKFRGCTHLSE---PKCAVKAAVEEGKITEYRYKNYKQFVEEIR-ERK
RSGA_BACCR       FPELKEAS--QYCKFRGCTHLSE---PKCAVKAAVEEGKITEYRYKNYKQFVEEIR-ERK
RSGA_BACSU       FPDIREKS--SSCKFRGCLHLKE---PKCAVKQAVEDGELKQYRYDHYVEFMTEIK-DRK
RSGA_BACHD       FPEMRDRL--PSCKFRGCTHTQE---PKCAVKEALAQGEIREFRYEHYVTFLEEVK-TQH
RSGA2_OCEIH      FPEFNARM--HLCKFRGCMHDKE---PKCAVKEAVENEEIAVFRYNHYLRFLEEIQ-TRK
RSGA1_LISMF      FPEMEDRR--SGCKFRGCMHDNE---PNCAVKTAVEANEIAEFRYKHYIQILQELK-NRK
RSGA2_LISMO      FPEIEDRR--SGCKYRGCMHENE---PSCAVKTAVEANEIAEFRYKHYIQILQELK-NRK
RSGA2_LISIN      FPEMEDRR--SGCKFRGCMHDNE---PNCAVKTAVEANEIADFRYKHYIQILQELK-NRK
RSGA_ENTFA       FPEFVAAA--SHCKFRECMHHKE---PGCEVKRQVEAGTIATSRYENYLQFLMEIE-NRR
RSGA1_LACPL      FPEFVRLS--VDCKYRGCVHINE---PQCAVKQALAAGELLASRYDNYLQFYETIK-NKK
RSGA_STRA3       FPELRRLS--HFCKFRSCTHTHE---PKCAVKEALTQGQLWQVRYDNYLQFLSEIE-NRR
RSGA_STRA5       FPELRRLS--HFCKFRSCTHTHE---PKCAVKEALTQGQLWQVRYDNYLQFLSEIE-SRR
RSGA_STRP1       FPELRRLS--HECKFRSCTHTHE---PKCAVKAALETGELWPVRYEHYLQFLSEIE-NRR
RSGA_STRP3       FPELRRLS--HECKFRSCTHTHE---PKCAVKAALETGELWPVRYEHYLQFLSEIE-NRR
RSGA_STRP6       FPELRRLS--HKCKFRSCTHTHE---PKCAVKAALETGELWPVRYEHYLQFLSEIE-NRR
RSGA_STRP8       FPELRRLS--HKCKFRSCTHTHE---PKCAVKAALETGELWPVRYEHYLQFLSEIE-NRR
RSGA_STRPN       FPEIATVS--RDCKFRTCTHTHE---PSCAVKPAVEEGVIATFRFDNYLQFLSEIE-NRR
RSGA_STRR6       FPEIATVS--RDCKFRTCTHTHE---PSCAVKPAVEEGVIATFRFDNYLQFLSEIE-NRR
RSGA_STRMU       FPELLKLS--AACKFRSCTHTHE---PGCAVKLALAQRKIWEKRYQTYLQILSEIE-NRR
RSGA_LACLA       FPEILRIS--HDCKFRECTHTHE---PSCAVKLALENHEILESRYDNYLQILDEIN-HTR
RSGA_STAAM       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAAN       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAAS       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAAW       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAAC       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAAR       FLELNRYG--ETCKFRNCNHIKE---PNCNVKHQLEIGNIAQFRYDHYLQLFNEIS-NRK
RSGA_STAHJ       FIEMNRFG--EECKFRNCNHIKE---PKCHVKQQLENGYLAQFRYDHYIQLYNEIS-NRK
RSGA_STAES       FIDIHEAG--EQCKFRNCNHIKE---PQCHVKALVEKGEIPQFRYDHYQQLYNEIS-NRK
RSGA_STAEQ       FIDIHEAG--EQCKFRNCNHIKE---PQCHVKTLVEKGEIPQFRYDHYQQLYNEIS-NRK
RSGA_STAS1       FMEIHEYG--ATCKFRDCNHINE---PKCNVKAELENGNIAQFRYDHYLQLFKEIS-NRK
RSGA_LACJO       FYDLKEAS--ANCKFRGCQHIKE---PGCEVKKLVEEGKIARSRYESYLKIRQEISDNRM
RSGA_MYCPU       FESFDKYS--QRCKYRHCLHQNER-LEDCNIKQLVQSQEIPLFRYNNYLKLLDEVK----
RSGA_MYCPE       FTDFRNNS--VHCKFKNCLHTNEQ---NCFIKKMVDENKIYKQRYLDYLKMFSEIKK---
