CLUSTAL format seed alignment for MF_01830

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y3350_METRJ      --------MSQHPGADGAAPVFADAVDARRAIRAGRFRGHTSGLVPAHAQGNLMILPRAM
Y4744_VEREI      -----MEWVDTGSAMQAPDATFADTREARQAIRAGRWRRHTSGLAPAYVQGNLVILPVDL
Y2116_PSEAE      ---------MPEPTFHELAQLP--PPVLRQLIRRGDYTGHTSGLGQRHLQANLVILQKSW
Y3212_PSEA8      ---------MPEPTFHELAQLP--PPVLRQLIRRGDYTGHTSGLGQRHLQANLVILQKSW
Y3721_PSEAB      ---------MPEPTFHELAQLP--PPVLRQLIRRGDYAGHTSGLGQRHLQANLVILQKSW
Y3193_PSEA7      ---------MPAPTFDELAQLP--PPTLRQLIRRGDYAGHTSGLGQRHLQANLVILQKSW
Y6345_CUPTR      ---------MNQPLQHAASLLPEDPAALRQLIRAGRYRGHTSGLARGHVQANIVILTRDW
Y2997_BORBR      --MRRPVPYHRVAAIMTILSLAGAGHQARLDARGGMLTGPTANLAPGHVQANLAILPQAV
Y3031_BORPA      --MRRPVPYHRVAAIMTILSLAGAGHQARLDARGGMLTGPTANLAPGHVQANLAILPQAV
Y1875_BORPE      --MRRPAPYHRVAAIMTILSLAGAGHQARLDARGGMLTGPTANLAPGHVQANLAILPQAV
Y2233_BORPD      ---------------MTHTPQSGTAYRARLEARAGRLAGPTANLAPGHVQANLAILPADV
Y1776_POLSJ      ----MSTSSESALSVFGAGDINNAAY-VRSIIRQGRWTSHTSGLASEHVQGNVVILPADE
Y5282_BURCM      ----------------------MTPSEFRQSVRSGAFRQPTAGQCGPFAQANLAILPNAY
Y3459_BURA4      ----------------------MTPSEFRQSVRSGAFRQPTAGQCGPFAQANLAILPNAY
Y4029_BURVG      ----------------------MTPSEFRRSVRSGAFRGPTAGQCGPFAQANLAILPNAH
Y3550_BURCH      ----------------------MTPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAY
Y3969_BURCC      ----------------------MTPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAY
Y4037_BURCJ      ----------------------MTPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAY
Y2576_BURL3      ----------------------MTPSEFRQSVRHGAFRGPTAGHCGPYAQANLAILPEAV
Y3391_BURM1      -------------------MNPITPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAY
Y2364_PARP8      ----------------------MTPFEFRQAVRHRDFRGPTAGHCGDYAQANLAILPAAH
Y4813_PARPJ      --------------------MSYTPSEFRQQIRSRRLSGPTAGYCGDYAQANLAILPKQH
Y4977_DELAS      ------------------MTHWTHPTEFRQEVRAGRFRGQTAGQCPGYTQGNLAILPREC
Y1097_METNO      ----MQTAPLRRPADLSHLSAHEA----RLACRRGEITGSTAGLAPGHVQANLAVLPKEL
Y2125_METS4      ------MTFLRNPADRARLTGHEA----RLACRRGEIVGSTAGLAHGYVQANLAVLPKDL
Y1503_XANP2      ---MASTASLRVAPQADTYAAYQTPLAVRQACRSGALTGPTAGMAPGYVQGNLAVLPKEL
Y4080_AZOC5      ---MTAHASIATPGGISLATGRDV----RLASRSGALTGSTAGFAPGFVQANLAILPAKL
Y2883_BRASB      --MTVSAAVQQQAGEAGLLPSHQA----RLDYRTG-KGWSTAGVANGFVQGNLAIIPEQY
Y2538_BRASO      --MTVSAALQQSADEAGLLPSHQA----RLDYRTG-KGWSTAGVANGFVQGNLAIIPERY
Y2921_BRADU      --MTVLVAAQQT-ETPDPLPSRQA----RLAYRGG-EVGSTAGVAPGFVQGNLAILPAEY
Y1747_RHOPA      --MTVFAAEQQFHDAERPLPSHQA----RLACRAG-LAETTAGVAPGFVQGNLAILPEKY
Y1947_RHOPT      --MTVFAAEQQFHDAERPLPSHQA----RLACRAG-LAETTAGVAPGFVQGNLAILPEKY
Y1846_RHOPS      --MTVFPAGQQFQTEGECLPSYQV----RLACRAG-QADTTAGVAPGFVQGNLAILPEKY
Y3621_RHOP2      --MTVFAASQQSAAGAGMLPSHQA----RLACRAG-QADTTAGVAPGYVQGNLAILPEKF
Y1692_RHOP5      --MTVLAA-HRLQGAEPLLPSLQA----RLACRAG-NAQQTAGVAPGFVQGNLAILPEKL
Y1666_RHOPB      --MTVLTA-PGFSGAAPTLPSVAA----RLACRAG-NAEQTAGLAPGYVQGNLAILPENL
Y2444_RHIL3      ----MNIVSNRQEQAFSNPLAMRA------ASRNGSWTRETSGAALGYVQANLAILPSAL
Y188_GLUDA       ---MVDSDSARLPYFNASPAEVRR------LCRAGESGPVTAGMAAGYIQANIVMLPASL
Y1377_ALIF1      --------MDQGLSLNTLP-----LKELRNLIRNNQFTGSTTGCAAGYLQANLVILPAEW
Y1458_ALIFM      --------MDQGLSLNTLP-----LKELRNLIRNNQFTGSTTGCAAGYLQANLVILPAEW
Y1435_ALISL      --------MDKDLSLDNL----------RKKIRSNEFTKATSGYAPGYLQANLVILPALW
Y1731_SHEWM      --------MQKPVNNNFKESLLRTVESLRKSIRSGEMDDSTSGLVPGLVQANIVILPKIW
Y7359_AFIC5      -MSAPRPVYDPSWDRANPN-------EVRRSIRERGYTGYTAGLAPGFVQANICILPKDW
Y660_PELUB       -----------MLDIKNPI-------EARKVIRKNEYRNQTAGTANKYVQGNLCILPSKY
Y3152_DINSH      MPWPAHCRHVTGEVGIYQTLKHKPLAEVRAAIRAGQYCSHTAGLGKGFLQANLAIMPEAY
Y1111_RUEPO      -----------MSVG-YDRLKTSSLAELRAAIRSGAYRSHTAGLGQGYLQANLAILPEAY
Y2570_JANSC      ----------------MGLHSTADAAAIRASIRSGAFGGHTSGMAPGKLQCNLAILPAAH
Y610_DINSH       -----------------------MHSSVPAEIRSGQHQGHTAGLAPGCLQVNLVVLPASH
Y2409_RUBXD      -------------------MGAPGAAEARERIRRGEHAGPTAGLAPGYAQANLVILPEEH
YCSI_BACSU       ----------------------MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDL
Y430_BACVZ       ---------------MKNHMSDMSPEEVRQLVRKGQMTGPTAGMAASYAQANLVVLQKDL
Y2808_BACLD      -----------------MHVNEMRPDEVRALIRKGEITGPTAGMAGGFTQANLVILKKEL
Y2103_GEOKA      ----------------MTFAAPMSSKEARQMIRNNEWVKPTAGVANGYTQANLVVLPKEL
Y381_BACP2       ----------------MNIYQTYEPSQIRELIRKKEITGPTAGLAEGYAQANLMIVKKEL
Y2764_PSEU5      --------------MNLTAYRDLSPAALRERIRQGEFDGPTAGLANGYAQANLMIVRREL
Y1160_THEP3      -------------MPEKINYENLKPSEARQLIREGVLTGPTAGIALGYTQANLVMLPKEL
Y1597_THEPX      -------------MPEKINYENLKPSEARQLIREGVLTGPTAGIALGYTQANLVMLPKEL
Y1103_PSYA2      ----------------MLDLANMTPKEVRALIGKNEINKPTSGMCKGHIQANLVIVPKNL
Y2760_CLOB8      -----------------MDYSKMKPSEVRNLIREGKITGPTSGMCAGYAQANLVILPKEL
Y1142_NATTJ      ------------------MTWKQNETEIRQRIKEGQYDGPTTGLMNGFTQANLVILPQNL
Y2975_ALKMQ      -------------------MNTKSVKDIWKAIEFGEWRKPTSGLAPGYTQANVVILPKKD
Y3393_SYNFM      ------------------MTGMESPRDIRARIARSQWTKPTTGLAPAYAQANVVILDRRY
Y2211_STACT      ----------------MTDLQNIEPQALRKLIRDKKVTGHTSGMAKGYIQANVVILPLDY
