CLUSTAL format seed alignment for MF_01836

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KAIC_THEEB      --------------------MTNLPEHQSSPTEQSSAEVKKIPTMIEGFDDISHGGLPQG
KAIC_THEVL      --------------------MTNLPEHQSSPTEQSSAEVKKIPTMIEGFDDISHGGLPQG
KAIC_RIPO1      --------------------MNEPISNSSKKTENTTQGVRKIRTMIEGFDEITHGGLPIG
KAIC_SYNY3      --------------------MNLPIVNERNRPDVPRKGVQKIRTVIEGFDEITHGGLPIG
KAIC_SYNP2      --------------------MNQPTSSNNG----AIKGVQKIRTLIEGLDEISHGGLPSG
KAIC_NOSS1      --------------------MSEKEQQEQQ--NTSGNGVEKIRTMIEGFDDISHGGLPVG
KAIC_ACAM1      --------------------MKKSNLSQYKKNDKNKVEVTKILTRIEGFDDISHGGIPLG
KAIC_SYNLI      MNQSLGPSEPEKPQDNTAEDSTEPTPDNHRADLSELRGIPKKQTGIEGFEDISHGGLPLG
KAIC_SYNE7      --------------------MTSAEMTSPN-NNSEHQAIAKMRTMIEGFDDISHGGLPIG
KAIC_SYNPX      -------------------------MQFPPASGSTQMQVQKLPTGIEGFDDVCQGGLPIG
KAIC_PROMM      -------------------------MQSSSAGGSSHMQVQKLPTGIEGFDDICHGGLPSG
KAIC_PROMP      -------------------------MKDKKISKSIKMQVQKIPTGIEGFDDVCRGGLPAA
KAIC_PROMA      ------------------------------------MQVQKLPTGIEGFDDVCQGGLPTA
                                                      : *  * ***:::: :**:* .

KAIC_THEEB      RTTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLID
KAIC_THEVL      RTTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLID
KAIC_RIPO1      RTTLVSGTSGTGKTLLAVQFLYHGIKYFDYPGLFVTFEESPTDIIQNAYSFGWDLQEIVD
KAIC_SYNY3      RTTLVSGTSGTGKTLLAVQFLYQGIHHFDYPGLFITFEESPSDIIENAYSFGWDLQQLID
KAIC_SYNP2      RTTLVSGTSGTGKTLLAIQFLYHGIKHFDYPGLFVTFEESPRDIIQNAHSFGWDLQSLVD
KAIC_NOSS1      RTTLVSGTSGTGKTLLSLQFLFNGISFFDEPGVFVTFEESPSDIIKNAHIFGWNLQRLIN
KAIC_ACAM1      RTTLVSGTSGTGKTMFAIQFLYHGIVHFDDPAVFVTFEESPKDIIQNALSFGWDLQQLMD
KAIC_SYNLI      RTTLVSGTSGTGKTLFAMQFLYNGIVKYQEPGIFVTFEETPADIIRNASSFGWDLQALID
KAIC_SYNE7      RSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVD
KAIC_SYNPX      RSTLISGTSGTGKTVFSLHFLHNGIKHFDEPGIFVTFEESPLDILRNAASFGWNLQEMVE
KAIC_PROMM      RSTLISGTSGTGKTVFSLHFLHNGITQFDEPGIFVTFEESPSDILRNSASFGWNLQEMVE
KAIC_PROMP      RSTLVSGTSGTGKTVFSLQYLHHGICNFDEPGIFITFEESPLDIIRNAASFGWDLQKLID
KAIC_PROMA      RSTLVSGTSGTGKTVFSLQYLHHGICHFDEPGVFVTFEESPLDIIRNAGSFGWDLQELIN
                *:**:*********::::::*.:**  :: *.:*:****:* **:.*:  ***:*  :::