RSGA_UREPA       FNDFANYA--RFCKFSNCLHIEEP---ECAIKKAVDE-KLIVNRYDDYLKIIKELPNDVL
RSGA_MYCGA       LIEFAQYQ--TKCKFNDCLHLENSA--DCYLKKKINS-----LIYQIYLSVIKSII----
RSGA_MYCGE       FVGFQKMI--SKCHFSNCYHQYEK---DCFVTTSVMKNRYPSWLYEKYRKMIN-------
RSGA_MYCPN       FVGFASLI--GQCHFSNCTHQSEK---GCFIVSAVTQKSYSLWLYESYLKLIN-------
RSGA_CLOAB       LFPEFYEY-NGSCKYSTCVHDKE---PGCEVKKAVEEGNINIERYNFYVDTLNKLSVRRN
RSGA_CLOPE       CFPEFNDY-NNLCKFNGCNHYKE---PKCAVKEAVEEGKINKLRYEFYIKTLEEIINRRG
RSGA_CLOTE       LFPEFIKY-INGCKFTGCLHYKE---PSCVVKNALEQGKIHKKRYEFYIQIIEEKLRGKN
RSGA_CALS4       YFREFIEF-QENCRFNSCLHVNE---PDCAVTEAVDEGIIDRQRYISYLTLLREVKEKEK
RSGA_FUSNN       LFPEFLN--IDSCKFLNCSHIHE---PGCNVKKQVEENKISKERYDFYKKTLEILLERWN
RSGA_AQUAE       YFREFLR---YQCKYPDCTHTNE---PGCAVKEAVKNGEISCERYKSYLKIIKVYLEEIK
RSGA_THEMA       YFKEFGD---KQCFFSDCNHVDE---PECGVKEAVENGEIAESRYENYVKMFYELLGRRK
RSGA_BORBU       FKEFENFA--SFCKYKSCLHVSE---PYCSVTSSLDNG-ISKLRYESYLKILSELKNYKN
RSGA2_BACTN      FPEIFKVS--ADCKYGNCTHRHE---PGCAVREAVEKHLISESRYTSYLNMLEDKEEGKY
RSGA_PORGI       FPEIFAAS--KGCRFGNCTHTHE---PGCAVLEALRRGEIAESRYISYLSILEDENAERY
RSGA_CHLTE       YTEFLRYM--PECTFSSCSHTVE---PGCAVIAAVESGSIARERYESYLALLDSLAE---
RSGA_BORPE       FPEFAPHI--EHCRFYNCTHRHE---PGCGVLAALQAGQIDAGRYALYLRILDENAAARP
RSGA_BORBR       FPEFAPHI--EHCRFYNCTHRHE---PGCGVLAALQAGQIDAGRYALYLRILDENAAARP
RSGA_BORPA       FPEFAPHI--EHCRFYNCTHRHE---PGCGVLAALQAGQIDAGRYALYLRILDENAAARP
RSGA_RALSO       FPEFRPRL--TECRFYNCRHLQE---PGCGILGAMAEGKIDPRRHALYAQLLHESEQQKP
RSGA_NEIMA       FPDFRHLV--GQCRFHNCTHRAE---PGCAFKAAAETRAASPERLAFLQGITDELPG---
RSGA_NEIMB       FPDFRHLV--GQCRFHNCTHRAE---PGCAFKAAAQTGAASPERLAFLQGITDELPG---
RSGA_NITEU       FIEFRPFL--GQCKFRDCRHIAE---PGCKLLLAAQEGMLNSRRIACYHKLVKGLKKSHP
RSGA_ECO57       FVEFHDYL--GLCKYRDCKHDTD---PGCAIREAVEEGKIAETRFENYHRILESMAQVKT
RSGA_SHIFL       FVEFHDYL--GLCKYRDCKHDTD---PGCAIREAVEEGKIAETRFENYHRILESMAQVKT
RSGA_ECOLI       FVEFHDYL--GLCKYRDCKHDTD---PGCAIREAVEEGKIAETRFENYHRILESMAQVKT
RSGA_ECOL6       FVEFHDYL--GLCKYRDCKHDTD---PGCAIREAVEEGKIAETRFENYHRILESMAQVKT
RSGA_SALTI       FVEFHDYL--GHCKYRDCKHDAD---PGCAIREAVENGAIAETRFENYHRILESMAQVKT
RSGA_SALTY       FVEFHDYL--GHCKYRDCKHDAD---PGCAIREAVENGAIAETRFENYHRILESMAQVKT
RSGA_YERPE       FVEFRDYL--GHCKFRDCSHTND---PGCALREAVEQGKIAEERFDNYHRILESMEQAKP
RSGA_PECAS       FIELREYI--GSCKFRDCKHEND---PGCAINAARERGDIARERFDNYHRILESMTQVKM
RSGA1_VIBVU      YLEFRPYL--GGCKFRDCKHADD---PGCIIREAVENGEISEVRYDNYHRIIESMAENKA
RSGA1_VIBVY      YLEFRPYL--GGCKFRDCKHADD---PGCIIREAVENGEISEVRYDNYHRIIESMAENKA
RSGA1_VIBPA      FVEFRPYL--GGCKFRDCKHNDD---PGCILREAVEKGEVSEVRFENYHRILESMMENKA