Y308_STAS1       -----------------MNIQDAQPSTLREMIKQGKLTGHTSGMAKGYVQANVVILPSKC
Y274_STAHJ       -----------------MNYKQSSPEVLRQLIRDGELVGHTSGMAEGYIQANVVILPSKY
Y3382_OCEIH      ----------------------MHPKQQRESFRSKQYTGTTSGMCDNYLQANMIILPKEY
Y8587_AGRRK      ----------MIALDHLRHVNVEAARTARARYRAG-TVEPTSGIAPGFTQANMIVLPRDW
Y5849_AGRVS      ----------MIALKHLAHWDVEPARAARARYRSG-DVEPTSGVAPGFTQANMIVLPRDW
Y3911_AGRFC      ---------MTIPTSYLNHTDAEAARKARATYRDG-LVAPTSGIAPGFTQANMIVLPRDW
Y5759_CUPNH      --------MQDSALERTRIAAVNAARAARASYRAG-TVQPTAGIAPGMTQANMIALPRDW
Y2449_CUPPJ      --------MTNHMLDEVRSAAVAAARTARESYRAG-KIQPTAGVAPGMTQANMIALPRDW
Y3512_ACIAC      ---------MNSPLEAARAAAIHAARAARARYRAG-VVEPTAGRAPGMTQANMIALPREW
Y5379_PSESM      ----------MNAFDRARQSAIAAAREARGTYRNG-LVTPTAGVAPGMTQANLIALPRDW
Y321_PARDP       ---------------MTLLPDPAEARAARLACRQG-APRPTAGMAPGFTQCNMISLPKDW
Y498_PSEU2       --------------MNSLQLAREAASAARTRYRQG-FVAPTAGEAPGLTQCNMITLPREW
Y1454_ACIB5      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPRDW
Y2264_ACIB3      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPRDW
Y2440_ACIBY      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPRDW
Y2257_ACIBS      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPRDW
Y1268_ACIBT      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPRDW
Y1268_ACIBC      ----------MYKDIKVDPAQLEAALDARLKIRAG-FDKPTAGMAAGMTQVNMISVPKEW
Y2519_ACIAD      ----------MNTSILAPPESLLEAQKVRLAIREG-YDRPTAGMANGLTQVNMISVPQDW
Y534_KINRD       ------------MVRLAPEERRREARAARAAYRAG-RRGPTSGVAPGMTQANLVAVPADW
Y6940_STRAW      MNR---VTPDRPLSRIDGHAHAWTPRKARARFRWG-VFGPTAGVAAGHTQANLISLPADW
Y1412_STRCO      MNRPHSATGDRPLALVDEHAHAWSPKTARARFRKG-LTGPTAGVAAGHTQANLISVPADW
Y3268_RHOOB      MPD--------------------SPTDLRSAFRSG-RVTPTAGLAPGFAQTNLIAVPQDW
Y3475_RHOJR      MTD--------------------SPADLRSAFRSG-RVTPTAGLAPGFAQTNLIAVPQDW
Y093_NOCSJ       MNS-------AVPGTTHDDIAALTPARARERFRAG-ERVATSGWCPGFTQANLIAVPQQY
Y3576_ARTS2      ---------------MNQATALMAPSDARLKFRNG-LVTPTSGWSDGYTQANLIAVAADY
Y2544_CORGL      -------------MNRSTI----SPVEARQQFRAG-LIQPTSGWSAGFAQANLISMPQDL
Y2449_CORGB      -------------MNRSTI----SPVEARQQFRAG-LIQPTSGWSAGFAQANLISMPQDL
Y077_BIFAA       ------MVDGMSDMGTTELGAASTPEQARAAFRDG-LVRPTCGIAQGYAQANLMILPKEQ
Y403_CORJK       ------MADEVVGQEYQGNPGAFSPQQARQIFRAG-TVAHTSGYSRGYAQANLITLPQEQ
Y1581_CORU7      ---------------MSTSTHEMSPAAARAAFREG-VAVPTTGYSDGYAQANLMVLPKEY
Y5194_MYCGI      ---------------MNPDVNAISPAEARRRFRDG-LVTPTAGWSAGYAQANLIAVPRDY
Y1553_SACEN      ----------------------MSPAAARAAFRAG-LRVPTSGYSAGWTQANLIALPRDY
                                                         * .      * *:  :    

Y3350_METRJ      AEDFHRFCQQNPKPCPILGVSRPGARAL-----PTLGADLDLATDVPGYRVYEGGELAAQ
Y4744_VEREI      ASDFMRFCQSNPKPCPLLAVGQAGDPAL-----PTLGRDIDIRTDVPAYRVYRDGVLVGE
Y2116_PSEAE      ADEFLRFCALNPRACPLLDVSEPGSPHF-----ARLGADIDVRSDLPRYRVHRRGQEPVE
Y3212_PSEA8      ADEFLRFCALNPRACPLLDVSEPGSPHF-----ARLGADIDVRSDLPRYRVHRRGQEPVE
Y3721_PSEAB      ADEFLRFCALNPRACPLLDVSEPGSPHF-----ARLGADIDVRSDLPRYRVHRRGQEPVE
Y3193_PSEA7      ADEFLRFCALNPRACPLLDVSEPGSPHF-----ARLGADIDVRSDLPRYRVHRRGQEPVE
Y6345_CUPTR      AYDFLQFCALNRKACPLIDVTDPGDPVF-----RNLGRDVDIRTDVPMYRVYRDGNAYHE
Y2997_BORBR      AGDFLRFCQRNPKPCPLLAVSEPGDPSL-----PELGLDIDIRTDVPRYRVWRDGKLVDE
Y3031_BORPA      AGDFLRFCQRNPKPCPLLAVSEPGDPSL-----PELGLDIDIRTDVPRYRVWRDGKLVDE
Y1875_BORPE      AGDFLRFCQRNPKPCPLLAVSEPGDPSL-----PELGLDIDIRTDVPRYRVWRDGKLVDE
Y2233_BORPD      AGDFLRFCQRNPKPCPLLAVSEPGDPAL-----PSLGHDIDVRSDIPRYRVWRDGQLAGE
Y1776_POLSJ      ANDFLRYCQRNPKPCPLLAVSEPGHAGL-----PTLGADLDIRTDLPRYRVWRHGEVVDE
Y5282_BURCM      AHDFLRFCQANPKACPLLGVGEPGAFRL-----DVLGEDLDIRTDVPSYNVYRDGRLTER
Y3459_BURA4      AHDFLRFCQANPKACPLLGVGEPGAFRL-----DVLGEDLDIRTDVPSYNVYRDGRLTER
Y4029_BURVG      AHDFLRFCHANPKACPLLGVGEPGAFRV-----DVLGADLDVRTDVPSYNVYRDGRLTER
Y3550_BURCH      AHDFLRFCQANPKACPLLGVGEPGAFRI-----DALGDDLDIRTDVPSYNVYRDGRLTER
Y3969_BURCC      AHDFLRFCQANPKACPLLGVGEPGAFRI-----DALGDDLDIRTDVPSYNVYRDGRLTER
Y4037_BURCJ      AHDFLRFCQANPKACPLLGVGEPGAFRI-----AALGEDLDIRTDVPSYNVYRDGRLTER
Y2576_BURL3      AHDFLRFCQANPKACPLLGVGEPGAFRV-----DALGEDLDIRTDVPSYNVYRDGRLTER
Y3391_BURM1      AHDFLRFCQANPKACPLLGVGEPGAFRL-----DVLGDDLDIRTDVPSYNVYRDGRLTER
Y2364_PARP8      AHDFLRFCHANPKPCPLLGVGEPGDFRV-----PVLGRDIDIRTDVPAYNVYRDGELSER
Y4813_PARPJ      ADDFLRFCTLNPKACPLLGIGEPGDWRV-----PALGADLDIRNDVPAFYVYRHGERAEE
Y4977_DELAS      SEEFLRFARLNPKSCPLIGVTEPGSSRV-----PELG-DIDLKTDLPSYWVFRDGHRAEQ
Y1097_METNO      ATDFLLFAQRNPKPCPIIGVSAPGERRI-----PELGEDLDIATDIPGYRVWRNGEMVEE
Y2125_METS4      ATDFLLFAQRNPKPCPIIGVSAPGDRRI-----PELGEDLDIATDVSGYRVWRHGEMVEE
Y1503_XANP2      AEEFLRFCHFNPRPCPVIGMSEPGSFKV-----PVLGEDLDIRTDFPGYRVWQDGEVIAD
Y4080_AZOC5      AFDFLRFCQRNPKPCPVIGVSEPGDPTL-----SSIGLDLDIRTDVPGYCVYKDGVLVDE
Y2883_BRASB      AGAFHRFCQLNPKPCPIIGMSDPGNPFI-----PALGADLDIRTDVPRYRVWRDGEMVEE
Y2538_BRASO      AGAFHRFCQLNPKPCPIIGMSDPGNPHI-----PALGADLDIRTDVPRYRVWRDGEMVEE
Y2921_BRADU      ASAFHRFCQLNPKPCPIIGMSDVGSPHI-----PALGADLDIRTDVPRYRVWRDGEVVDE
Y1747_RHOPA      AAAFHRFCQLNPKPCPIVGMSDVGNPMI-----PSLGIDLDIRTDLPRYRVWRDGELVEE
Y1947_RHOPT      AAAFHRFCQLNPKPCPIVGMSDVGNPMI-----PSLGIDLDIRTDLPRYRVWRDGELVEE
