CLUSTAL format seed alignment for MF_01840

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACSF1_NOSS1      ---------------MVNTLPKPGIKTPSKETVLTPRFYTTDFETAANLDLSAQENELQA
ACSF2_NOSS1      --------MVNSLTTPEPQTLKPGVKAPVQETLLTPRFYTTDFDAVANLDISANETEIRA
ACSF2_SYNY3      --------MVSTTLPTQLETIRPGIKAPVKETLLTPRFYTTDFDKVANLVLTLQDEEIEA
ACSF2_THEEB      ------------MVAIAPNPHSGQSVKTIRENLLTPRFYTTDFEQAAKLDLSRQQEQLEA
ACSF_GLOVI       -------------MVDALREANTASQSERRETLLTPRFYTTDFEALAKLDISAMEADFEA
ACSF_RUBGE       -----------MLATPTIESPEEAARRAKESTLLSPRFYTTDYAAMNAIDVSSIRAEWDA
ACSF_RHOPA       MIPMEGGAQGALRTRPDIKGSVDSLNIAKQDTILTPRFYTTDYAAMDKLDVSLVRAEWTA
ACSF3_NOSS1      --------MVDSLKKPGFEEIRPGVKVPAKETLLTPRFYTTDFDEMARMDISVNEDELLA
ACSF1_SYNY3      --------MVNTLEKPGFDEIRPGVKTPAKETILTPRFYTTDFDEMAKMDISPNEDELRA
ACSF1_THEEB      --------MVNTVAKPEFEELRPGIKAPAKETILTPRFYTTDFEAMANMDITENKAELEA
ACSF_PROMP       --------MAQQTIESNNKKSVNRGKDIAKDTILTPNFYTTDFEAMEKMDLSINEDELEA
ACSF_SYNPX       ----------MVPPTAVAEANAVATKDPVKDTILTPRFYTTDFDDMAAMDLRPNEAELEA
ACSF_SYNP6       --------MVDSLQKPELEELRPGIKAPAKETILTPRFYTTDFEAMAKMDLSPNEDELRA
ACSF_CYACA       ---------------MVLNANHLQTKKTIKETLLAPRFYTTDFDEISRYDISSNFEEIEA
ACSF_CYAM1       -------------------MQTAVQTQTTVQTLLTPRFYTTDFDQMAKYDISKNRAEIEA
ACSF_GRATL       -----------------MSTSQNLSQTPVKETLLTPRFYTTDFDEMSKLDISSNIDEFEA
ACSF_PORPU       -----------------MQTTIQKEEAPNRETLLTPRFYTTDFEEMASMNISENEQDFFA
ACSF_PROMA       --------MTTTTSGAPASLGRNELPPHLDENLLTPRFYTTEFEKAAKTDLEIARKDFEA
ACSF_PROMM       ------MTATTATAPTMRGGGRNELPPHLDDNLLTPRFYTTEFDKAAKTDLDIARKDFEA
                                               ..:*:*.****::       :     :  *

ACSF1_NOSS1      MLAEMRADYNRHHFVRDEAFEQS----WEHIDGEARQAFIEYLERSCISEFSGFLLFKEL
ACSF2_NOSS1      IVEELRADYNRHHFVRDEEFKQS----WDHITGEKRRAFIDFLERSCTSEFSGFLLFKEL
ACSF2_SYNY3      ALEELRADYNRYHFVRNDDFKRS----FDHIDGATRLAFIDFLERSCTSEFSGFLLFKEL
ACSF2_THEEB      MLAEMRADYNRHHFVRDDSFKGT----WDLLDAQTRKAFIDYLERSCVSEFSGFLLFKEL
ACSF_GLOVI       LLAEFQADYNREHFQRDAGFVEQ----AHQIDPQWRALMLEFLERSCTSEFSGFLLYKEI
ACSF_RUBGE       MLAEYEGDNNHDHFQRTPEFAQEVAERFSQVSPELRQEFLDFLVSSVTSEFSGCVLYNEI