RSGA_VIBCH       YVEFRPYL--GGCKFRDCKHGDD---PGCLLREAVSKGEISALRFDNYHRIVQSMTENKA
RSGA_SHEON       FIEFRDFL--GGCKFRDCKHGDD---PGCALKAAVDAGKISEDRFNNYHRIIASLDEQRH
RSGA_HAEIN       YREFQYVL--GTCKFRDCKHLSD---PGCALREAVEQGKISPVRYDNYHRLIESLSETKS
RSGA_PASMU       YREFQYFL--GTCKFRDCKHLND---PGCALREAMEQGKIHSVRFANYHRLIASLEETKS
RSGA_HAEDU       YCEFQTIL--GNCKFRDCKHNTD---PGCAIKHAVEKGLINPIRFENYHRLIESRDETKS
RSGA_PSEPK       FIEFRDLF--GTCRFRDCKHDRE---PGCALLKALEEGRIKPQRMNSYRSIIASLAEDSY
RSGA_PSESM       FIEFNDLI--GTCRFRDCKHDRE---PGCALLKGLEDGRVQQQRMNSYRSIIASLPQDSY
RSGA_PSEAE       FIEFRDLL--GHCRFRDCKHDRE---PGCALLQALEDGRIMPQRMASYRHILASMPETDY
RSGA2_NOSS1      FADIETLA--PECRFRNCQHHNE---PGCAVQQALLEGELDYSRFLGYQKLQKELNYLVR
RSGA1_OCEIH      FSDINHLI--AECKFTDCKHDTE---PDCAVKEALETGDLEEGRWNSYLKLQRELAYIER
RSGA2_LACPL      FAEIAALA--TQCKFNDCTHTSE---PGCAVRAAVEVGTVTSERLQSYQKLQREMSYQGL
RSGA2_LISMF      FSDVEELA--EGCRFHDCSHTQE---PGCAVKAALEDGTLTMQHYENWLKLQREMAYHAR
RSGA1_LISMO      FSDVEELA--EGCRFHDCSHTQE---PNCAVQAALEDGTLTMQHYENWLKLQREMAYHAR
RSGA1_LISIN      FSDVEELS--KDCRFHDCSHTSE---PGCAVQESLADGTLSLKHYENWQKLQREMAYHAR
RSGA2_VIBVU      FAEIETLA--QHCRFKDCQHQQE---PGCAVQQAIDNGTLEARRLQNYFKLLREQAYNAS
RSGA2_VIBVY      FAEIETLA--QHCRFKDCQHQQE---PGCAVQQAINNGTLEARRLQNYFKLQREQAYNAS
RSGA2_VIBPA      FADVEALA--DHCRFGDCKHQTE---PGCAVQAAIENGSLEVRRFNNYQKLLREQAFNGA
RSGA_RHILO       FAEITELA--PLCKFRDCTHVHE---PGCAVQAALKAGTLDPERLARWRKLSDENQHNTP
RSGA_XANAC       FSDVEALA--AQCRFNDCAHIAE---PGCAVRAAIDAGELDPERVANYMKLRMEVASAAE
RSGA_XANCP       FSDVEALA--AQCRFNDCAHIAE---PGCAVRAAIEADQLDPERVANYMKLRVEVASAAE
RSGA_XYLFA       FADIELLA--TQCRFRDCAHQAE---PGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAAD
RSGA_XYLFT       FADIELLA--TQCRFRDCAHQAE---PGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAAD
RSGA_STRAW       FSEIEALA--AECRFHDCAHTAE---PGCAVLAALDTGELPERRLDSYRKLLRENQRIVA
RSGA_STRCO       FAEIAELA--EECRFHDCAHESE---PGCAVLAAIDSGALPERRLESYRKLMRENQRIVA
RSGA_LEPIC       FPEIAVAA--EECRFNDCSHNEE---PNCGVVAAVKDGRISEARYFSYLKLSKELMAYQA
RSGA_LEPIN       FPEIAVAA--EECRFNDCSHNEE---PNCGVVAAVKDGRISEARYFSYLKLSKELMAYQA
RSGA_METAC       FSEIVDAA--RNCKFKDCTHRNE---PGCAVLQAVRDGIIPEERLESYHRLTDELSFQSK
RSGA_METMA       FSEIVDAA--SNCKFKDCTHRDE---PGCAVLKAVKDGIIPEERLASYHRLTDELAFQSR
RSGA1_BACTN      MFEISDYA--ESCRFSDCKHIDE---PGCAVLEAVHNGTLDHKVYESYLKLRREAWHFSA
RSGA_RHOBA       MPDLRPYV--SGCRYPDCLHLAE---DDCAVKTAVADARIDARRYDAYCHLLEEELM---
                             * :  * *  :     * .                             