Y1846_RHOPS      AAAFHRFCQLNPKPCPIIGMSDVGNPQI-----PALGLDLDIRTDLPRYRVWRDGELIEE
Y3621_RHOP2      AAAFHRFCQLNPKPCPIIGMSDVGNPMI-----PALGLDLDIRTDLPRYRVWRDGEVIEE
Y1692_RHOP5      AASFHRFCQLNPKPCPIIGMSDVGDPNL-----PALGRDLDIRTDLPRYRVWRDGELVDE
Y1666_RHOPB      AASFHRFCQQNPKPCPIIGMSEVGDPKI-----PSLGLDLDIRTDLPRYRVWRDGEMVDE
Y2444_RHIL3      ADDFLRFCVRNPKACPLVGISEKGSPRI-----PDLGVDLDIRTDVPRYRVWEDGELAAE
Y188_GLUDA       ADAFHEFCLRNPKPCPLVGMSRPGDYRL-----PSLGADLDLRTDLPLYRVWRDGNMVAE
Y1377_ALIF1      ATDFLLFCQKNPVACPLIDVTQPGEKYL-----QSIGRDIDLSTDVPEYHVFYDGEFETA
Y1458_ALIFM      ATDFLLFCQKNPVACPLIDVTQPGEKYL-----QSIGRDIDLSTDVPEYHVFYDGEFETA
Y1435_ALISL      ATDFLLFCQKNPVACPLIDVTQPGERYL-----PSIGADIDLSRDVPEYHVFYEGNFEAS
Y1731_SHEWM      AHDFLLFCQKNPIACPLIDVFDAGQFLL-----NSLGKDIDVRTDIPEYCVFVGGVKTEV
Y7359_AFIC5      AEDFLLFCQRNPKPCPLLTRSDVGDPSL-----PALSDNIDIRTDVPRYQIFRNGEFTEE
Y660_PELUB       AMDFASFCQKNPKPCPLIGFGTKGDPSL-----KDLGD-IDIRTDVPQYRIWEKGKIIDE
Y3152_DINSH      ALDFMRYCQRNPKPCPLSGVSDTGNPMM-----TTMGGQIDIRTDVPAYNIYRDGRLAGS
Y1111_RUEPO      ALDFMRYCQRNPKPCPLIGVSDTGNPMM-----FTLGRDIDIRTDVPAYNVYRDGRLDSV
Y2570_JANSC      ALDFLRFCQRNPKPCPVVGVSETGDPML-----PTLGVDIDIRTDVPRYRIFRDGVLTGE
Y610_DINSH       AQAFGEYCALNPRPCPLILLTTPGQTDW-----TELGTGLDVRRDVPAYNIYENGVLSRT
Y2409_RUBXD      ALDFLRFCVRNPKPCPLLEVTDTGSPVP-----RTLAPGADLRTDVPRYRVYERGKLVEE
YCSI_BACSU       AFDFLLFCQRNQKPCPVLDVTEAGSPVP-----SLAAPDADIRTDFPKYRIYRHGILTEE
Y430_BACVZ       AFDFLLFCQRNQKPCPVLDVTDAGSPVP-----AIAAPGADIRTDFPKYRIYRHGVLTEE
Y2808_BACLD      AFEFLLFCQRNQKPCPILDVTDPGSPVP-----SITAPDADIRTDFPKYRVYKRGELADE
Y2103_GEOKA      AFEFLLFCQRNPKPCPVLDVTEPGSWEP-----SMVAPGADLRVDLPKYRVYRNGELTEE
Y381_BACP2       AFDFLLFCQRNPAACPLLDVLEPGDPVP-----RKSAPKADIRTDFPKYRIYRKGILQEE
Y2764_PSEU5      AYDFLLFCQRNPKPCPLLDVTDPGSFEP-----RHAAPGADIRTDFPRYRIYRNGELDQE
Y1160_THEP3      AYDFLLFAFRNPKPCPILDVTDVGSPEP-----KGVAKGADLRTDIPKYRIYKKGVLEAE
Y1597_THEPX      AYDFLLFAFRNPKPCPILDVTDVGSPEP-----KGVAKGADLRTDIPKYRIYKKGVLEAE
Y1103_PSYA2      AYDFLLFAQRNPKSCPILDVTDVGSSEP-----RLMAKGADLKSDVPMYRIYEFGELVAE
Y2760_CLOB8      AYDFLLFSQRNPKACPILEVSDVGSRSL-----RYIAEDADIAKDIPKYRVYEDGILTGE
Y1142_NATTJ      AYDFLLFCQRNPKPCPLLEVIDTGKYEP-----KETAPGKDLRTDLPRYYIYRDGVKSAE
Y2975_ALKMQ      AFDFLLFCYRNEKPCPIVDICEPGQVAP-----PVAGPDADIRVHVPKYRIYRHGELDKE
Y3393_SYNFM      AFDFLLFCVRNSKPCPILEVLEPGVTEP-----HATAPGADIRTDVPLYRVWRKGRLEQE
Y2211_STACT      AYDFLKFCFKNPKTCPLLDISEVGEVNF-----SKYGKDADITTDVGAYRVYENGELIET
Y308_STAS1       AYDFLLFCFRNPKTCPLLDVSEKGNKSF-----TKYGVTADISTEVAAYRIYQYGELIET
Y274_STAHJ       AYDFLKFCFRNPKTCPLLDVSEVGAHSF-----PYYGPYADIRTDVPKYRIYEHGQLIKE
Y3382_OCEIH      AFEFLLFCQRNPKSCPIIDVLEEGVT-------TPQIADADIRTDLPKYRIYRNGQLDKE
Y8587_AGRRK      AFDFLLYAQRNPRACPVLDVSDPGSHTT----LLAPGA--DLRKDLPLYRVWRDGKLAEE
Y5849_AGRVS      AFDFLLYAQRNPKACPVLDVSDPGSHLT----ELAKGA--DLRTDLPLYRIWRDGKLAEE
Y3911_AGRFC      AFDFLLYAQRNPKPCPVLDVSDPGSPTT----LLAPGA--DLRTDLPLYRIWRDGKLAEE
Y5759_CUPNH      AWDFLLYAQRNPKACPVLDVIEAGAQQT----VLAQGA--DIRTDIPLYRVWRDGKLAEE
Y2449_CUPPJ      AWDFLLYAQRNPKACPVLDVIEAGAYHT----VLAEGA--DIRTDIPLYRVWRNGRLVEE
Y3512_ACIAC      AWDFLLYAQRNPKPCPVLDVIEAGSHAT----VLAEGA--DLRTDIPLYRVWRDGRLAGE
Y5379_PSESM      AYDFLLYAQRNPKACPILDVSDAGSPTT----LLAEGS--DLRTDIPMYRIWRDGKLAEE
Y321_PARDP       AWDFLLYAQRNPKPCPVLDVTDPGSHRT----ALAPKA--DLRTDIPLYRIWRDGVLAEE
Y498_PSEU2       AYDFLLFAQRNPQACPVLDVTEPGSHTT----LLAEQA--DLRTDLPLYRVWRDGQLAEE
Y1454_ACIB5      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y2264_ACIB3      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y2440_ACIBY      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y2257_ACIBS      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y1268_ACIBT      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y1268_ACIBC      AYDFLLYAHRNPQSCPVLDVLEEGIYAT----KLAADS--DIRTDFPRYRIWKDGEMVDE
Y2519_ACIAD      AYDFLLYTQRNPQSCPVLDVIDAGQFQS----RLIQDKQHDIRTDFPRYRIWEYGQCVDE
Y534_KINRD       AFDVLLYAQRNPRACPVLDVLEAGRVES----ALAPGS--DVRTDLPAYLVFRDGVVVEE
Y6940_STRAW      AYDMLLFCQRNPKPCPVLDVTDAGSWTT----PLAEGA--DLRTDLPRYRVWENGELVAE
Y1412_STRCO      AYDMLLFCTRNPQPCPVLDVTDAGSWTT----VLADGA--DLRTDLPRYRVWRDGELVDE
Y3268_RHOOB      AYDVLLFTQRNPKPCPVLDVGDAGSRTT----MLAPGA--DITTDLPLYRVWKDGELADE
Y3475_RHOJR      AYDVLLFTQRNPKPCPVLDVGDVGSRET----VLAPGA--DITTDLPLYRVWKDGELADE
Y093_NOCSJ       AYDVLLFTQRNPKACPVIDVTDAGSVEP----GIAPGA--DLRTDLPGYRVYEEGRLVAE
Y3576_ARTS2      ADEFIEFCRLNPKACPVIDIIPAGRHES----VLAAGS--DIRSDVPAYRIWVDGELADE
Y2544_CORGL      AYDFLLFAQRNPKPCPILEVLNAGETFGGIFGSNATEA--DIRTDAPQYRIYAHGELIDS
Y2449_CORGB      AYDFLLFAQRNPKPCPILEVLNAGETFGGIFGSNATEA--DIRTDAPQYRIYEHGELIDS
Y077_BIFAA       AFDFLLFAQRNHKPCPLLEVMEPGVTAP----VTAPGA--DIRTDVPLYRVWKRGELVAE
Y403_CORJK       AFDFLLFAQRNPKPCPLLGVLEAGQVSS----ELLADG--DIRSDIPLYRVYRKGQLDSE
Y1581_CORU7      AFDFLLFAQRNPKPCPILGVLEPGQLNS----ELLPGG--DIRTDIPKYRVYRDGELAGE
Y5194_MYCGI      AFDLMLFAQRNPKPCPVLDVLEPGQYAG----PLLAGG--DIRTDIPAYRIYVDGELVTE
Y1553_SACEN      AYDFLLFAQRNPKSCPVLDVTEPGETSA----SIFAG---DLRTDLPAYRVYRDGELVEE
                 :  .  :   *  .**:      *                *:  .   : :   *     

Y3350_METRJ      LPDLTGVWRE--DLVTFVLGCSFSFEAGLIEAGIPLRHVALGRNVAMYRTSIETQPSGPF
