CLUSTAL format seed alignment for MF_01837

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SASA_SYNE7      -------MGESLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINV
SASA_NOSS1      MLKHDSMQVSQDQPIYSEAPLQLLLFVDGRPKSKQQVQRIRAYLKDLQAEYNFELQIIDV
SASA_SYNY3      ------MSSSSELGNASSVPLQFLLFIDDRPNSQDSVQEIGQCLTNLLDGHSHDLQILQI
SASA_THEEB      ----MKASADASSPQETTPPLSLLLFVANRPGDEEETAAIQAHIQQLPSNFSFELKVVPI
SASA_PROMP      --------------MNEKKELKLILVAARNHLSRGDLKLLLSYLESDDCEFEISLQISEP
SASA_PROMA      ---------MNKATANERKKLRLLLVASRKHLSRGDLRSLIRFLESEDCGFEIKLQFSDP
SASA_SYNPX      ---------MGEDDPKGRQRLKLLLVAARHHLSGPDLRSVVHYLERDDVGFQVTLQLADP
SASA_PROMM      ---------MDGVKANQRQQLQLLLVAARHQLSRSDLRSMIQFLENEDCGFNVTLQMADP
                                    * : *.   .  .      :   :          *:.   

SASA_SYNE7      ADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEAFFAD-----
SASA_NOSS1      GQQPYLAEHFKLVATPALIKIHPEPRQILAGSNIITQLKNLWPRWQAAADTYAK-LQEDL
SASA_SYNY3      SKHPHLVEHFRLVATPSLIKLQPEPRQVLAGSNIIQQLQKWWPRWQQELA---------M
SASA_THEEB      GEQPYLLEEYKLVATPALIKVRPEPRQTLAGRKLLQKVDYWWPRWQRE---VALGLQADM
SASA_PROMP      TEQPELLELHRLVAIPALIKVSPAPKQIFAGSNIFVQLQTWLPRWKQEGV--TKDLGINL
SASA_PROMA      KEQPELLELHRLVAIPALIKLDPQPKQIFAGTSILEQLKNWLPRWEQEDILISSGLGINL
SASA_SYNPX      SQQPELLELHRLVITPALIKLSPAPKQVFAGSNILQQLKGWVPRWQQDGV--VSGLGLSL
SASA_PROMM      SEQPELLELHRLVATPALIKLSPTPKQVFAGSSIFQQLQNWITRWQQDIV--VTGLGLSL
                 .:* * * .:**  *:*:*: * .:* ::* .:  ::    .:*               

SASA_SYNE7      ----REPPEVNIPFTEL--GQPETPALQQADAFFQLQQQYADLSERTKFLEQVIALVAHD
SASA_NOSS1      QERVDDNGRVAQPQSTINSVAVSAELLRLSDEIFNLKQEKEKLLEQLQFKDRVIAMLVHD
SASA_SYNY3      DPNPEDTGQSPSCPREISSVGYSGELMKMSDELFLLKKDKEELLQQIQFKDQILAMLAHD
SASA_THEEB      Q------------KSAAEQSDCSMELSRLKDELFQLRQERDRLAEQLQFKDRIISLLAHE
SASA_PROMP      Q------------PSKIDSIRTQKEF-LLEEELLVLRQENETLTKRIESQERLLRMVAHE
SASA_PROMA      R------------QKESENGRTRNEL-LLEDENLVLRQENETLSNQIESQERLLRMVAHE
SASA_SYNPX      R------------PTELDGSRTQKEL-QLEDQLLVLRQENETLIDRIHAQERLLRMVAHE
SASA_PROMM      R------------PTELDGSRTQREL-QLEDQLLVLRQENETLIDRLNAQERTLRMVAHE
                                              :  : *:::   * .: .  :: : ::.*:

SASA_SYNE7      LRNPLTAALLAVDTIQIRSQSFSVATAK-EMQGLCSLFDQARSQLREIERMIAEILEATR
SASA_NOSS1      LRNPLTAAAIAIETLQSNYNPDIGQFQRLKPALVVNLLRQARTQAKTIDKMIADLLQVGR
SASA_SYNY3      LRSPLTAASIAVDTLELLQHKPI---EEQKPALRSQLLYQARKQFKIMDRLIEDILQASK
SASA_THEEB      LRNPLTAGGIALETLESNLQEES--SQQLPIEDIQRLFHHARSQTQTMGQLITDLLLAAR
SASA_PROMP      LRTPLTAATLAIQ------------SQKLGQIDIKKLQDVIKRRLEEIELLSQDLLEVGT
SASA_PROMA      LRTPLSAAKLALQ------------SQALGQIDLIKLQEVVKRRLEEIESLSKDLLEVGT
SASA_SYNPX      LRTPLTAAALALQ------------SQRLGQIDMTRFQDVITRRLEEMEALSKDLLEVGT
SASA_PROMM      LRTPLTAAVLALQ------------SQQLGQINIEHFQDVVKRRLDEIELLSKDLLEVKS
                **.**:*. :*::                       :      :   :  :  ::* .  