ACSF_RHOPA       MMNELRADYNKSHFKKTDEFVNS---DLDKLPPELRAEFKDFLVSSLTAEFSGCVLYAEI
ACSF3_NOSS1      ILEEFRTDYNRHHFVRDAEFEKS----WDHIDGDTRRLFVEFLERSCTAEFSGFLLYKEL
ACSF1_SYNY3      ILEEFRVDYNRHHFVRNESFNKS----WDHIDGEKRQLFVEFLERSCTAEFSGFLLYKEL
ACSF1_THEEB      ILEEFRCDYNRHHFVRDEEFEQS----WDHIDGETRRLFIEFLERSCTAEFSGFLLYKEL
ACSF_PROMP       ICEEFRKDYNRHHFVRNKEFEGA----ADKIDAETRELFVDFLEGSCTSEFSGFLLYKEL
ACSF_SYNPX       ICEEFRKDYNRHHFVRNDDFDGA----ADKLDPETRRVFVEFLEQSCTSEFSGFLLYKEL
ACSF_SYNP6       ILEEFRADYNRKHFVRTPEFDGS----AADMDPETKKVFVEFLEQSCTSEFSGFLLYKEL
ACSF_CYACA       IVNEFRSDYNKKHFIRDEEFDRH----WSQIDAQTKQMFVEFLERSCTAEFSGFLLYKEL
ACSF_CYAM1       IVNEFRKDYNQTHFIRDDEFDQV----WTQMPESKRQWFKEFLERSCTAEFSGFLLYKEL
ACSF_GRATL       LLQEFRADYNRQHFIRDQEFEQS----WNNLDSGTKALFVEFLERSCTAEFSGFLLYKEL
ACSF_PORPU       ILEEFRADYNSQHFIRGEEFNQS----WSNLETKTKSLFIEFLERSCTAEFSGFLLYKEL
ACSF_PROMA       MFKEMEADYNLKHFDRKASLER-----LDELSPEDKAVYESYLVRSVVSEFSGFLLFKEI
ACSF_PROMM       MFKEMEADYNLKHFDRKASLER-----LSELSPEDKAIYESYLVRSVVSEFSGFLLFKEI
                    * . * *  ** :   :          :    :    .:*  *  :**** :*: *:

ACSF1_NOSS1      SRKLKNR-SPVLAEMFQLMARDEARHAGFLNKAMGDFKLSLDLATVTKTRTYTFFPIEWV
ACSF2_NOSS1      SRRIKSR-NPLLAEAFEFMARDEARHAGFLNKSMSDLNLSLDLNYLTKNRTYTFFPPEWV
ACSF2_SYNY3      SRRLKNR-SPKLAEAFHLLARDEARHAGFINKAMADFGLSLDLRYLTQKRTYTFFPPEWV
ACSF2_THEEB      SRKLKDR-NPLLAEIFHLMARDEARHAGFLNKAMMDFGHAMDLGYLSKTRTYTFFPLPWV
ACSF_GLOVI       SRRLKAA-NPLLAECFKAMSRDEARHAGFLNKAMGDYDLGLDLSNLAKQKKYTFFKPKFI
ACSF_RUBGE       QKNVE---NPDVKALMRYMARNESRHAGFINQALRDFGLGINLGGLKRTKAYTYFKPKYI
ACSF_RHOPA       KKRIK---NPEIRELFGLLSRDEARHAGFINEILKDHGIGVDLSFLTKVKKYTYFRPKFI
ACSF3_NOSS1      GRRLKDK-SPVLAECFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRNYTFFKPKFI
ACSF1_SYNY3      GRRLKNK-NPLLAECFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTFFKPKFI
ACSF1_THEEB      SRRLKDR-NPLLAECFALMSRDEARHAGFLNKAMADFNLSLDLGFLTQHRSYTYFEPEFI
ACSF_PROMP       SKRIKDK-NPLLAECFAHMARDEARHAGFLNKSMNDFGLQLDLGFLTANKDYTYFAPRAI
ACSF_SYNPX       SRRIKQQ-NPLLAECFAHMARDEARHAGFLNKAMSDFGMQLDLGFLTANKDYTFFQPKFI
ACSF_SYNP6       SRRIKNR-NPLLAECFELMARDEARHAGFLNKSMSDFDLQLDLGFLTANKKYTYFKPAYI