RSGA1_NOSS1      PESTLKLKTKGKGQSQYEPKLESKKYRRTSRRTQVQGLQDLYQEEE---------
RSGA_SYNY3       TDTGLKTKTGSDGQEYDEPKLETKKYRRHSRRQEHQELQSFCEQTDLDNLQEDWE
RSGA_THEEB       KVPLVKAKSDRQGQQRLEPLLDAKKYRRRSRRQQHQHVNPMAEEV----LDSEW-
RSGA_PROMA       -------------------------------------------------------
RSGA_BACAN       PRY----------------------------------------------------
RSGA_BACC1       PRY----------------------------------------------------
RSGA_BACCR       PRY----------------------------------------------------
RSGA_BACSU       PRY----------------------------------------------------
RSGA_BACHD       KRRF---------------------------------------------------
RSGA2_OCEIH      PRY----------------------------------------------------
RSGA1_LISMF      PRY----------------------------------------------------
RSGA2_LISMO      PRY----------------------------------------------------
RSGA2_LISIN      PRY----------------------------------------------------
RSGA_ENTFA       PVYKKKS------------------------------------------------
RSGA1_LACPL      VIYNKKK------------------------------------------------
RSGA_STRA3       ETYKKVIKRK---------------------------------------------
RSGA_STRA5       ETYKKVIKRK---------------------------------------------
RSGA_STRP1       ETYKKVIKRK---------------------------------------------
RSGA_STRP3       ETYKKVIKRK---------------------------------------------
RSGA_STRP6       ETYKKVIKRK---------------------------------------------
RSGA_STRP8       ETYKKVIKRK---------------------------------------------
RSGA_STRPN       ETYKKVSKKIPK-------------------------------------------
RSGA_STRR6       ETYKKVSKKIPK-------------------------------------------
RSGA_STRMU       ETYKKVLKRK---------------------------------------------
RSGA_LACLA       ETYEKKRKKQG--------------------------------------------
RSGA_STAAM       VRY----------------------------------------------------
RSGA_STAAN       VRY----------------------------------------------------
RSGA_STAAS       VRY----------------------------------------------------
RSGA_STAAW       VRY----------------------------------------------------
RSGA_STAAC       VRY----------------------------------------------------
RSGA_STAAR       VRY----------------------------------------------------
RSGA_STAHJ       VRY----------------------------------------------------
RSGA_STAES       VRY----------------------------------------------------
RSGA_STAEQ       VRY----------------------------------------------------
RSGA_STAS1       ERY----------------------------------------------------
RSGA_LACJO       PEYLKK-------------------------------------------------
RSGA_MYCPU       -------------------------------------------------------
RSGA_MYCPE       -------------------------------------------------------
RSGA_UREPA       KIKTRAQNRKCK-------------------------------------------
RSGA_MYCGA       -------------------------------------------------------
RSGA_MYCGE       -------------------------------------------------------
RSGA_MYCPN       -------------------------------------------------------
RSGA_CLOAB       YK-----------------------------------------------------
RSGA_CLOPE       N------------------------------------------------------
RSGA_CLOTE       NKW----------------------------------------------------
RSGA_CALS4       RRYKN--------------------------------------------------
RSGA_FUSNN       -------------------------------------------------------
RSGA_AQUAE       ELCRED-------------------------------------------------
RSGA_THEMA       K------------------------------------------------------
RSGA_BORBU       YAR----------------------------------------------------