Y4744_VEREI      VDDLKALWRD--DFVAFVLGCSFSFEHGLIEAGIPLRHVDEGKNVAMYRTNIQTVPAGPF
Y2116_PSEAE      VSDIGTFWEA--DFVAFAIGCSFSFEQALLDAGIGLRHLELGRNVTMYRSSIATRPSGRL
Y3212_PSEA8      VSDIGTFWEA--DFVAFAIGCSFSFEQALLDAGIGLRHLELGRNVAMYRSSIATRPSGRL
Y3721_PSEAB      VNDIGAFWEA--DFVAFAIGCSFSFEQALLDAGIGLRHLELGRNVAMYRTAIATRPSGRL
Y3193_PSEA7      VNDIGAFWEA--DFVAFAIGCSFSFEQALRDAGIGLRHLELGRNVAMYRSSIATRPSGRL
Y6345_CUPTR      TTGITELWRD--DFVAFAIGCSFSFEQALLAANVPLKHINLGRNVAMYRTAIETRPAGRL
Y2997_BORBR      PLDVRGLWRD--DLVAFLIGCSFSFEEAMLENGLPVRHIEQGCNVPMYRTNIATHPAGPF
Y3031_BORPA      PLDVRGLWRD--DLVAFLIGCSFSFEEAMLENGLPVRHIEQGCNVPMYRTNIATHPAGPF
Y1875_BORPE      PLDVRGLWRD--DLVAFLIGCSFSFEEAMLENGLPVRHIEQGCNVPMYRTNIATHPAGPF
Y2233_BORPD      PTDVRDLWRD--DLVAFLIGCSFSFEEAMLDNGLPVRHIEQGCNVPMYRTSIPTEPAGPF
Y1776_POLSJ      PADISALWRK--DLVTFVIGCSFSFEEALMQAGLPLRHIEQQRNVAMYRSNIATEPAGAF
Y5282_BURCM      VESLEALWRD--DFVVFAIGCSFSFEDMLAREGIALRHIEEGRNVPMYRTSIPNRRAGIF
Y3459_BURA4      VESLEALWRD--DFVVFAIGCSFSFEDMLAREGIALRHIEEGRNVPMYRTSIPNRRAGIF
Y4029_BURVG      VDSLEALWRD--DFVVFAIGCSFSFEDMLAREGIALRHIEEGRNVPMYRTSIPNRRAGIF
Y3550_BURCH      VESLDALWRD--DFVVFAIGCSFSFEDMLAREGIGLRHVEEGCNVPMYRTSIANRRAGIF
Y3969_BURCC      VESLDALWRD--DFVVFAIGCSFSFEDMLAREGIGLRHVEEGRNVPMYRTSIANRRAGIF
Y4037_BURCJ      VESLEALWQD--DFVVFAIGCSFSFEDMLAREGIGLRHVEEGRNVPMYRTSIANRRAGIF
Y2576_BURL3      VESLEALWRD--DFVVFAIGCSFSFEDMLAREGIGLRHVEEGRNVPMYRTSIPNRRAGIF
Y3391_BURM1      VDSLEALWRD--DFVAFAIGCSFSFEDMLAREGIALRHVEEGRNVPMYRTSIPNRRAGVF
Y2364_PARP8      VESIETLWQD--DFVVFAIGCSFSFEHMLAKEGIGLRHVEEGRNVPMYRTTIANRRAGVF
Y4813_PARPJ      VRSLDELWRD--DLVVFAIGCSFSFEEMLRREGIALRHIEQQVNVPMYRTRERNVAAGVF
Y4977_DELAS      VNDLTDLWRD--DLVGFVIGCSYSFEDALRDAGVPVRHIDEGRGAPMFITDIANGQAGRF
Y1097_METNO      RRDVADLWRD--DLVAFAIGCSFSFEAAMVEDGLPLRHVEMGVRVPMYRTNIPCRPAGPF
Y2125_METS4      RLDVADLWRD--DLVAFAIGCSFSFEAAMVEDGLPLRHVEMGVRVPMYRTTVPCRPAGPF
Y1503_XANP2      TADVTDYWRD--DLVAFVIGCSLSFEEALMAEGLPLRHVDRNVRVPMFRTTVQCVPAGRF
Y4080_AZOC5      PADLKAYWRE--DLVTFAIGCSLSFEEALMAADIPLRHVEKGVKVPMFRTNIACVPAGPF
Y2883_BRASB      PTDLLAHWLD--DLVTFVLGCSFSFEEALMADGLPIRHIEQGCRVPMYRTNIACTPSGPF
Y2538_BRASO      PTDLLAHWRD--DLVTFVLGCSFSFEEALMADGLPIRHIEQGCRVPMYRTNIACTPSGQF
Y2921_BRADU      PTDVTGYWRD--DLVTFVLGCSFSFEEALLDEGMPIRHIEQNVRVPMYRTNIACGEAGPF
Y1747_RHOPA      PTDIVAHWRD--DLVAFVIGCSFSFEEALLADDIPIRHIEEKVRVPMYRTNIPCAPAGPF
Y1947_RHOPT      PTDIVAHWRD--DLVAFVIGCSFSFEEALLADDIPIRHIEEKVRVPMYRTNIPCEPAGPF
Y1846_RHOPS      PTDVMAHWRD--DLVAFVVGCSFSFEEALLADDIPIRHIERKVRVPMYRTNIACTPAGPF
Y3621_RHOP2      PTDIMAHWRD--DLVAFVIGCSFSFEEALLADDIAIRHIDCKVRVPMYRTNIPCAPAGPF
Y1692_RHOP5      PTDILAHWRD--DLVAFVIGCSFSFEEALLADDLPIRHIELGVRVPMYRTNIACAPSGPF
Y1666_RHOPB      PTDIMAHWRE--DLVAFVIGCSFSFEEALMADELPIRHIEQGVRVPMYRTNIACAPAGPF
Y2444_RHIL3      PTDISDLWSD--DLVVFAIGCSFSFEEALIANGIGLRHVAEGHNVAMYRTNIECVPAGPF
Y188_GLUDA       TGDIRDQWRD--DLVTFALGCSFSFENALTACDVPMRHLQLGRGVPVYRTNIACTPVGPF
Y1377_ALIF1      VSDLSTLWRE--DLVTFVLGCSFSFEEALIQSGLSIRNIDEGKNVSMYDTSIPCQSSGKF
Y1458_ALIFM      VSDLSTLWRE--DLVTFVLGCSFSFEEALIQSGLSIRNIDEGKNVSMYDTSIPCQSSGKF
Y1435_ALISL      VPDLTELWQD--DLVTFVLGCSFSFEEALIQSGLSIRNIDDGKNVSMYDTNIACQPAGKF
Y1731_SHEWM      KKDISDLWQD--DFVVFALGCSFSFEYALQQAGLSIANLESNSNVSMYETNVPTKSVGVF
Y7359_AFIC5      VTDIRSHWRD--DLVTFAFGCSFSFEEALQDDGIPLRFLANNNVAGVYVSTMPTEAAGPF
Y660_PELUB       PYDIKKYWNE--DLTTFVLGCSMSFELPLIEAGIPIQHIENDTIVPMYRTSIDCEPAGQF
Y3152_DINSH      VTDIRDLWQD--DFVAFALGCSFTFEHALQQAGIALWHIDNDKTVPMYRSGIDTVPAGPF
Y1111_RUEPO      SADITEDWRD--DLVVFALGCSFTFEHAVMRAGVALWHVDNDRTVPMFRSNIETVPAGPF
Y2570_JANSC      VTDIRDLWTD--DLVSVALGCSFTFENALVRAGIPVRHIEDGVNVPMFRTNIPLVPAGPF
Y610_DINSH       VPDLLNDWSD--DLVTFALGFSFTFEHALLRAGIPVRNIATNTTVPMYQTNRETRSAGPF
Y2409_RUBXD      PADILPRWRG--DLVCFLLGCSFTFERALLAAGLRLAHVEQGRNVPMYVTNRRCAPSGPF
YCSI_BACSU       VSDITPYWED--DFVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCVPAGAF
Y430_BACVZ       VTDITPYWKD--DDVGFLIGCSFSFEQALINQHIPIRHIDEGVNVPMYKTDIDCVPAGPF
Y2808_BACLD      VTDISSLWED--DMVGFLIGCSFTFEQALMNNGIPVRHIEEKRNVPMYQTNIPCVPAGRF
Y2103_GEOKA      RTDIIDLWDK--DMVGFLLGCSFTFEHALVNNGIPVRHIQENCNVPMYKTNIPCVKAGRF
Y381_BACP2       VSDISAYWED--DMVAFLIGCSFTFEHALMLNDIPVRHIENGHNVPMYQTNIACKRAGVF
Y2764_PSEU5      VQDITPFWED--DMVAFLIGCSFSFEAALLANGVPVRHIEDGHNVPMYRTNIACQPAGGL
Y1160_THEP3      VNDIRDYWRD--DFVAFLLGCSFTFEKALLENDIPVRHIEEGKNVPMYITNIETRPAGIF
Y1597_THEPX      VNDIRDYWRD--DFVAFLLGCSFTFEKALLENDIPVRHIEEGKNVPMYITNIETRPAGIF
Y1103_PSYA2      VSDLTDYWRE--DLVCFLLGCSFSFESAMLNASIPVRHIEDNHNVPMYITNIETEPAGQF
Y2760_CLOB8      YTSVEHLWRD--DFVSFLIGCSFSFESELLEAGVPVRHIEENCNVPMFITNIECEPAGIF
Y1142_NATTJ      VTDINKYWTQ--DLVSFLLGCSFTFESFFLQRGVPVRHIEEGVNVPMYRTNIKCKDAGVF
Y2975_ALKMQ      VDDIKSYFTE--DMVTFLIGCSFTFEKELLEKGVPVRHMEEGKNVPMYVTNRQCQSAGIF
Y3393_SYNFM      ATDITGCFDA--GMVSFLLGCSFTFEASLTGAGVPVRNIEEGKNVSMYVTNRKCASAGPF
Y2211_STACT      PTDVKHLFND--QMVSFLIGCSFTFEHALLEAGIPLRHLEEGHNVPMYITNIPAEPAGRF
Y308_STAS1       RANVDDLYTD--DMVSFLIGCSFTFEHALLEAGIPIRHLEENHNVPMYVTNIPANPSGQF
Y274_STAHJ       VDDITDLYTE--DMVSFLIGCSFTFEHALLEAGLPVRHIEEGHNVPMYRTNIPAESSGYF
Y3382_OCEIH      VTDIKDKWRA--DFVTFLIGCSFTFEKALIENGIRLLHQEQERVVPMYKTNIPCEKAGRF