ACSF_CYACA       ARKLKEK-MPVLAEGFLLMSRDEARHAGFLNKAMADFNLTLDLGFMTKNRRYTFFKPKFI
ACSF_CYAM1       SRRLKDT-NPLLAEGFGYMSRDEARHAGFLNKAMADFGVSLDLGFLTKHRQYTFFAPKFI
ACSF_GRATL       SRKLDKS-NPVIAECFLLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTFFAPKFI
ACSF_PORPU       SRKLKDS-NPIIAECFLLMSRDEARHAGFLNKAIGDFNLSLDLGFLTKTRKYTFFSPKFI
ACSF_PROMA       SNRFKKAGRQELGQFFTFLARDEARHAGFLGRALKTEGINVDLPNLPKKRAATFFPLSWV
ACSF_PROMM       SNRFKKAGRQELGQFFTFLARDEARHAGFLGRALKAEGINVDLPNLGNKRAATFFPLSWV
                  ....      :   :  ::*:*:*****:.. :      ::*  :   :  *:*    :

ACSF1_NOSS1      LYTVYLSEKIGYWRYIIIFRHLEKHPENQFYPIFRYFESWCQDENRHGDIFKALLRSQPQ
ACSF2_NOSS1      IYTVYLSEKIGYWRYILVHQHMQEHPEYQFYPLFRKFESWCQDENRHGDFFKALLRSQPQ
ACSF2_SYNY3      IYTVYLSEKIGYWRYILMFRHLEKNPDHNIYPLFNYFECWCQDENRHGDFFKALLRSQTA
ACSF2_THEEB      LYTVYLSEKIGYWRYIIIYRHLEKHPEHSFYPLFNYFERWCQDENRHGDIFKALIHSQPQ
ACSF_GLOVI       FYATYLSEKIGYWRYIAIFRHLERHPENRIHPLFNYFKNWCQDENRHGDFFGLILKSQPQ
ACSF_RUBGE       FYATYLSEKIGYARYITIYRQLERHPDKRFHPIFRWFERWCNDEFRHGESFALILRAHPH
ACSF_RHOPA       FYATYLSEKIGYARYITIYRQMERHPERRFHPIFKWFERWCNDEFRHGEAFALLMRADPS
ACSF3_NOSS1      FYATYLSEKIGYWRYITIYRHLEAHPEDRIYPIFRFFENWCQDENRHGDFFDAIMKSQPQ
ACSF1_SYNY3      FYATYLSEKIGYWRYITIYRHLEKNPNDCIYPIFEFFENWCQDENRHGDFFDAIMRAQPH
ACSF1_THEEB      FYATYLSEKIGYWRYITIYRHLEKHPEHRIYPIFRFFENWCQDENRHGDFFDAVMRAQPQ
ACSF_PROMP       FYATYISEKIGYWRYIAIYRHLEKNPSGKIFPLFNFFENWCQDENRHGDFFDALMKAQPR
ACSF_SYNPX       FYATYLSEKIGYWRYIAIYRHLEKNPESKIFPIFNFFENWCQDENRHGDFFDALMKSQPD
ACSF_SYNP6       FYATYLSEKIGYWRYITIFRHLEQHPEYRIYPIFKFFENWCQDENRHGDFFDALMKAQPS
ACSF_CYACA       FYATYLSEKIGYWRYITIYRHLEKHPEHRIYPIFKFFESWCQDENRHGDFFAAIVKSQPY
ACSF_CYAM1       FYATYLSEKIGYWRYITIYRHLEAHPKWSVYPIFKFFEKWCQDENRHGDFFAAILKAQPK
ACSF_GRATL       FYATYLSEKIGYWRYITIYRHLEKHPEHRIYPIFKFFENWCQDENRHGDFFAALLKSQPQ
ACSF_PORPU       FYATYLSEKIGYWRYITIYRHMEQYPEHRIYPIFKFFENWCQDENRHGDFFAALLKSQPH
ACSF_PROMA       LYSLYLSEKIGYWRYILINRHLKANPDKVCAPLFDFFEPWCQDENRHGDCINLMMRCWPG
ACSF_PROMM       LYSLYLSEKIGYWRYILINRHLNDNPEKVCAPLFDFFEPWCQDENRHGDCINLMMRCWPG
                 :*: *:****** *** : ::::  *.    *:*  *: **:** ***: :  :::. . 

