CLUSTAL format seed alignment for MF_01835

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KAIB_THEEB      MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKIL
KAIB_THEVL      MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKIL
KAIB_RIPO1      MVNFKKTYVLKLYVAGNTPNSVRALKTLKNILEDEFKGVYALKVIDVLKNPQLAEEDKIL
KAIB_SYNY3      MSPFKKTYVLKLYVAGNTPNSVRALKMLKNILEQEFQGVYALKVIDVLKNPQLAEEDKIL
KAIB_SYNP2      MNLLKKTYVLKLYVAGNTPNSVRALKTLKNILETDFKGVYALKVIDVLQNPQLAEEDKIL
KAIB_NOSS1      MNKARKTYVLKLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKIL
KAIB_ACAM1      MSSIRKTYVLKLYVAGNTPNSVRALRTLNHILETEFQGVYALKVIDVLKNPQLAEEDKIL
KAIB_SYNPX      MSP-RKTYILKLYVAGNTPNSMRALKTLRNILETEFRGVYALKVIDVLKNPQLAEEDKIL
KAIB_PROMM      MSP-RKTYILKLYVAGNTPNSMRALKTLRDILENEFRGVYALKVIDVLKNPQLAEADKIL
KAIB_PROMP      MVA-RKTYILKLYVAGNTPNSMRALNTLKEILENEFKGVYALKVIDVLKQPQLAEEDKIL
KAIB_PROMA      MSP-RKTYILKLYVAGNTPNSMRALTTLREILQTDFKGVYALKVIDVLKNPQLAEEDKIL
KAIB_SYNE7      MSP-RKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKIL
                *   :***:************:***  *..**: :*:*:*********::***** ****

KAIB_THEEB      ATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE------------
KAIB_THEVL      ATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE------------
KAIB_RIPO1      ATPTLSKILPPPVRKIIGDLSDREKVLIGLDLLYEEIRERESEL----------------
KAIB_SYNY3      ATPTLAKILPPPVRKIIGDLSDREKVLIGLDLLYDEIREREAEDQ---------------
KAIB_SYNP2      ATPTLSKVLPPPVRKIIGDLSDREKVLIGLDLLYEEFLEREEEL----------------
KAIB_NOSS1      ATPTLSKILPPPVRKIIGDLSDRERVLIGLDLLYEELTEEDWEAQSNL------------
KAIB_ACAM1      ATPTLAKVLPPPVRKIIGDLSDRERVLIGLDLLYEELSDGIMEY----------------
KAIB_SYNPX      ATPTLSKILPPPVRRIIGDLSDRERVLIGLDLLYDELADNAFSSG---------------
KAIB_PROMM      ATPTLAKILPPPVRRIIGDLSDRERVLIGLDLLYDEISEEMLGSAELDTLADDDIASPDS
KAIB_PROMP      ATPTLAKILPPPVRRIIGDLSDREKVLIGLDLLFDELSESEYSGGTKN------------
KAIB_PROMA      ATPTLAKILPPPVRRIIGDLSDRERVLIGLDLLFEELSESDFFSGSPDSEFSSDEGKS--
KAIB_SYNE7      ATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF-----------------
                *****:*:** ***:******:**:********: *: :