Y8587_AGRRK      TTDATAAWGEHPDLVSFLIGCSFTFETPMVEAGIEIRHITDRSNVPMYLTNKACRPAGRL
Y5849_AGRVS      TPDATAAWAEHPDLVSFLIGCSFTFETPMVEAGIEIRHMTDKSNVPMYLTNQPCRPAGRL
Y3911_AGRFC      TADATSAWAERDDLVAFLIGCSFTFETPMVEAGIEIRHMTDKSNVPMYLTNRPCRPAGRL
Y5759_CUPNH      VADATPLWTEHPDLVTFLIGCSFTFETPLQEAGIEVRHIADGSNVPMYRTNRQCRPAGRL
Y2449_CUPPJ      VADATPLWQEHPDLVTFLIGCSFTFETPLLEAGIEVRHITDGSNVPMYRTNRQCRPAGRL
Y3512_ACIAC      VSDATALWAGQPDLVTFLIGCSFTFETPLQEAGIEVRHIAQGCNVPMYRTQRMRRPAGRL
Y5379_PSESM      VSDATQAWAEHDDMVAFLIGCSFTFETPLQEAGIEVRHITDGCNVPMYRTNRACRPAGRL
Y321_PARDP       TPDATAAWAEHPDLVTFLIGCSFTFETPLQQAGIEVRHIAQGCNVPMFLTDRDCRPAGRL
Y498_PSEU2       LSDVSHIWAQHTDLVSFLIGCSFTFETDLMHAGIDVRHISEGCNVPMYRSNRVCRPAGRL
Y1454_ACIB5      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIKCEPAGRI
Y2264_ACIB3      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIKCEPAGRI
Y2440_ACIBY      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIKCEPAGRI
Y2257_ACIBS      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIKCEPAGRI
Y1268_ACIBT      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIKCEPAGRI
Y1268_ACIBC      VTDAREIYNAHPDLVTFLIGCSFSFETALQEAGIEVRHIHDDTNVPMYLSNIECEPAGRI
Y2519_ACIAD      VNDATSIWNNHPDLVTFLIGCSFSFESALLNAGIEVRHITDQRNVPMYLSNIPCASAGRI
Y534_KINRD       VPDATGYWD---DLVTLLIGCSFTFETPLLAAGIPVRHQELGRNVPMYRTDRPCAPAGRL
Y6940_STRAW      PTDVVAYWRD--DLVSFLIGCSFTFEWALSEAGVPMRHIEQGRNVSMYVTSRACRPAGRL
Y1412_STRCO      PSDVREHWRD--DLVTFLIGCSFTFEWALAAAGVPIRHVEQGRNVPMYVTSRACRPAGRL
Y3268_RHOOB      TADVSSLWRD--DLVAFHIGCSFTFEHPVAAAGVPLRHVEQGSNVPMYVTDRECRPAGRV
Y3475_RHOJR      TADVSGLWRD--DLVAFHIGCSFTFEHPVAAAGVPLRHVEQGSNVPMFVTNRECRPAGRM
Y093_NOCSJ       TGDAREHWRE--DMVAFLIGCSFTFERALLESGVPVRHLTAGTNVPMYRTNRACRPAGRL
Y3576_ARTS2      VTDATSVWRD--DMVGVLIGCSFTFEAALASEGIPLRHTETGRNVPMYRTNIECTPAGRI
Y2544_CORGL      PASAVDYWRD--DLVSFIIGCSFTFEHPMVQAGVPVRHLEAGRNVPMYETSLACRPAGSL
Y2449_CORGB      PASAVDYWRD--DLVSFIIGCSFTFEHPMVQAGVPVRHLEAGRNVPMYETSLACRPAGSL
Y077_BIFAA       VPDIREYWRS--DLVTFVIGCSFTFEFPLMEAGVPVRHITAGRNVPMYDTSIECRSAGAF
Y403_CORJK       VPDVRDVWRE--DLVSFIIGCSFTFETALLDNGVPVEHIAQGKNVPMYRTSIPTNSAGAF
Y1581_CORU7      YPDVTEFWRD--DLVSFLIGCSFTFEGALLDNGIPVAHIEQGRNVPMYKTSIPTARAGRF
Y5194_MYCGI      VADATEYWTD--DLVAFLIGCSFSFEAALLDSGVPVRHIEEDVNVPMYRTDRPCRSAGRI
Y1553_SACEN      VGDVTGLWRD--DLVSFLVGCSFTFEAALLEAGVPVRHIETGGNVPMYRTNRDCRPAGRM
                   .    :      . . .* * :**  .    : :        . :: :       * .

Y3350_METRJ      HGPLVVSMRPMKAADAIKAVQVTARMPAVHGAPIHLGDPGLIGIRDLARPDFGDPVPIEP
Y4744_VEREI      HGPMVVSMRPMKAADAIRAVQITARVPQVHGAPVHIGDPALIGIADITQPDFGDAVRIAP
Y2116_PSEAE      AGPTVVSMRPLKAAEAIRAIQVTSRFPMTHGAPLHLGDPALIGIRDLARPDYGDPVPLAA
Y3212_PSEA8      AGPTVVSMRPLKAAEAIRAIQVTSRFPMTHGAPLHLGDPALIGIRDLARPDYGDPVPLAA
Y3721_PSEAB      AGPTVVSMRPLKAAEAIRAIQITSRFPMTHGAPLHLGDPALIGIRDLARPDYGDPVPLAA
Y3193_PSEA7      AGPTVVSMRPMKAADAIRAIQVTSRFPLTHGAPLHLGDPTLIGIRDLARPDYGDPVPLAA
Y6345_CUPTR      SGKLVVSMRPLKAADAILATEITARYPDVHGAPVHIGDPRLIGIEDIESPDYGDAVPLDA
Y2997_BORBR      SGPLVVSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPALIGIADLGRPDYGDAVEIRA
Y3031_BORPA      SGPLVVSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPALIGIADLGRPDYGDAVEIRA
Y1875_BORPE      SGPLVVSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPALIGIADLGRPDYGDAVEIRA
Y2233_BORPD      RGPLVVSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPAQIGIADINRPDYGDAVEIRP
Y1776_POLSJ      HGPMVVSMRPFKASDAIRAIQITSRFPDVHGAPVHMGDPAQIGIADLARPDYGDAVEVLP
Y5282_BURCM      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPVHIGHPLELGIADLGTPDFGDAVTVRD
Y3459_BURA4      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPVHIGHPRELGIADLGAPDFGDAVTVRD
Y4029_BURVG      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPIHIGHPRALGIADLGAPDFGDAVTVRD
Y3550_BURCH      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPIHIGDPRALGIEDLNAPEFGDAVTIRD
Y3969_BURCC      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPIHIGDPRELGIEDLNAPEFGDAVTIRD
Y4037_BURCJ      GGQLVVSMRPLRGADAIRAVQITSRFPGVHGAPIHIGHPRELGIDDLNAPEFGDAVTIRD
Y2576_BURL3      GGQLVVSMRPMRGADAIRAVQITSRFPGVHGAPIHLGDPRELGIADLNAPEFGDAVTIRD
Y3391_BURM1      GGQLVVSMRPMRGADAIRAVQITSRFPGVHGAPIHLGDPRELGIADLGAPDFGDAVTIRE
Y2364_PARP8      GGELVVSMRPLRGADAIRAVQITSRFPGVHGAPVHIGDPAELGIADLARPEFGDAVTIRA
Y4813_PARPJ      GGNRVVSMRPMKAADAIRAIQITSRFPAVHGAPVHIGDPSLIGIRDLASPDFGDAVEVRS
Y4977_DELAS      GGRMVVSMRPMTAAQAIRAIQVTSRFPSVHGAPVHLGDPAQIGIADIERPDFGEPMALKP
Y1097_METNO      GGPMVVSMRPLKPADAIRAVQITSRFPAVHGAPVHLGLPEAIGIRDLAKPDYGDPVRIGA
Y2125_METS4      AGPMVVSMRPLTPAQAIRAVQITSRFPAVHGAPVHLGLPEAIGIRDLGRPDYGDPVRVAP
Y1503_XANP2      SGRMVMSMRPLVPAHAIRAIQITTRFPQVHGAPLHVGLPELIGVKDLMKPDYGDAVEVLD
Y4080_AZOC5      AGPMVVSMRPMTPANAIRAVQITSRFPSVHGAPIHIGLPEAIGIKDLSKPDYGDAVEILE
Y2883_BRASB      AGPMVVSMRPFKPAQAIRAVQITTRFPAVHGAPVHLGHPDQIGIVDINKPDYGDPVPVAA
Y2538_BRASO      AGPMVVSMRPFKPAQAIRAVQITTRFPAVHGAPVHLGLPEQIGIADINTPDYGDPVPVGT
Y2921_BRADU      AGPMVVSMRPFKPADAIRAVQITSRYPAVHGAPVHLGHPHLIGIKDIAKPDYGDPVPVAD
Y1747_RHOPA      SGPMVVSMRPLKPKDAIRAIQITSRFPSVHGAPVHIGLPQSIGIADIAKPDYGDPVPIGP
Y1947_RHOPT      SGPMVVSMRPLKPKDAIRAIQVTSRFPSVHGAPVHIGLPQSIGIADIAKPDYGDPVPIGP