KAIC_THEEB      QGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASV
KAIC_THEVL      QGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASV
KAIC_RIPO1      EGKLFILDASPDPDGQEVVGSFDLSALIERIQYAINKYKAQLVSIDSVTAVFQQYDAASV
KAIC_SYNY3      DGKLFILDASPDPEGQEVVGTFDLSALIERIQYAVRKYKAKLVSIDSVTAVFQQYDAASV
KAIC_SYNP2      EGKLFILDASPDPDGQEVVGNFDLSALIERIQYAIRKYNAKLVSIDSVTAVFQQYDAAPV
KAIC_NOSS1      EGKLFILDASPDPEGQDIVGNFDLSALIERLQYAIRKYKAKRVSIDSITAVFQQYEAVGV
KAIC_ACAM1      DGKLFILDASPDPEGQDIAGEFDLSALIERIQYAISKYQAKRVGIDSVTAIFQQYDAATV
KAIC_SYNLI      RGQLFILDASPDPEGYEVSGNFDLSALIERIQYAIRKYKAKRVSIDSVTAIFQQYDPAGV
KAIC_SYNE7      EGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSV
KAIC_SYNPX      QDKLFILDASPDPDGQDVAGSFDLSGLIERINYAIRKYKAKRVAIDSITAVFQQYDAVFV
KAIC_PROMM      QDKLFILDASPDPDGQDVAGSFDLSGLIERINYAIVKYKAKRVAIDSMTAVFQQYDAISV
KAIC_PROMP      QNKLFILDASPDPDGQDVAGNFDLSGLIERISYAIRKYKAKRVAIDSITAVFQQYDAIYV
KAIC_PROMA      QDKLFVLDASPDPDGQDVAGNFDLSGLIERISYAIKKYKAKRVAIDSMTAVFQQYDAVYV
                 .:**:*******:* :: * ****.****:.**: **.*  *.***:*::****:.  *

KAIC_THEEB      VRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRT
KAIC_THEVL      VRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRT
KAIC_RIPO1      VRREIFRLVARLKLLGVTSIMTTERIEEYGPIARYGVEEFVSDNVVVLRNVLEGERRRRT
KAIC_SYNY3      VRREIFRLVARLKQLQVTSIMTTERVEEYGPIARFGVEEFVSDNVVVLRNVLEGERRRRT
KAIC_SYNP2      VRREIFRLVARLKHLAVTSIMTTERLDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRT
KAIC_NOSS1      VRREIFRLVARLKQLNVTTIITTERSEEYGPVASFGVEEFVSDNVVIARNVLEGERRRRT
KAIC_ACAM1      VRREIFRLTARLKQIGVTTVMTTERVDEYGPVARYGVEEFVSDNVVIVRNVLEGERRRRT
KAIC_SYNLI      VRRELFRLTARLKQANVTTVMTTERTDEYGPIARYGVEEFVSDNVVILRNILEGEKRRRT
KAIC_SYNE7      VRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRT
KAIC_SYNPX      VRREIFRLIARLKEIGVTTVMTTERIDEYGPIARYGVEEFVSDNVVILRNVLEGERRRRT
KAIC_PROMM      VRREIFRLIARLKVIGVTTVMTTERIDEYGPIARYGVEEFVSDNVVILRNVLETEKRRRT
KAIC_PROMP      VRREIFRLIARLKEIGVTTVMTTERVDDYGPIARYGVEEFVSDNVVLLRNVLEAEKRRRT
KAIC_PROMA      VRREIFRLIARLKEIGVTTVMTSERIDEYGPIARYGVEEFVSDNVVILRNVLESEKRRRT
                ****:***  ***   .*:::*:** ::***:* :***********: **:** *:****

KAIC_THEEB      VEILKLRGTTHMKGEYPFTI-NNGINIFPLGAMRLTQRSSNVRVSSGVKTLDEMCGGGFF
KAIC_THEVL      VEILKLRGTTHMKGEYPFTI-NNGINIFPLGAMRLTQRSSNVRVSSGVKTLDEMCGGGFF
KAIC_RIPO1      AEILKLRGTTHMKGEYPFTITNDGINIFPLGAMRLTQRSSNARISSGVKTLDEMCGGGFF
KAIC_SYNY3      VEILKLRGTTHMKGEYPFTITHDGINIFPLGAMRLTQRSSNARISSGVQTLDEMCGGGFF
KAIC_SYNP2      IEILKLRGTTHMKGEYPFTITNDGINIFPLGAMRLTQRSSNARISSGVETLDKMCGGGFF
KAIC_NOSS1      IEILKLRGTTHMKGEYPFTITNDGVNIFPLGAMRLTQRSSNVRVSSGVKTLDGMCGGGFF
KAIC_ACAM1      LEILKLRGTSHMKGEYPFTITDDGINIFPLGAMRLTQRSSNARVSSGVQTLDEMCGGGFF
KAIC_SYNLI      IEILKLRGTTHMKGEYPFTITNDGINIFPLGAMQLTQRSSNVRVSSGIEKLDEMCGGGFF
KAIC_SYNE7      LEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFF
KAIC_SYNPX      VEILKLRGTTHMKGEFPFTMGTHGISIFPLGAMRLTQRSSNVRVSSGVPRLDEMCGGGFF
KAIC_PROMM      VEILKLRGTTHMKGEFPFTMGTHGVSVFPLGAMRLTQRSSNVRISSGVPNLDEMCGGGFF
KAIC_PROMP      LEVLKLRGTVHMKGEFPFTMGDDGIIVFALGAMRLTQRSSNIRISSGVKDLDEMCGGGYF
KAIC_PROMA      VEVLKLRGTTHMKGEFPFTMGAEGITVFALGAMRLTQRSSNIRISSGVPDLDDMCGGGYF
                 *:****** *****:***:  .*: :*.****:******* *:***:  ** *****:*

