CLUSTAL format seed alignment for MF_01839

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SLMA_ECOLI      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SHIB3      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO55      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOLC      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOBW      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECODH      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOSE      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO24      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO57      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO5E      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOLU      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO8A      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SHIFL      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SHIF8      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOHS      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOSM      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO45      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO7I      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOK1      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOL6      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECOL5      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO81      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ESCF3      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ECO27      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALA4      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALCH      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALPB      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALPC      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALSV      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALTY      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALEP      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALG2      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALHS      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALNS      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALDC      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALPA      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALPK      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALTI      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_SALAR      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_CITK8      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_KLEP3      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_KLEP7      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_ENT38      -----------------MAEKQTAKR---NRREEILQSLALMLESSDGSQRITTAKLAAS
SLMA_CROS8      -----------------MAEKQTAKR---NRREEILQSLAQMLESSDGSQRITTAKLAAS
SLMA_ERWT9      -----------------MVEKKSAKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_PECAS      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_PECCP      -----------------MAEKESTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPE      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPP      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPY      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPG      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPA      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPN      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPS      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERPB      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERP3      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_YERE8      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_SERP5      -----------------MAEKEKIKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_EDWI9      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_SODGM      -----------------MAEKENTKR---NRREEILQALAQMLESSDGSQRITTAKLAAN
SLMA_PHOLL      -----------------MAENENTKK--RNRREEILQALAHMLQSSDGSHRITTAKLAAN
SLMA_PROMH      -----------------MAEEKETKKKRRNRRDEILQSLAQMLESSDGSQRITTAKLAAT
SLMA_VIBCB      -----------------MAGSK--KT---NRREEILQALAQMLESTEGASRITTAKLAKQ