Y1846_RHOPS      AGPMVVSMRPLKPADAIRAVQITSRFPSVHGAPVHIGLPQSIGIADIANPDYGDPVPIAP
Y3621_RHOP2      AGPMVVSMRPMKPKDAIRAVQITSRFPSVHGAPVHIGLPQSIGIADIAKPDYGDPVPIAD
Y1692_RHOP5      AGPMVVSMRPMKPADAIRAVQITSRFPAVHGAPVHLGLPQSIGITDLAKPDYGDPVPIND
Y1666_RHOPB      AGPMVVSMRPLKPKDAIRAVQITSRFPSVHGAPVHLGLPQSIGIKDIAKPDYGDPVQIKD
Y2444_RHIL3      SGPMVVSMRPLAPADAIRAVQITSRMPAVHGAPIHIGLPASIGIENLDQPDYGDPTRIMP
Y188_GLUDA       AGPVVVSMRPFRSHHAIRAVQISSLIPLAHGAPIQIGFPEEIGIADIDSPDYGDPTEVAD
Y1377_ALIF1      SGNYVVSMRPFTSIDAIRAIQITTRFPKAHGAPVHFGDPSLIGINDISTPNYGDAVEIKP
Y1458_ALIFM      SGNYVVSMRPFTSIDAIRAIQITTRFPKAHGAPVHFGDPSLIGINDISTPNYGDAVEIKP
Y1435_ALISL      DGNFVVSMRPFTPKDAIRAIQITTRFPKSHGAPVHFGDPSVIGISDIAKPNYGEAVHINS
Y1731_SHEWM      QGNVVVSMRPFTPAQAIKAIQITSQFPLAHGAPIHIGKPEMIGINSLSNPSFGDSVEINE
Y7359_AFIC5      EAPLIVTMRSFTPQNAIRAIQITSRFPNVHGAPVHIGDPAQIGVDLAKRYQNVGDPTVGE
Y660_PELUB       SGKLVVSMRPLNSKDAIRSIQISSRFPAVHGAPIHLGDPSEIGIKDIMNPEYGDPPKAFK
Y3152_DINSH      RGKMVVSMRAIPEDRVAEAVEISRRFPLAHGAPVHWGDPAGLGITDLARPDWGDPVPVPE
Y1111_RUEPO      SGKMVVSMRAVPEDRVAEVAEISRAYPLAHGAPVYWGDPAGLGIADIMSPDWGDPAPLGP
Y2570_JANSC      NGHMVVTMRPIPEAMVDKAHGISARFPQAHGAPIATGDPRALGIADLAKPDYGDAVAVKP
Y610_DINSH       AGPLVVSMRPIPAAKVAKAHDISAQFPWARGAPIHSGDPKVLGIEDLDQPDWGDTSETRD
Y2409_RUBXD      AGPLVVSMRPYRPEEVPRAVSVSARYPAMHGAPVHVGRPEALGIKDLGRPDFGDAVILGE
YCSI_BACSU       HGQMVVSMRPVPERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRD
Y430_BACVZ       SGKMVVSMRPIPERLAVRAAQVTSRFPAVHGAPVRIGNPQSIGISDLHQPDFGDAVTVRE
Y2808_BACLD      QGPMVVSMRPVPEEQAVRAVQVTSRLPAVHGGPVHIGSPEAIGITDIAKPDFGDAVTIKK
Y2103_GEOKA      EGPMVVSMRPIPHKDVVRAVQVTSRFPSVHGAPIHIGDPKLIGIHDIYKPDFGDPVTIRE
Y381_BACP2       HGPMVVSMRPIPAHQITRSVQVTSRFPSVHGGPIHIGDPAMIGIANVDQPDFGETSVIKE
Y2764_PSEU5      SGPMVVSMRPMPANKVVRAVQVTSRFPSVHGAPVHVGDPRLLGIADLAKPDFGEPSELRE
Y1160_THEP3      HGYMVVSMRPIPQNLVVRAVQVTSRFPSVHGAPVHIGDPKAIGIASLDKPDFGDPVEIKA
Y1597_THEPX      HGYMVVSMRPIPQNLVVRAVQVTSRFPSVHGAPVHIGDPKAIGIASLDKPDFGDPVEIKA
Y1103_PSYA2      HGKMVVSMRPIPYPLITRAVQATSRFPQVHGAPIHIGDPSVIGITDIHSPDFGDASLIKE
Y2760_CLOB8      NGKMVVSMRPIPYDQIVKSVMVTGAMPKVHGTPIHIGEPSVIGISDISKPDFGDSVNIKE
Y1142_NATTJ      HGNMVVSMRPIPENKLTEAIQITSRFPAVHGAPIHIGSPEKIGIKDLDSPDFGNRVNVES
Y2975_ALKMQ      SGPLVVSMRPIPAHLVDKAVEITAPFRKAHGAPVHIGDPAELGIKDINKVDFGEPPNIKE
Y3393_SYNFM      SAPLVVTMRPIPNDLVMRAVRITSRYSLAHGAPIQVGDPGALGIRDLDRPDFGDPVTVKD
Y2211_STACT      EGNITVSMRPMTMKDAIRATEITTHFKNVHGTPIHIGNPADFGIKDLENPDFGEPVKIKD
Y308_STAS1       KGNITVSMRPMTMTQAIKATEITTRFKNVHGTPIHIGNPTEIGITDLALPDFGEPVTINE
Y274_STAHJ       KGNITVSMRPMTMTQAIKATEITSHFKNVHGTPIHIGTPEELGITDIDKPDYGEAVTIKP
Y3382_OCEIH      EGNMVVSMRALEPEEIDKAVKITERFETSHGSPVHIGNPEEIGIKDIDNPDYGESISFDK
Y8587_AGRRK      RGNMVVSMRPIPASRVADAATISGRFPAVHGAPVHVGAPEEIGIKDLAKPEFGDPVRIEP
Y5849_AGRVS      HGNMVVSMRPIPASRVADAATISGRFPAVHGAPVHVGAPEQIGIVDLAKPQFGDPVRIEP
Y3911_AGRFC      KGNMVVSMRPIPASRVADAATISGRFPAVHGAPVHVGAPEQIGISDLSKPDFGDAVRIEP
Y5759_CUPNH      HGEMVVSMRPIPAHRVADAVSISGRFPSVHGSPVHVGDPAALGIADLARPDFGDAVRIEP
Y2449_CUPPJ      HGELVVSMRPIAASRIADAAMISGRFPSVHGAPVHVGNPEALGIADIHRPDFGDAVRIES
Y3512_ACIAC      RGELVVSMRPVPADRVADAVSISGRFPSVHGAPVHVGDPAALGIADLARPDFGDPVEIHP
Y5379_PSESM      HGEMVVSMRPIPADRVAEASAISGRYPSVHGAPVHIGEPGRLGINDLSRPDFGDAVSIKP
Y321_PARDP       HGKMVVSMRPIPAGRVAEAAMISGRTPAVHGAPVHIGAPEALGIADLSRPDFGDPVQIRP
Y498_PSEU2       QGNMVVSMRPIAADRVAEAARITGRYPGVHGAPVHVGEPELLGINDLANPDFGDAVTIRP
Y1454_ACIB5      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGIKDVNKPDFGDASRIEA
Y2264_ACIB3      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGIKDVNKPDFGDASRIEA
Y2440_ACIBY      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGIKDVNKPDFGDASRIEA
Y2257_ACIBS      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGIKDVNKPDFGDASRIEA
Y1268_ACIBT      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGIKDVNKPDFGDASRIEA
Y1268_ACIBC      SGNMVVSMRPIPSHQISEAVKITARMPSVHGAPVHIGHPESLGISDVNKPDFGDASRIEA
Y2519_ACIAD      SGNMVVSMRPIPAAQVSQAVQITAKMPRVHGAPVHIGDPKSLGIADLSKPDFGDFPRILD
Y534_KINRD       RGDLVVSMRPVPADRVADAVAITGRFPAVHGAPVHVGDPAALGIASLDSPDFGDPPVVRD
Y6940_STRAW      HGPMVVSMRPVPPEHLAAAIRESTMLPAVHGSPVHCGDPSGLGIDDLGRPDFGDPVDAEP
Y1412_STRCO      RGPMVVSMRPVPPAHLSAAIHESSLLPAVHGSPVHCGDPSALGIDDLDRPDFGEAVYREP
Y3268_RHOOB      SGPMVVSMRPVPEHQVSLAAAISARMPAVHGGPVHIGDPTELGIADLGAPDFGDPVNLEP
Y3475_RHOJR      SGPMVVSMRPVPEHQVSLAAAISARMPAVHGGPVHIGDPTELGIADVAAPDFGDPVNFEP
Y093_NOCSJ       HGPMVVSMRAVPADQVAAAVQVTSRFPSMHGAPVHVGDPAALGIEDLAWPDYGDAPVLAD
Y3576_ARTS2      HGPMVVSMRPMLPGLVDTAIRVTSEVPKVHGSPVHVGSPEDLGIADINRPDFGDAVEIRP
Y2544_CORGL      SGNLVVSLRMIPASQVADAVRITSRYPAVHGAPVHIGDPSLIGIDDINNPDFGDAPLSEP
Y2449_CORGB      SGNLVVSLRMIPASQVADAVRITSRYPAVHGAPVHIGDPSLIGIDDINNPDFGDAPLSEP
Y077_BIFAA       HSTMVVSMRGIPSTQVADACRISGYYPSVHGAPVCVGDPSAIGIDDIMHPDYGDAPVLEP
Y403_CORJK       SGPMVVSMRPIPAAQVADAVRITSRYPAVHGAPVHVGDPAAIGIQDLNNPDFGEAVDIPA
Y1581_CORU7      HGPLVVSMRPIPASQIADAVRVTSRYPAVHGAPVHVGDPAAIGISDLASPDYGDAVEIPD
Y5194_MYCGI      GGPLVVSMRPLPPEQVADAVRITSRYPSVHGTPVHVGDPAGLGIAHLSAPDYGDAVTIRP
Y1553_SACEN      SGPLVVSMRPVPASMVATAVRITSRYPAVHGAPVHIGEPADLGIGDIDSPDFGEPVEIRP
                  .   :::*             :      :* *:  * *  :*:      .         