SASA_SYNE7      HSGESLRINPREVVFEPLLQQVLEQLHERWRSKQQQLITDVPGDLPTLYADPDRLRQVLV
SASA_NOSS1      GTDTELIIIPQKTEIGLLCLEVLGELRDRYTTKAQKVETDIPQDLPCVYADPERIRQVLI
SASA_SYNY3      NLNSQFQVHGRPLAIADLCQEVLELYQAKFSKKNLTITYDIPKDLPNVFADEELIRQVIA
SASA_THEEB      GPQDKLQIMARQLDLRQLCQETVEDVRLNFERKKQHFTTDIPLDLPLVYGDGDRIRQVLV
SASA_PROMP      -TKWEALFNPQKIDLGNISAEAILELEKFWRLRKIEIDTDIPSDLPSVYADQRRMRQVFL
SASA_PROMA      -TRWEALFNPQEANLANIAAEVILELEKFWLSRGIGINTDIPADLPNVFADQSRMKQVLL
SASA_SYNPX      -TRWETLFNPQRLDLASVSAEVILELEKLWLGRNVEIRTDIPSDLPKVFADQRRMRQVLL
SASA_PROMM      -TKWEDLFNPQNLDLGNIAAEAILELEKLWLDRNIEIRTDIPSDLPKVFADQRRMRQVLL
                    .  .  :   :  :  :.:   .  :  :   .  *:* *** ::.*   ::**: 

SASA_SYNE7      NLLDNAIKYTPPGGTITIAALHRTSQKVQISISDTGSGIPRDQLSVIFKNLVRLSR-DSS
SASA_NOSS1      NLLDNAIKYTPEGGTISIAGLHRTTQKVQFSIGDTGPGIPSDNRERIFENHYRLER-DEA
SASA_SYNY3      NLLDNAIKYTPAHGSITVGALHRTTQKVQVSITDNGPGIPNSKQETIFEGHFRLQR-DEQ
SASA_THEEB      NLLDNACKYTPEGGKIHLSAFHRMTQKVQVTVSDTGPGIPIEQQEKIFGETVRLDR-DRA
SASA_PROMP      NLIENALKFSENSGRIKITLIHKTNQWVEITICDKGAGIPVSEQKRIFLDRVRLPQTSEG
SASA_PROMA      NLIENALKFSNDGDTVEITMLHRTNQWVQISVSDKGPGIPEEEQQRIFLDRVRLPQTSNE
SASA_SYNPX      NLLENALKYTGNGGHITLTMLHRTSQRVEVSVCDSGPGIPTEEQQRIFLDRVRLPQTSDR
SASA_PROMM      NLLENALKFTEDGGEVSLTMLHRTSHWVQVSICDNGPGIPEDEQERIFLDRVRLPQTSVS
                **::** *::   . : :  :*: .: *:.:: *.*.*** .: . **    ** : .  

SASA_SYNE7      QEGYGIGLSVCQRIVQAHFGRIWVASELGQGSTFHFTMPVYRYTMPC-------------
SASA_NOSS1      KEGYGIGLSLCQRIIRAHYGQIWVDSNPHGGAWFHFTLPVYPS-----------------
SASA_SYNY3      TDGYGLGLSLCRKIIQAHYGQIWVDSRPKQGSSFHFTLPVYR------------------
SASA_THEEB      IEGYGIGLALCRQIIRMHYGQIWVDSQPGKGSCFHFTLPVYS------------------
SASA_PROMP      TSGFGIGLSVCRRIVEVHGGRIWVVSEVGEGSCFHFTVPVWQGQNKDQQHLTKG------
SASA_PROMA      TSGFGIGLSVCRRIVEVHGGKIWVVSQPGEGSCFYFTVPVWDKRNKSLEPLTLTQG----
SASA_SYNPX      TTGFGVGLSVCRRIVEVHGGRIWVVSEPGEGACFTFTVPIWQGQGQEWGQAVLTEGELEP
SASA_PROMM      TSGFGVGLSVCRRIVEVHGGKIWVVSEPDKGACFYLTVPVWQRNGQE-------------
                  *:*:**::*::*:. * *:*** *.   *: * :*:*::