ACSF1_NOSS1      LWNNWK-------------------------------ARLWSRFFLLSVFATHTLTVH-E
ACSF2_NOSS1      LWKNWK-------------------------------ARLWVRFFLLTVFVTHTMTVF-E
ACSF2_SYNY3      LWKTWQ-------------------------------SRLWSRFFLLTVFVTHTLTVF-E
ACSF2_THEEB      LIQGWG-------------------------------AKLWMRFFLLTVFATHTLTVH-E
ACSF_GLOVI       LLKGPI-------------------------------NRLWVRFFLLSFCLTMYLNDR-K
ACSF_RUBGE       LISGA--------------------------------NLLWVRFFLLAVYATMYVRDH-M
ACSF_RHOPA       LLSGV--------------------------------NKLWIRFFLLAVFSTMYVRDH-M
ACSF3_NOSS1      MLNDWK---A----------------------------KLWSRFFLLSVFATMYLNDI-Q
ACSF1_SYNY3      TLNDWK---A----------------------------KLWCRFFLLSVFATMYLNDT-Q
ACSF1_THEEB      MLDRPR---TFWQKIKEIPLSLSGKKWARYFMVCWVPPKLWCRFFLLSVFATMYLNDL-Q
ACSF_PROMP       TVKSLSQKIEIFGYTLKHPIFDYYHRFRYFLNNHPIVSKLWSRFFLLAVFATMYIRDLGT
ACSF_SYNPX       TVRGPI-------------------------------AKLWCRFFLLAVFATMYVRDV-A
ACSF_SYNP6       TVRGFV-------------------------------AKLWCRFFLLAVFATMYIRDV-Q
ACSF_CYACA       LLEGFI-------------------------------SKLWCRFFLLAVFATMYLNDC-Q
ACSF_CYAM1       WITGWA-------------------------------SRLWCRFFLLSVFVTMYLNDL-Q
ACSF_GRATL       LLNNLE-------------------------------ARLWCRFFLLSVFATMYLNDF-Q
ACSF_PORPU       FLNDWK-------------------------------AKMWCRFFLLSVFATMYLNDF-Q
ACSF_PROMA       MTKGFR-------------------------------GKLLSRFFLWTVFLTHTLTVC-E
ACSF_PROMM       MTKGFR-------------------------------GKLLSRFFLWSVFLTHTLTVC-E
                                                        :  **** :.  *  :     

ACSF1_NOSS1      RSGFYKSLGLDATDFDLQVVRNTNETAGRAFPVMLNTEHPKFFPLLQRCAGYNLNISEIE
ACSF2_NOSS1      RASFYESIGIHPRKYNNRVIQETNNTSARAFPLILNTNHPLFFWRLEQCWENNFKLAAIK
ACSF2_SYNY3      RTDFYQSVGLDAKQYNVDVVTNTNATAARAFPEVLDTDNPKFFPRLEACASANEKLTAIA
ACSF2_THEEB      RAKFYEALGLDATAFDREVIAKTNETAARTFSVVLNVDHPEFYSRLQRCVEISNKLQAIE
ACSF_GLOVI       PHNLYSALGLDASHYAMEVLRQTNLDSGKVFPLILDLDNPRFQRHLDRCADLNLQLEALS
ACSF_RUBGE       RPQLHEAMGLESTDYDYRVFQITNEISKQVFPISLDIDHQAFRAGMERLVRVKTKVDAAK
ACSF_RHOPA       RPAFYEALGVDATDYGMQVFRITTEISKQVFPVTINLDDPRFLQNLERLRIAAEKIDRSH
ACSF3_NOSS1      RKDFYATIGLDARDYDIYVIKKTNETAGRVFPIILDVDSPEFYERLDICVENSEKLSAIA
ACSF1_SYNY3      RADFYACLGLEARSYDKEVIEKTNETAGRVFPIILDVNNPEFYNRLETCVSNNEQLRAID