Y3350_METRJ      D-ELPVFWACGVTPQAVAMAARLPLCITHAPGHMLITDLL---NRDLPFL----------
Y4744_VEREI      D-ELPVFWACGVTPQAVVMAAKPALCITHSPGYMLITDML---NRDLPFA----------
Y2116_PSEAE      D-EIPLFWACGVTPQAVLAEVQPELYISHAPGHMLVSDRL---YDEL-------------
Y3212_PSEA8      D-EIPLFWACGVTPQAVLAEVQPELYISHAPGHMLVSDRL---YDEL-------------
Y3721_PSEAB      D-EIPLFWACGVTPQAVLAEAQPELYISHAPGHMLVSDRL---YDEL-------------
Y3193_PSEA7      D-EIPLFWACGVTPQAVLAEAQPELYISHAPGHMLVSDRL---YDEL-------------
Y6345_CUPTR      D-EIPVFWACGVTPQAVIREARPEICITHAPGCMLVTDLD---NNRL-------------
Y2997_BORBR      G-EIPVFWACGVTPQSVVAAVRPEFCITHAPGHMLVTDLL---NSRLAAF----------
Y3031_BORPA      G-EIPVFWACGVTPQSVVAAVRPEFCITHAPGHMLVTDLL---NSRLAAF----------
Y1875_BORPE      G-EIPVFWACGVTPQSVVAAVRPEFCITHAPGHMLVTDLL---NSRLAAF----------
Y2233_BORPD      G-EIPVFWACGVTPQSVVAAVRPKFCITHAPGHMLVTDLL---NSRMAVL----------
Y1776_POLSJ      D-EIPVFWACGVTPQAAIAQARPEFCITHAPGAMLITDLL---NHQLAAF----------
Y5282_BURCM      G-ELPVFWACGVTPQTALMEAKLPLAIAHTPGYMLMTDIT---NASLAVF----------
Y3459_BURA4      G-ELPVFWACGVTPQTALMEAKLPLAIAHTPGYMLMTDIT---NASLAVF----------
Y4029_BURVG      D-ELPVFWACGVTPQTALMEAKLPLAIAHTPGYMLITDMT---NASLAVF----------
Y3550_BURCH      G-ELPVFWACGVTPQTALMDAKLPIAIAHTPGHMLMTDIT---NASLAVF----------
Y3969_BURCC      G-ELPVFWACGVTPQTALMDAKLPIAIAHTPGYMLMTDIT---NASLAVF----------
Y4037_BURCJ      G-ELPVFWACGVTPQTALMDAKLPIAIAHTPGHMLMTDIT---NASLAVF----------
Y2576_BURL3      G-ELPVFWACGVTPQTALMDAKLPIAIAHTPGHMLMTDIT---NASLAVF----------
Y3391_BURM1      G-ELPVFWACGVTPQTALMEAKLPLAIAHTPGHMLMTDIT---NASLAVF----------
Y2364_PARP8      G-ELPVYWACGVTPQTALMAAKLPLAIAHAPGHMLMTDIT---NASLAIF----------
Y4813_PARPJ      D-ELPVFWACGVTPQAAIESARLPFAIAHKPGHMLVTDIP---NTTLAVL----------
Y4977_DELAS      G-EIPVFWACGVTPQQAIRSAALPFAITHEPGHMLVTELR---NSHLAAF----------
Y1097_METNO      D-EIPVFWACGVTPQSVIAASKPAFAITHAPGAMLITDRR---NTEFAVI----------
Y2125_METS4      D-EIPVFWACGVTPQSVIAASKPSFAITHAPGAMLVTDRR---NSEFAVL----------
Y1503_XANP2      N-ELPVFWACGVTPQSVIAEAKPSFAITHAPGCMLVTDRR---NTEFAIL----------
Y4080_AZOC5      G-EIPVFWACGVTPQSVISAAKIEYALAHGPGMMLCTDLK---NSALATG----------
Y2883_BRASB      D-EIPVFWACGVTPQAVISAAKLPFAITHAPGLMLITDLK---NKDLAVL----------
Y2538_BRASO      D-EIPVFWACGVTPQAVIAAAKLPFAITHAPGLMLITDLR---NKDLAVL----------
Y2921_BRADU      D-EIPVFWACGVTPQSVINAARLPFAITHSPGLMLVTDLK---NRTMAVI----------
Y1747_RHOPA      D-ELPVFWACGVTPQAVIAAAKVPFAITHAPGLMLVTDLK---NKHLAVL----------
Y1947_RHOPT      D-ELPVFWACGVTPQAVIAAAKVPFAITHAPGLMLVTDLK---NKHLAVL----------
Y1846_RHOPS      D-ELPVFWACGVTPQAVIAAAKVPFAITHAPGLMLVTDLK---NKHLAVL----------
Y3621_RHOP2      D-ELPVFWACGVTPQAVIAAAKVPFAITHAPGLMLVTDLK---NKHLAVL----------
Y1692_RHOP5      D-EIPVFWACGVTPQAVIAAARVPFAITHSPGLMLVTDLK---NKQLAVL----------
Y1666_RHOPB      D-EIPVFWACGVTPQAVIAAARVPFAITHSPGLMLVTDLK---NKQLAVL----------
Y2444_RHIL3      D-EMPVFWACGVTPQAVIQAARPKFAITHAPGCMLVTDKP---NAALIAF----------
Y188_GLUDA       D-ELPVFWACGVTPQAVLAASKPEFAITHAPGAMLVTDMPIEGYEDLVASHRGRII----
Y1377_ALIF1      N-EVPVFWGCGVTPQNVIRQSRPPFCITHAPGKMLITDRL---SSEFAVL----------
Y1458_ALIFM      N-EVPVFWGCGVTPQNVIRQSRPPFCITHAPGKMLITDRL---SSEFAVLDSRHLLLLPN
Y1435_ALISL      D-EIPVFWACGVTPQNVIRQSRPPFCITHAPGKMLITDRL---SSEFAVL----------
Y1731_SHEWM      D-HIPVFWGCGVTPQVVISNAKIPMFITHAPGKMLITDKL---YSELR------------
Y7359_AFIC5      G-EIPVFWACGLTPQFAVMKAKPPFCITHAPSSMLVTDLR---NSSLAVM----------
Y660_PELUB       NNEIPVFWACGVTPQSVLQDSKPDFCITHAPGKMLITDKL---NNDLAAL----------
Y3152_DINSH      G-HVPVFWACGVTPQVALEAASMPICITHKPGHMLISDIP--EDAEIPILRPQDQHTSQT
Y1111_RUEPO      G-EVPMFWACGVTPQVAIEAARLPLCITHKPGHMLITDVA--EDAEVPVV-----ETAQD
Y2570_JANSC      G-EVPVFWACGVTPQNVLRDARLPLCITHSPGHMLISDVA--EDAETPIY--------QS
Y610_DINSH       G-GVPVFWACGVTPQAALEEAELSLCITHRPGHMLVTDLP--EHDPFRAG------NLQ-
Y2409_RUBXD      G-EIPVFWACGVTPQAVALQAGLPLVITHSPGHMFVTDRR---DAEYEV-----------
YCSI_BACSU       GE-VPVFWACGVTPQAVAMNVKPEMVITHAPGHMLITDIR---DESLAVL----------
Y430_BACVZ       GE-VPVFWACGVTPQAVIMEAKPDIVITHSPGHMLITDIR---NESLAVL----------
Y2808_BACLD      GE-VPVFWACGVTPQAVAMHARPELMITHSPGHMLVTDVR---DEQFGVL----------
Y2103_GEOKA      GE-TPVFWACGVTPQAVAMEVKPDIMITHAPGHMFITDLR---DEQLGVL----------
Y381_BACP2       GE-VPVFWACGVTPQAVVMHTKPEIAITHAPGHMFITDQR---DQQLGVL----------
Y2764_PSEU5      GE-VPVFWACGVTPQAVAMQARPELVITHAPGHMFITDLR---DEQLGVI----------
Y1160_THEP3      GE-VPVFWACGVTPQAVAMKSKPEIMITHSPGHMFITDLK---DEMLAC-----------
Y1597_THEPX      GE-VPVFWACGVTPQAVAMKSKPEIMITHSPGHMFITDLK---DEMLAC-----------
Y1103_PSYA2      GE-VPVFWACGVTPQSIAMTSKPELMITHSPGYMFICDPK---DEDLAVL----------
Y2760_CLOB8      GE-VPVFWPCGVTPQSVVMNVKPKIVITHSPGHMLITDTK---NIDIKFS----------
Y1142_NATTJ      GE-IPVFWACGVTPQAVIMNYRPEFVITHAPGHMFITDKK---DMDYFQL----------
Y2975_ALKMQ      GE-IPVFWACGVTPQMALKNARPELVITHSPGYMFITSIT---DEEIARL----------
Y3393_SYNFM      GE-TPVFWACGVTSSLAVLSAEPELCITHAPGHMFITDVL---NETLAAL----------
Y2211_STACT      NE-VPVFWGCGVTPQSVALDAKPELIITHAPGHMFITDVK---DSELSD-----------
Y308_STAS1       NE-VPVFWGCGVTPQSVALDAKPDLMITHAPGHMFITDIP---DSQLSD-----------
Y274_STAHJ       NE-MPVFWGCGVTPQSVALDAKPELMITHSPGHMFITDIK---DSELND-----------
Y3382_OCEIH      KKRTPVFWACGVTPQNVGLNVKPPIMIAHAPGHMLITDQL---EEK--------------
Y8587_AGRRK      G-EIPVFWACGVTPQAAVMASGVPFAITHAPGHMFITNIP---DSAYHA-----------
Y5849_AGRVS      G-EVPVFWACGVTPQAAVMASGVPFAITHAPGHMFITDIL---DSAYHA-----------
Y3911_AGRFC      G-EVPVFWACGVTPQAAVMASGVPFAITHAPGHMFITDIP---DTAYHA-----------
Y5759_CUPNH      G-EIPVFWACGVTPQAAVMASGVPFAVTHAPGHMFITDVP---DSTYHV-----------
Y2449_CUPPJ      G-EIPVFWACGVTPQAAVMASGVPFAVTHAPGHMFVTDVP---DSTYHV-----------
Y3512_ACIAC      G-EVPVFWACGVTPQAAVMASGVPFAVTHAPGHMFITDVP---DSTYHV-----------
Y5379_PSESM      G-EVPVFWACGVTPQAAVMASGVPFAITHSPGYMFITDVP---DSTYHV-----------