RSGA2_BACTN      RAAY---------------------------------------------------
RSGA_PORGI       RPEY---------------------------------------------------
RSGA_CHLTE       -------------------------------------------------------
RSGA_BORPE       Y------------------------------------------------------
RSGA_BORBR       Y------------------------------------------------------
RSGA_BORPA       Y------------------------------------------------------
RSGA_RALSO       W------------------------------------------------------
RSGA_NEIMA       -------------------------------------------------------
RSGA_NEIMB       -------------------------------------------------------
RSGA_NITEU       WMETNKRV-----------------------------------------------
RSGA_ECO57       RKNFSDTDD----------------------------------------------
RSGA_SHIFL       RKNFSDTDD----------------------------------------------
RSGA_ECOLI       RKNFSDTDD----------------------------------------------
RSGA_ECOL6       RKNFSDTDD----------------------------------------------
RSGA_SALTI       RKNFSDTDD----------------------------------------------
RSGA_SALTY       RKNFSDTDD----------------------------------------------
RSGA_YERPE       RK-TSDSDEK---------------------------------------------
RSGA_PECAS       RKGFSDTDN----------------------------------------------
RSGA1_VIBVU      NRQYSRNKK--------ADL-----------------------------------
RSGA1_VIBVY      NRQYSRNKK--------ADL-----------------------------------
RSGA1_VIBPA      NRQYSRNKK--------ADL-----------------------------------
RSGA_VIBCH       NRQYSRSKKPICKSKLLASLEHLLTEGAIFSNISRPSPLYWNVNHG---------
RSGA_SHEON       ARQFRAQSDE---------------------------------------------
RSGA_HAEIN       QRHFSLV------------------------------------------------
RSGA_PASMU       QRHFSSEN-----------------------------------------------
RSGA_HAEDU       QRHFRT-------------------------------------------------
RSGA_PSEPK       -------------------------------------------------------
RSGA_PSESM       -------------------------------------------------------
RSGA_PSEAE       -------------------------------------------------------
RSGA2_NOSS1      KQEQRAQLAQKERWKKIHKAMRNHHQY----------------------------
RSGA1_OCEIH      KQNAKLATEERKKWKKISMQQKKNR------------------------------
RSGA2_LACPL      NSRQLEQAKIQRMFGGKQAMKRVKQRYHRD-------------------------
RSGA2_LISMF      KNSPALARQERDRWKVIQKSLRTHLKTRPKK------------------------
RSGA1_LISMO      KNSPALARQERDRWKVIQKSMRTHFKTRPKK------------------------
RSGA1_LISIN      KNSPALARQERDRWKTIQKSLRTHLKTRPKR------------------------
RSGA2_VIBVU      TFAEQRNRIKQIGKMYRHVQSDKQKLKTTY-------------------------
RSGA2_VIBVY      TFAEQRNRMKQFGKMCRHVQSDKQKLKTTY-------------------------
RSGA2_VIBPA      TLAEQRAQSRQFGKLTRNVMSDKRKRQQSY-------------------------
RSGA_RHILO       VQSGPRGAKSPAGRGKRR-------------------------------------
RSGA_XANAC       KLATRVAQNNRGKGSGKRPASVDRPGRH---------------------------
RSGA_XANCP       KLATRVAQNNRGKGSGKRPASVDRPGRR---------------------------
RSGA_XYLFA       RSTLRRY------------------------------------------------
RSGA_XYLFT       RSMLRRY------------------------------------------------
RSGA_STRAW       KTDARLRAEIRRDWKRKGAEGKAAMEAKRGQWG----------------------
RSGA_STRCO       KTDARARAEIRKEYKRRGAIGKAAMEAKRGGLR----------------------
RSGA_LEPIC       LNDPEEARKKKQKDKQMSKALQKRLKDKGRK------------------------
RSGA_LEPIN       LNDPEEARKKKQKDKQMSKALQKRLKDKGRK------------------------
RSGA_METAC       KAEIGLKRLEKERYREMAVNIKKYRKFTGKP------------------------
RSGA_METMA       KSEIGLKRLEKERFKKIAVDIKKYKKSTGKL------------------------
RSGA1_BACTN      SEHEKRKKEKSFTKLVEEVKKRKANF-----------------------------
RSGA_RHOBA       -------------------------------------------------------