KAIC_THEEB      KDSIILATGATGTGKTLLVSKFLETGCQQGERALLFAYEESRAQLSRNASSWGIDFEELE
KAIC_THEVL      KDSIILATGATGTGKTLLVSKFLETGCQQGERALLFAYEESRAQLSRNASSWGIDFEELE
KAIC_RIPO1      KDSIILATGATGTGKTLLVSKFLEEGCRQGERAILFAYEESRAQLSRNAFSWGIDFEEME
KAIC_SYNY3      KDSIILATGATGTGKTLLVSKFLQEGCRQRERAILFAYEESRAQLSRNASSWGIDFEEME
KAIC_SYNP2      KDSIILATGATGTGKTLLVSKFLEEGCRRGERAILFAYEESRAQLSRNASSWGIDFEEME
KAIC_NOSS1      KDSIILATGATGTGKTLLVSKFLQNGCVNNERAILFAYEESRAQLSRNAYSWGIDFEELE
KAIC_ACAM1      KDSIILVTGATGTGKTLLVSKFLEDACKNGDRAILFAYEESRAQLSRNAYSWGIDFEEME
KAIC_SYNLI      KDSIILATGATGTGKTSLVSKFLERGCLDGERCILFAYEESRAQLSRNASSWGIDLEEFE
KAIC_SYNE7      KDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEME
KAIC_SYNPX      KDSIILATGATGTGKTLLVSKFIEDACRNKERAILFAYEESRAQLLRNGTSWGIDFEQME
KAIC_PROMM      KDSIILVTGATGTGKTLLVSKFIEDAFRNQERAILFAYEESRAQLLRNATSWGIDFEEME
KAIC_PROMP      QDSIILATGATGTGKTMLVSKFIEDAYNNKERAILFAYEESRAQLNRNATSWGIDFEKME
KAIC_PROMA      QDSIILATGATGTGKTMLVSKFIEDAYRNQERAIIFAYEESRAQLLRNATSWGIDFEQME
                 *****.********* ***:*:: .    :*.::********** **. ***:*:*::*

KAIC_THEEB      RRGLLRIICAYPESAGLEDHLQIIKSEIADFKPSRVAIDSLSALARGVSNNAFRQFVIGV
KAIC_THEVL      RRGLLRIICAYPESAGLEDHLQIIKSEIADFKPSRVAIDSLSALARGVSNNAFRQFVIGV
KAIC_RIPO1      RKGLLKLLCSYPESAGLEDHLQIIKSEISEFKPSRIAIDSLSALARGVTNNAFRQFVIGV
KAIC_SYNY3      HKGLLKLLCTYPESAGLEDHLQMIKSEISEFKPSRIAIDSLSALARGVTNNAFRQFVIGV
KAIC_SYNP2      RKGLLKLLCSYPESAGLEDHLQMIKSEISEFKPSRIAIDSLSALARGVTNNAFRQFVIGV
KAIC_NOSS1      SQGLLKIICTYPESTGLEDHLQIIKSEIAYFKPARIAIDSLSALARGVSNNAFRQFVIGV
KAIC_ACAM1      QKGLLKILCTYPESAGLEDHLQQIKSEIAEFKPSRISIDSLSALARGVSNNAFRQFVIGV
KAIC_SYNLI      RQGLLKIICAYPESAGLEDHLQKIKTEMMAFKPSRMAIDSLSALARGVSQNAFRQFVIGV
KAIC_SYNE7      RQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGV
KAIC_SYNPX      QDGLLKIICAYPESTGLEDHLQIIKTDIGQFKPSRMAIDSLSALARGVSHNAFRQFVIGV
KAIC_PROMM      RQGLLKIICAYPESTGLEDHLEIIKTAIGQFKPSRMAIDSLSALARGVSLNAFRQFVIGV
KAIC_PROMP      NEGLLKIICAYPESTGLEDHLQIIKSQINEFKPKRLAIDSLSALARGVSLNAFRQFVIGV
KAIC_PROMA      ADGLLKIICAYPESTGLEDHLQIIKTEITEFKPSRMAIDSLSALARGVSLNAFRQFVIGV
                  .**:::*:****:******: **: :  *** *::***********: **********