Y321_PARDP       G-EVPVFWACGVTPQAALMASKPPFAITHAPGYMFITDVP---DTHWQV-----------
Y498_PSEU2       G-EIPVFWACGVTPQAVVMASRVPFAISHAPGHMFITDIP---DSYYHV-----------
Y1454_ACIB5      G-EIPVFWACGVTPQAAVMNSKIPFAISHAPGYMFITDIP---DRAWMG-----------
Y2264_ACIB3      G-EIPVFWACGVTPQAAVMNSKIPFAISHAPGYMFITDIP---DRAWMG-----------
Y2440_ACIBY      G-EIPVFWACGVTPQAAVMNSKIPFAISHAPGYMFITDIP---DRAWMG-----------
Y2257_ACIBS      G-EIPVFWACGVTPQAAVINSKIPFAISHAPGYMFITDIP---DRAWMG-----------
Y1268_ACIBT      G-EIPVFWACGVTPQAAVMNSKIPFAISHAPGYMFITDIP---DRAWIG-----------
Y1268_ACIBC      G-EIPVFWACGVTPQAAVMNSKIPFAISHAPGYMFITDIP---DRAWMG-----------
Y2519_ACIAD      G-EIPVFWACGVTPQAAVMRSKVPFAISHAPGYMLITDVP---DQAWML-----------
Y534_KINRD       G-EVPVFWACGVTPQAALFASRPPFAVTHAPGHMFVTDVL---DSEYDVTGVS-------
Y6940_STRAW      D-DIPVFWACGVTPQAAVMASRPPFAITHAPGQMFLTDAR---DEQYRVA----------
Y1412_STRCO      D-DIPVFWACGVTPQAAVMASRPPFALTHAPGQMFLTDAR---DEQYRVA----------
Y3268_RHOOB      G-DVPMFWACGVTPQAAVMASRLPFAITHAPGYMLITDTP---DSEYVLEVPDAR-----
Y3475_RHOJR      G-DVPVFWACGVTPQAAVMASRLPFAITHAPGYMLITDIP---DSEYVLEVPDAR-----
Y093_NOCSJ       G-DVPVFWACGVTPQAVIAAVGIPYAVSHAPGQMFISDVP---EATWALA----------
Y3576_ARTS2      G-EVPVFWACGVTPQSAVMASRPSFAISHAPGHMFITDVP---ESNYREPAGVSL-----
Y2544_CORGL      S-DVPVFWACGVTPQAMVMSSKPPLAITHAPGHMLITDAP---DLGFQVP----------
Y2449_CORGB      G-DVPVFWACGVTPQAMVMSSKPPLAITHAPGHMLITDAP---DLGFQVP----------
Y077_BIFAA       G-DVPVFWACGVTPQAAVMASKPEFAITHAPGHMFITSKR---DLEYMV-----------
Y403_CORJK       G-TIPVFWACGVTPQSVVMESKPEFAICHAPGHMLITDAR---DLQYQVP----------
Y1581_CORU7      G-HIPVFWACGVTPQAAVMETKPSLAIAHAPGHMLVTDAR---DLQYQVP----------
Y5194_MYCGI      G-EIPVFWACGVTPQAAVMQSRPPLAIGHAPGHMLITDLR---DSELVVP----------
Y1553_SACEN      G-EIPVFWACGVTPQAAVMQSRPPFAIGHAPGHMAITDAR---DSEFLVP----------
                     *::* **:*..           : * *. *   .                      

Y3350_METRJ      ----------------------
Y4744_VEREI      ----------------------
Y2116_PSEAE      ----------------------
Y3212_PSEA8      ----------------------
Y3721_PSEAB      ----------------------
Y3193_PSEA7      ----------------------
Y6345_CUPTR      ----------------------
Y2997_BORBR      ----------------------
Y3031_BORPA      ----------------------
Y1875_BORPE      ----------------------
Y2233_BORPD      ----------------------
Y1776_POLSJ      ----------------------
Y5282_BURCM      ----------------------
Y3459_BURA4      ----------------------
Y4029_BURVG      ----------------------
Y3550_BURCH      ----------------------
Y3969_BURCC      ----------------------
Y4037_BURCJ      ----------------------
Y2576_BURL3      ----------------------
Y3391_BURM1      ----------------------
Y2364_PARP8      ----------------------
Y4813_PARPJ      ----------------------
Y4977_DELAS      ----------------------
Y1097_METNO      ----------------------
Y2125_METS4      ----------------------
Y1503_XANP2      ----------------------
Y4080_AZOC5      ----------------------
Y2883_BRASB      ----------------------
Y2538_BRASO      ----------------------
Y2921_BRADU      ----------------------
Y1747_RHOPA      ----------------------
Y1947_RHOPT      ----------------------
Y1846_RHOPS      ----------------------
Y3621_RHOP2      ----------------------
Y1692_RHOP5      ----------------------
Y1666_RHOPB      ----------------------
Y2444_RHIL3      ----------------------
Y188_GLUDA       ----------------------
Y1377_ALIF1      ----------------------
Y1458_ALIFM      LIIRAGMRINCDMGESFGLCNR
Y1435_ALISL      ----------------------
Y1731_SHEWM      ----------------------
Y7359_AFIC5      ----------------------
Y660_PELUB       ----------------------
Y3152_DINSH      QQGETHDTHA------------
Y1111_RUEPO      KR--------------------
Y2570_JANSC      ----------------------
Y610_DINSH       ----------------------
Y2409_RUBXD      ----------------------
YCSI_BACSU       ----------------------
Y430_BACVZ       ----------------------
Y2808_BACLD      ----------------------
Y2103_GEOKA      ----------------------
Y381_BACP2       ----------------------
Y2764_PSEU5      ----------------------
Y1160_THEP3      ----------------------
Y1597_THEPX      ----------------------
Y1103_PSYA2      ----------------------
Y2760_CLOB8      ----------------------
Y1142_NATTJ      ----------------------
Y2975_ALKMQ      ----------------------
Y3393_SYNFM      ----------------------
Y2211_STACT      ----------------------
Y308_STAS1       ----------------------
Y274_STAHJ       ----------------------
Y3382_OCEIH      ----------------------
Y8587_AGRRK      ----------------------
Y5849_AGRVS      ----------------------
Y3911_AGRFC      ----------------------
Y5759_CUPNH      ----------------------
Y2449_CUPPJ      ----------------------
Y3512_ACIAC      ----------------------
Y5379_PSESM      ----------------------
Y321_PARDP       ----------------------
Y498_PSEU2       ----------------------
Y1454_ACIB5      ----------------------
Y2264_ACIB3      ----------------------
Y2440_ACIBY      ----------------------
Y2257_ACIBS      ----------------------
Y1268_ACIBT      ----------------------
Y1268_ACIBC      ----------------------
Y2519_ACIAD      ----------------------
Y534_KINRD       ----------------------
Y6940_STRAW      ----------------------
Y1412_STRCO      ----------------------
Y3268_RHOOB      ----------------------
Y3475_RHOJR      ----------------------
Y093_NOCSJ       ----------------------
Y3576_ARTS2      ----------------------
Y2544_CORGL      ----------------------
Y2449_CORGB      ----------------------
Y077_BIFAA       ----------------------
Y403_CORJK       ----------------------
Y1581_CORU7      ----------------------
Y5194_MYCGI      ----------------------
Y1553_SACEN      ----------------------