ACSF1_THEEB      RAKFYTALGLDAREYDREVIAKTNETAGRVFPVILDVDHPEFYQRLERCVENNAKLTEIA
ACSF_PROMP       KRNFYGALGLNAREYDQFVINKTNETSAKVFPVVLNVYDKSFYKRLDRIVENGTRLSEID
ACSF_SYNPX       RKEFYEALGLDARTYDKMVIEKTNETTARVFPVVLDVNNPKFWTRLERLVENNAALEAAD
ACSF_SYNP6       RKEFYEALGLDAREYDRHVIAKTNETSARVFPVVLDVDHPKFYDRLETCIANNNQLAAIE
ACSF_CYACA       RGEFYKSIGLDPRQFDIYVIQKTNESAAKLFPTVLDLDNPRFFECLDKCACYNKLLLEID
ACSF_CYAM1       RKDFYQLIGLDARAFDWHVIRKTNESAARLFPVVLDVDHVDFVRLMDECACAYAHWRETQ
ACSF_GRATL       RSNFYKSIGLDARQYDMQVIRKTNESASRIFPVALNVDQPKFFQYLDQCAVENKKLIEID
ACSF_PORPU       RIDFYNAIGLDSRQYDMQVIRKTNESAARVFPVALDVDNPKFFKYLDSCACNNRALIDID
ACSF_PROMA       RGEFYELLGIDPVLFDEEVIIQTNNTSKNAFPWVYKFEDGKFLSMRIDILNAFKKWRNQN
ACSF_PROMM       RGDFYGLLGIDPVLFDEEVIIQTNNTSRNAFPWVYNFDDGKFLEMRVQILKAFRNWRESS
                    ::  :*:..  :   *.  *.  : . *.   .     *                  

ACSF1_NOSS1      RSSQP---KFVKLIRKLPLIAAIVWNLLMVYLIKPIDTEALRETVR------
ACSF2_NOSS1      NSKLP---NFVKFFQRIPPATAIFWNMLRLFLIKPIDTEATRGTVL------
ACSF2_SYNY3      NSEAP---KLAKFCQKAPWIAVIIWQMICIFLQKPVDAEARRGMVC------
ACSF2_THEEB      ATHQP---KWLKALRKLPHQLAIAGHLLRIYLLPPVNAQQEWGTVH------
ACSF_GLOVI       GKSP---------LARLPVIAALAGTIAQLFLLKPVAPPA-PEMVR------
ACSF_RUBGE       AR--G---GLVGRLQQAAWAAAGAATFARMYLIP-VRRHALPAQVRMAPAW-
ACSF_RHOPA       S---Q---GLLGKLKRPFYAASAALAFGRLFLLPAKRNE-LPRVIGLRPAW-
ACSF3_NOSS1      SSNTP---KFLQFFQKLPVLASTGWQLLRLYLMKPIDAVSAQGAAR------
ACSF1_SYNY3      ASGAP---GVIKALRKLPIFASNGWQFIKLYLMKPIAVDQLAGAVR------
ACSF1_THEEB      KQNGG-------FLKKLPLYLSNVWQMIKLFLIPAKEPT--RVAVR------
ACSF_PROMP       KKENP---NVIKVLSKLPIFISNGYQLIRLYLLKPLESDDFQPSIR------
ACSF_SYNPX       RSSSP---APLKLFKKLPRWISNGAEMAKLFLMSPIDSAKFQPAVR------
ACSF_SYNP6       ATSAP---KPVKVLRKLPYYLSNGLQLLKLYLVKPLESDVYQPAVR------
ACSF_CYACA       DREQPFFNQVLNVFYKFYLYFLLVLNFIMLYFLRTVNCNSFTRMVK------
ACSF_CYAM1       SVLS---------------LAKIFACLFKLYVIKPINTQALWNTIK------
ACSF_GRATL       QKYNN---WFIKKLIKMPIYIKLCSCLIKLYLLPAIPSAHVVSTIR------
ACSF_PORPU       KKGSQ---PLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAVWNTVR------
ACSF_PROMA       GIKKP---LALGKF---------VLLILKQFTL-PMEK---TDAVR----YG
ACSF_PROMM       GLAKP---VALSKFVSL---------ILRQFAL-PMQK---TNAVR----YG
                                           :   :