KAIC_THEEB      TGFAKQEEITGFFTNTTDQFMGSNSITESHISTITDTILLLQYVEIRGEMSRAINVFKMR
KAIC_THEVL      TGFAKQEEITGFFTNTTDQFMGSNSITESHISTITDTILLLQYVEIRGEMSRAINVFKMR
KAIC_RIPO1      TGYAKQEEITGFFTNTTDQFMGAHSITESHISTITDTIIMLQYVEIRGEMSRAINVFKMR
KAIC_SYNY3      TGYAKQEEITGFFTNTTDQFMGAHSITESHISTITDTILMLQYVEIRGEMSRALNVFKMR
KAIC_SYNP2      TGYAKQEEITGFFTNTTDQFMGAHSITESHISTITDTILMLQYVEIRGEMSRAINVFKMR
KAIC_NOSS1      TGYAKQEEITGFFTNTTDQFMGSHSITDSHISTITDTILMLQYVEIRGEMSRAINVFKMR
KAIC_ACAM1      TGFAKQEEITGFFTNTTDHFLGSHSITESHISTITDTILMLQYVEILGEMSRAINVFKMR
KAIC_SYNLI      TGLAKQEEITGFFTNTTDQFMGSHSITESHISTITDTIILLQYVEIRGEMARALNVFKMR
KAIC_SYNE7      TGYAKQEEITGLFTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMR
KAIC_SYNPX      TGYAKQEEIAGFFTNTSEEFMGSHSITDSHISTITDTILMLQYVEIRGEMARALNVFKMR
KAIC_PROMM      TGYAKQEEIAGFFTNTAEEFMGSHSITDSHISTITDTILLLQYVEIRGEMARAVNVFKMR
KAIC_PROMP      TGYSKQEEIAGFFTNTAEEFMGSHSITDSHISTITDTILLLQYVEIKGEMARAINVFKMR
KAIC_PROMA      TGYAKQEEIAGFFTNTAEEFMGSHSITDSHISTITDTILLLQYVEIRGEMARAINVFKMR
                ** :*****:*:****::.*:*::***:**********::****** ***:**:******

KAIC_THEEB      GSWHDKGIREYVITEKGAEIRDSFRNFEGIISGTPTRISVDEKTELARIAKGMQDLESE-
KAIC_THEVL      GSWHDKGIREYVITEKGAEIRDSFRNFEGIISGTPTRISVDEKTELARIAKGMQDLESE-
KAIC_RIPO1      GSWHDKGIREYSINESGPTIQDSFRNYERIISGSPTRITVDEKNELSRIVRGVKDKTLDE
KAIC_SYNY3      GSWHDKGIREYSISHDGPDIRDSFRNYERIISGSPTRISVDEKSELSRIVRGVKDKTAE-
KAIC_SYNP2      GSWHDKGIREYTISEGGAAIKDSFRNYERIISGSPTRIAVDEKSELSRIMRGVQDKTLPE
KAIC_NOSS1      GSWHDKGIREYNITADGPEIQDSFRNYERIVSGSPTRVSIDEKAELSRIVRRFEDKQGSD
KAIC_ACAM1      GSWHDKGIREYSISQHGPEIKNAFHNFEGIISGTPTRVSLDEKRDLSRIVQDVKGLSDDD
KAIC_SYNLI      GSWHDKGIREYLISNAGIQIRDSFRGYERIISGSPTRINVDEKNELSRIVQNVQALEEEG
KAIC_SYNE7      GSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES
KAIC_SYNPX      GSWHDKGIREFVITGNGPQIKDSFSNFERIISGVPHRVTTDERSELSRIARGVSSED---
KAIC_PROMM      GSWHDKRIREYVITDNGPQIKDSFSNFERIFSGAPHRITDDERA----------------
KAIC_PROMP      GSWHDKRIREYIITGQGPEIKDSFSNFEQIFSGAPHRVISDQS--IPNVFKGIEKN----
KAIC_PROMA      GSWHDKRIREFIITNEGPEIKDSFTNFEQIFSGAPHRISGEDS--ISGVFKSLDKREKK-
                ****** ***: *.  *  *:::* .:* *.** * *:  ::                  

KAIC_THEEB      --
KAIC_THEVL      --
KAIC_RIPO1      E-
KAIC_SYNY3      --
KAIC_SYNP2      --
KAIC_NOSS1      S-
KAIC_ACAM1      LL
KAIC_SYNLI      L-
KAIC_SYNE7      --
KAIC_SYNPX      --
KAIC_PROMM      --
KAIC_PROMP      --
KAIC_PROMA      --