SLMA_VIBPA      -----------------MAGSK--KS---NRREEILQALAQMLESAEGASRITTAKLAKQ
SLMA_VIBVU      -----------------MAGSK--KS---NRREEILQALAHMLESAEGASRITTAKLAQQ
SLMA_VIBVY      -----------------MAGSK--KS---NRREEILQALAHMLESAEGASRITTAKLAQQ
SLMA_VIBA3      -----------------MAGTR--KS---NRREEILQALAQMLESTEGASRITTVKLAKQ
SLMA_VIBCH      -----------------MAGNK--KI---NRREEILQALAEMLESNEGASRITTAKLAKQ
SLMA_ALIF1      -----------------MATPR--KP---NRRDEILQALAEMLESNEGAARITTAKLAKQ
SLMA_ALIFM      -----------------MATPR--KP---NRRDEILQALAEMLESNEGAARITTAKLAKQ
SLMA_PHOPR      -----------------MAGNK--KT---NRREEILQALAQMLESTQGSQRITTAKLAAQ
SLMA_SHEB5      -----------------MAVSP-----KINRREHILQCLAQMLETNPG-QRITTAKLASE
SLMA_SHEB8      -----------------MAVSP-----KINRREHILQCLAQMLETNPG-QRITTAKLASE
SLMA_SHEB9      -----------------MAVSP-----KINRREHILQCLAQMLETNPG-QRITTAKLASE
SLMA_SHEB2      -----------------MAVSP-----KINRREHILQCLAQMLETNPG-QRITTAKLASE
SLMA_SHESM      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHESR      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHESA      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHEON      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHEPC      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHESW      -----------------MAVSP-----KINRREHILQCLAQMLETSPG-QRITTAKLASE
SLMA_SHEHH      -----------------MAASP-----KINRREHILQCLATMLETSPG-QRITTAKLAAE
SLMA_SHEPA      -----------------MAASP-----KINRREHILQCLATMLETSPG-QRITTAKLAAE
SLMA_SHEPW      -----------------MAASP-----KINRREHILQCLATMLETSPG-QRITTAKLAAE
SLMA_SHELP      -----------------MAASP-----KINRREHILQCLATMLETSPG-QRITTAKLAAE
SLMA_SHESH      -----------------MAVSP-----KINRREHILQCLATMLETNPG-QRITTAKLAAE
SLMA_SHEWM      -----------------MAASP-----KINRREHILQCLATMLETNPG-QRITTAKLAAE
SLMA_SHEDO      -----------------MATSP-----KINRREHILQCLAQMLETSPG-QRITTAKLAAE
SLMA_SHEFN      -----------------MAESP-----KINRREHILQCLAQMLETSPG-QRITTAKLAAE
SLMA_SHEAM      -----------------MAAKE-----KISRREHILQCLAQMLETNPG-QRITTAKLAAE
SLMA_IDILO      -----------------MAEQ------KRNRREEILQALAAMLETSPG-QRITTAKLAAN
SLMA_ALTMD      -----------------MPAVK-----KTNRRAQILQALAGMLETSPG-QRITTAKLAEK
SLMA_COLP3      -----------------MVATQNKNL-KPNRKHQILESLALMLQNCPG-QRITTAKLAAE
SLMA_MARHV      -----------------MTNQK------PSRRESILQALVELLQSDPG-ARITTAGLAKT
SLMA_MARMS      -----------------MSNKK------NDRRTQILQALAQMLESSPG-ARITTAALAKQ
SLMA_ACTPJ      ---------------MIQPTVKMPKKSVKERQQQVLEVLIGLLNSEDGMQRVTTERLAKA
SLMA_ACTP2      ---------------MIQPTVKMPKKSVKERQQQVLEVLIGLLNSEDGMQRVTTERLAKA
SLMA_ACTP7      ---------------MIQPTVKMPKKSVKERQQQVLEVLIGLLNSEDGMQRVTTERLAKA
SLMA_HAEDU      ---------------MTEPLIKMPKKSVKERQQQVLEVLIGLLNSEQGMQRVTTERLAKA
SLMA_HAEPS      ---------------MTEPVIKMPKKSVKERQQQVLEVLIGLLNSEEGMQRVTTERLSKA
SLMA_HAEIN      MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
SLMA_HAEI8      MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
SLMA_HAEIE      MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
SLMA_HAEIG      MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
SLMA_PASMU      -------------------MQKPVKRSLKERRQQVLTVLTHMLHSERGMERMTTARIAAE
SLMA_MANSM      -MAEQLTLDSIEP-EPEKQSAKIEKRSIKERRQQVLTVLTHLLHSEKGMERMTTARLAKE
                                             .*:  :*  *  :*..  *  *:**  ::  

SLMA_ECOLI      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_SHIB3      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO55      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOLC      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOBW      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECODH      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOSE      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO24      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO57      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO5E      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOLU      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO8A      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_SHIFL      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_SHIF8      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOHS      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOSM      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO45      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO7I      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOK1      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOL6      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECOL5      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO81      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ESCF3      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_ECO27      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGE
SLMA_SALA4      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALCH      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALPB      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALPC      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALSV      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALTY      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALEP      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALG2      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALHS      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALNS      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIVLLILGFGE
SLMA_SALDC      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKNTSTRLRLIMLLILGFGE
SLMA_SALPA      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTSTRLRLIVLLILGFGE
SLMA_SALPK      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTSTRLRLIVLLILGFGE
SLMA_SALTI      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTSTRLRLIVLLILGFGE
SLMA_SALAR      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTSARLRLIVLLILGFGE
SLMA_CITK8      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTSARLRLIVLLILGFGE
SLMA_KLEP3      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLILGFGE
SLMA_KLEP7      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLILGFGE
SLMA_ENT38      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLILGFGE
SLMA_CROS8      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKETLNRLRLIVLLILGFGE
SLMA_ERWT9      VGVSEAALYRHFPSKTKMFDSLIEFIEDSLITRINLILKDEKETMPRLRLITQLILGFGE
SLMA_PECAS      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLTTRINLILQDEKETFNRLRLILLLILGFAE
SLMA_PECCP      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLTTRINLILQDEKETFNRLRLILLLILGFAE
SLMA_YERPE      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPP      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPY      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPG      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPA      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPN      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPS      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERPB      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERP3      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_YERE8      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_SERP5      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILQDEKETFNRLRLILLLVLGFAE
SLMA_EDWI9      VGVSEAALYRHFPSKTRMFDSLIEFIEDTLTSRINLILQDEKDTFHRLRLILLLILGFAE
SLMA_SODGM      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLISRINLILQDEKETLNRLRLILLLLLGFAE
SLMA_PHOLL      VGVSEAALYRHFPSKTRMFDSLIEFIEDSLISRINLILQDEKDTITRIRLILVLILGFSE
SLMA_PROMH      VGVSEAALYRHFPSKTKMFDSLIEFIEDSLVSRINLILKDEKETIARIRLILILILGFAE
SLMA_VIBCB      VGVSEAALYRHFPSKARMFEGLIEFIEEALMTRINRILDDEKDTLERIRMVMHLILAFSE
SLMA_VIBPA      VGVSEAALYRHFPSKARMFEGLIEFIEEALMTRINRILDDEKDTLERIRMVMHLILAFSE
SLMA_VIBVU      VGVSEAALYRHFPSKARMFEGLIEFIEEALMSRINRILDEEKDTLERIRLVLQLLLAFAE
SLMA_VIBVY      VGVSEAALYRHFPSKARMFEGLIEFIEEALMSRINRILDEEKDTLERIRLVLQLLLAFAE
SLMA_VIBA3      VGVSEAALYRHFPSKARMFEGLIEFIEEALMSRINRILDEEKDTLERIRLVLQLILVFSE
SLMA_VIBCH      VGVSEAALYRHFPSKARMFEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAE
SLMA_ALIF1      VGVSEAALYRHFPSKAKMFEGLIEFIEESIFSRVNRILEDEKDTLKRIELLLKLLLAFAE
SLMA_ALIFM      VGVSEAALYRHFPSKAKMFEGLIEFIEESIFSRVNRILEDEKDTLKRIELLLKLLLAFAE
SLMA_PHOPR      VGVSEAALYRHFPSKARMFEGLIEFIEDSISTRINRILDDEKDTMNRLRMVLQLILVFAE
SLMA_SHEB5      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAE
SLMA_SHEB8      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAE
SLMA_SHEB9      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAE
SLMA_SHEB2      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAE
SLMA_SHESM      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMRRCQLVLQLLLIFAE
SLMA_SHESR      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMRRCQLVLQLLLIFAE
SLMA_SHESA      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMNDEKDTMRRCQLVLQLLLIFAE
SLMA_SHEON      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMKRCQLVLQLLLIFAE
SLMA_SHEPC      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMKRCQLMLQLLLIFAE
SLMA_SHESW      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMKRCQLMLQLLLIFAE
SLMA_SHEHH      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAE
SLMA_SHEPA      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAE
SLMA_SHEPW      VGVSEAALYRHFPSKARMFEGLIEFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAE
SLMA_SHELP      VGVSEAALYRHFPSKARMFEGLIDFIEESLLSRINLIMDEEKDTMRRCQLLLQLLLVFAE
SLMA_SHESH      VGVSEAALYRHFPSKARMFEGLIDFIEESLLSRINLIMTEEKDTMKRCQLLLQLLLIFSE
SLMA_SHEWM      VGVSEAALYRHFPSKARMFEGLIDFIEESLLSRINLIMDEEKDTMKRCQHLLQLLLIFAE
SLMA_SHEDO      VGVSEAALYRHFPSKARMFEGLIEFIEDAILSRLNLIMDEEKDTMMRCQLVLQLLLVFSE
SLMA_SHEFN      VGVSEAALYRHFPSKARMFEGLIEFIEDAILSRLNIIMDEEKDTMTRCQLVLHLLLVFSE
SLMA_SHEAM      VGVSEAALYRHFPSKARMFEGLIEFIEDSLLSRINLIMDDEKDTMRRCQLVLQLLLLFAE
SLMA_IDILO      LGVSEAALYRHFPSKARMFEGLIEFVEDTLLTRINMIMDEEKNTLSRCHAILQLLLTFAE
SLMA_ALTMD      VGVSEAALYRHFPSKARMFEGLIEFIEETLFTRINKIVNEEKDSLTRCQLILHLILGFAE
SLMA_COLP3      VGFSEAALYRHFPSKARMFEGLIDFIEESIFSRINLILADHKEALVRCHHILHVLVVFAE
SLMA_MARHV      VGVTEAALYRHFPSKRKMFEALIEFAEEAVFSRCQVILQEQEDVRVRLQQLSHLVLVFAE
SLMA_MARMS      VGVSEAALYRHFPSKAKMFEGLIEFIEESLFTRINRIVQEESNVIARIEMIVTLVLGFAE
SLMA_ACTPJ      VGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTASTVKAILYTVIEFAR
SLMA_ACTP2      VGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTASTVKAILYTVIEFAR
SLMA_ACTP7      VGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTASTVKAILYTVIEFAR
SLMA_HAEDU      VGVSEGALYRYFPSKSKMFEALIERIEQTLTSYINASKRKENSTALAVKAILYTVIEFAR
SLMA_HAEPS      VGVSEGALYRYFPSKTKMFEALIERIEMTLTSYINASKRQEN-TELAVKAILQTILEFAQ
SLMA_HAEIN      VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
SLMA_HAEI8      VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
SLMA_HAEIE      VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
SLMA_HAEIG      VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
SLMA_PASMU      VGVSEAALYRYYPSKTKMFEALIDNLEAHLFTRITQSVKNETHTAARVHNIMQMVLDFAR
SLMA_MANSM      VGVSEAALYRYFPSKTKMFEALIENIESSLFSRISYSIKMETNTLNRVHDILQMIFDFAR
                :*.:*.****::*** :**:.**:  *  :          .       . :   :. *..

SLMA_ECOLI      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_SHIB3      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO55      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOLC      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOBW      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECODH      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOSE      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO24      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO57      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO5E      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOLU      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO8A      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_SHIFL      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_SHIF8      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOHS      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOSM      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLAS
SLMA_ECO45      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLAS
SLMA_ECO7I      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLAS
SLMA_ECOK1      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLAS
SLMA_ECOL6      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECOL5      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO81      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ESCF3      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_ECO27      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLAS
SLMA_SALA4      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALCH      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALPB      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALPC      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALSV      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALTY      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALEP      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALG2      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALHS      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALNS      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALDC      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALPA      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALPK      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDENLLAS
SLMA_SALTI      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDKNLLAS
SLMA_SALAR      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDENLLAS
SLMA_CITK8      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLAS
SLMA_KLEP3      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEVQLRQVMREKKMREGEGYTLDETLLAS
SLMA_KLEP7      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVMREKKMREGEGYTLDETLLAS
SLMA_ENT38      RNPGLTRIMTGHALMFEQDKLQGRINQLFERIEAQLRQVLREKKMREGEGYTTDENVLAG
SLMA_CROS8      RNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKKMREGEGYATDEALLAS
SLMA_ERWT9      LNPGLTRILTGHALMFEQDRLQGRINQLFERIELQIRQVMRERKMREGEGFATDEALLAT
SLMA_PECAS      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIESQLRQVLREHKLRDGKGFQHDETLLAS
SLMA_PECCP      RNPGLTRIMTGHALMFEQDRLQDRINQLFERIESQLRQVLREHKLRDGKGFQHDETLLAS
SLMA_YERPE      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPP      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPY      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPG      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPA      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPN      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPS      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERPB      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERP3      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_YERE8      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEVQLRQVLREKKLRDGQGFIHDEALLAT
SLMA_SERP5      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERKLREGKGFIVDETLLAS
SLMA_EDWI9      RNPGLTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERRLREGSGFDHDETLLAS
SLMA_SODGM      RNPGLTRIMTGHALMFEQDRLQGRINQLYERIEVQLRQVLRERKLREGEAFELDESLLAS
SLMA_PHOLL      KNPGLTRIMTGHALMFEQNRLQGRINQLFERIEVQIRQVLKEKKLRDGQGFSYDESLLAS
SLMA_PROMH      KNPGLSRILTGHALMFEQDRLQGRINQLYERIEVQLRQVIKERKIREGSAFLHDEALLAS
SLMA_VIBCB      RNPGLTRILSGHALMFENERLRDRINQLFERIETQLRQILRERKIREGKSFPVEERILAA
SLMA_VIBPA      RNPGLTRILSGHALMFENERLRERINQLFERIETQLRQILRERKIREGKSFPVEERILAA
SLMA_VIBVU      RNPGLTRIMSGHALMFENERLRDRINQLFERIETQLRQILRERKLREGKSFPVEEKILAA
SLMA_VIBVY      RNPGLTRIMSGHALMFENERLRDRINQLFERIETQLRQILRERKLREGKSFPVEEKILAA
SLMA_VIBA3      RNPGLTRILSGHALMFENERLRDRINQLFERIETQLRQILRERKLREGKSFPVDEKILAA
SLMA_VIBCH      RNPGLTRILSGHALMFENERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAA
SLMA_ALIF1      RNPGLTRIMTGHALMFENERLRSRINQIFERIELQFKQILRERKLREGKAFPIDESILAA
SLMA_ALIFM      RNPGLTRIMTGHALMFENERLRSRINQIFERIELQFKQILRERKLREGKAFPIDESILAA
SLMA_PHOPR      RNPGLTRIMTGHALMFEQDRLQSRINQLFERIETQLRQVLRERKLREGKGFPVDESVLAA
SLMA_SHEB5      RNPGISRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEB8      RNPGISRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEB9      RNPGISRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEB2      RNPGISRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHESM      RNPGISRVLNGDALLGENERLRSRISTLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHESR      RNPGISRVLNGDALLGENERLRSRISTLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHESA      RNPGISRVLNGDALLGENERLRSRISTLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEON      RNPGISRVLNGDALLGENERLRSRISTLFAKIETQLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEPC      RNPGISRVLNGDALLGENERLRSRISSLFAKIETQLKQILREKTLREGRGFNLDEAILAN
SLMA_SHESW      RNPGISRVLNGDALLGENERLRSRISSLFAKIETQLKQILREKTLREGRGFNLDEAILAN
SLMA_SHEHH      RNPGISRVLNGDALLGENERLRSRISQLFAKIETHLKQILREKSLREGKGFNLDEAVLAN
SLMA_SHEPA      RNPGISRVLNGDALLGENERLRSRISQLFSKIETHLKQILREKSLREGKGFELDEAVLAN
SLMA_SHEPW      RNPGISRVLNGDALLGENERLRSRISQLFSKIETHLKQILREKSLREGQAFSIDEAVLAN
SLMA_SHELP      RNPGISRVLNGDALLGENERLRNRTGQIFSKVETHLKQILREKTLREGKGFNLDEAILAN
SLMA_SHESH      RNPGISRVLNGDALLGENERLRSRVSLIFSKIETHLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEWM      RNPGISRLLNGDALLGEHDRLRSRIGQIFSKIETHLKQILREKTLREGKGFNLDEAILAN
SLMA_SHEDO      RNPGISRVLNGDALLGENERLRSRISVLFAKIETQLKQILREKTLREGQGFNLDEAILAN
SLMA_SHEFN      RNPGISRVLNGDALLGENERLRSRIDVLFAKIETHIKQILREKTLREGVGFNIDEAILAN
SLMA_SHEAM      RNPGISRVLNGDALLGENERLRSRVSALFGKIETQLKQILREKTLREGKGFELDEAMLAN
SLMA_IDILO      RNPGITRVMTGDALMGEHDRLRGRMEDLFNRIESSIKQILREKAMREQQRFIVDEAVLAN
SLMA_ALTMD      KNPGITRILNGDALMGEQDRLRARIAKLFERLETQLKQVLRERKLREGKTLSADEAIIAN
SLMA_COLP3      RNPGMCRILAGDALMGENERLRGRVHQFFEKLESQFKQVLRERKLREGKTFTINEAALAS
SLMA_MARHV      RNPGLCCVLTGDALMGEDESLRKRASQFFERLETQIRQALKEGEIRQGLRPRTTAARGAD
SLMA_MARMS      QNPGMCRLLTADALAGETERLRVRITQVFDRIETQLKQVIREADLKQGLRPAMGVAPCAN
SLMA_ACTPJ      KNPGVTRILTGHALMFEDDQLKARVAKFFDGLEFQFANILQMSKLREGKTFE-DERALAG
SLMA_ACTP2      KNPGVTRILTGHALMFEDDQLKARVAKFFDGLEFQFANILQMSKLREGKTFE-DERALAG
SLMA_ACTP7      KNPGVTRILTGHALMFEDDQLKARVAKFFDGLEFQFANILQMSKLREGKTFE-DERALAG
SLMA_HAEDU      KNPGVTRILTGHALMFENSELKLRVAKFFDGLELQFVNILQMRKLREGKAFQ-DERALAG
SLMA_HAEPS      KNPGVTRILTGHALMFEDELLKARVAKFFEGLELQFMNLLQMRKLREGRAFA-DERALAG
SLMA_HAEIN      KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
SLMA_HAEI8      KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
SLMA_HAEIE      KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
SLMA_HAEIG      KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
SLMA_PASMU      KNPGLTRILTGHALMFEEPQLQARVAQFFDRLELQFINILQMRKLREGKGFDYEERVIAA
SLMA_MANSM      KNPGLTRVLTGHALMFEEAKLQARVALFFDRLELQFVNILQMRKLREGKTFPIDERTIAT
                 ***:  :: ..**  *   *: *   .:  :*  : : ::   :::           * 

SLMA_ECOLI      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SHIB3      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO55      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOLC      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOBW      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECODH      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOSE      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO24      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO57      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO5E      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOLU      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO8A      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SHIFL      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SHIF8      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOHS      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOSM      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO45      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO7I      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOK1      QILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOL6      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECOL5      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO81      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ESCF3      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_ECO27      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALA4      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALCH      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALPB      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALPC      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALSV      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALTY      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALEP      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALG2      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALHS      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALNS      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALDC      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALPA      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALPK      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALTI      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_SALAR      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ---
SLMA_CITK8      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLVAAQLQ---
SLMA_KLEP3      QLLAFCEGMLSRFVRSEFKYRPTDDFEARWPLVAAQLQ---
SLMA_KLEP7      QLLAFCEGMLSRFVRSEFKYRPTDDFDARWPLVAAQLQ---
SLMA_ENT38      QLLAFCEGMLSRFVRSEFKYRPTDDFDTRWPLVAAQLQ---
SLMA_CROS8      QLLAFCEGMLSRFVRSEFRYSPTADFEARWPLLAAQLQ---
SLMA_ERWT9      QLLAFCEGLLSRFVRSEFRYRPTVDFDARWPLMAAQLI---
SLMA_PECAS      QLLAFCEGMLSRFIRSEFRYRPTQEFDTRWPLLAAQLN---
SLMA_PECCP      QLLAFCEGMLSRFIRSEFRYRPTQEFDTRWPLLAAQLN---
SLMA_YERPE      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPP      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPY      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPG      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPA      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPN      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPS      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERPB      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERP3      QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ---
SLMA_YERE8      QLLAFCEGMLSRFVRSEFRYRPTQEFDARWPLIVAQLQ---
SLMA_SERP5      QLLAFCEGMLSRYVRSEFRYRPTQEFDGRWPLLAAQLQ---
SLMA_EDWI9      QLLAFCEGMLSRFVRSEFRYRPTQEFETRWPLLACQLQ---
SLMA_SODGM      QLLAFCEGMLSRFVRTEFKYRPTQEFELRWPLLVAQLH---
SLMA_PHOLL      QLLAFCEGMLSRFVRSEFHYRPTQEFEARWPLLLAQLQ---
SLMA_PROMH      QLLAFCEGMLARFVRTEFRYHPTQEFEARWPLIQAQLQ---
SLMA_VIBCB      QILGQVEGSLNRFVRSDFKYQPTANFDEYWALLSAQIK---
SLMA_VIBPA      QILGQVEGSLNRFVRSDFKYQPTANFDEYWALLSAQIK---
SLMA_VIBVU      QLLGQVEGSLNRFVRSDFKYQPTENFEEYWALLSAQIK---
SLMA_VIBVY      QLLGQVEGSLNRFVRSDFKYQPTENFEEYWALLSAQIK---
SLMA_VIBA3      QLLGQVEGSLNRFVRSDFKYQPTENFDAYWALLSAQIK---
SLMA_VIBCH      QLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK---
SLMA_ALIF1      QLVGQVEGSFCRFVRSDFKYQPTENFNEYWALLSAQIQ---
SLMA_ALIFM      QLVGQVEGSFCRFVRSDFKYQPTENFNEYWALLSAQIQ---
SLMA_PHOPR      QLLGQVEGSLNRYVRSNFKYKPTENFDHYWQLLSAQLG---
SLMA_SHEB5      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHEB8      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHEB9      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHEB2      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHESM      LLLAFAEGRIAQFVRSEFKLKPTQHFDEQWRFIQHQLLQS-
SLMA_SHESR      LLLAFAEGRIAQFVRSEFKLKPTQHFDEQWRFIQHQLLQS-
SLMA_SHESA      LLLAFAEGRIAQFVRSEFKLKPTQHFDEQWRFIQHQLLQS-
SLMA_SHEON      LLLAFAEGRIAQFVRSEFKLKPTQHFDEQWRFIQHQLLQS-
SLMA_SHEPC      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHESW      LLLAFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS-
SLMA_SHEHH      LLLAVAEGRIAQFVRSEFKLKPTKHFNEQWTFIQQQLLQS-
SLMA_SHEPA      LLLAVAEGRIAQFVRSEFKLKPTKHFNEQWNFIQQQLLQS-
SLMA_SHEPW      LLMAIAEGRIAQFVRSEFKLKPTKHFNEQWTFVQQQLLQS-
SLMA_SHELP      LLLAVAEGRIAQFVRSDFKNKPTEHFAEQWQFIQQQLLQS-
SLMA_SHESH      LLLAIAEGRIAQFVRSEFKQKPTEHFDQQWIFIQQQLLQS-
SLMA_SHEWM      LLLAVAEGRISQFVRSEFKQKPTTHFEEQWVFIQQQLLQS-
SLMA_SHEDO      LLLAVAEGRIAQFVRSEFKQKPTLHFDEQWTFIQQQLLRS-
SLMA_SHEFN      LLLAFAEGRISQFVRSEFKQKPTQHFDEQWTFIQQQLLRS-
SLMA_SHEAM      LLLAVAEGRIAQYIRSEFKQKPTEHFDEQWGFIQKQLLQS-
SLMA_IDILO      LLLSYADGKISQFVRSNFKRLPTEHFSAQWQVMEQQLISA-
SLMA_ALTMD      MMICYTDGRINGFIRSGFTRKPTEQFNEQWAAFKQMFV---
SLMA_COLP3      LLVSFAEGKISQYVRSGYSKKPSTDFNEQWQFLMANK----
SLMA_MARHV      FVMVFVEGRIQRFVRSSFLRLPTSDFDEAWGLVSEAVWG--
SLMA_MARMS      FLIAIIEGKIRHYVRSEFKVKPMEIWPEQWTVLAQNLMLNR
SLMA_ACTPJ      YLVNFCEGQFLRLVRSNFSYNQHQHFEKQWALIKPLFE---
SLMA_ACTP2      YLVNFCEGQFLRLVRSNFSYNQHQHFEKQWALIKPLFE---
SLMA_ACTP7      YLVNFCEGQFLRLVRSNFSYNQHQHFEKQWALIKPLFE---
SLMA_HAEDU      YLVTFCEGQFLRLVRSNFSSNPHQHFEKQWSLIKPLFE---
SLMA_HAEPS      YLVNFCEGQFLRLVRSNFGFNQHQHFEKQWQLIKPLFY---
SLMA_HAEIN      HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA---
SLMA_HAEI8      HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA---
SLMA_HAEIE      HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA---
SLMA_HAEIG      HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA---
SLMA_PASMU      HLVNLCEGHFMRYVRSNFRHSTQQSFEQQWRLLERLFA---
SLMA_MANSM      YLVTFCEGQFMRLVRTNFRHMPNQGFEQQWRFIEPLFE---
                 ::   :* :   :*: :       :   *  .