CLUSTAL format seed alignment for MF_01843

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

THF1_PROMP      MKEKLTVSDSKKLFHEQFPYVIPGLYKRIVDEMLVELNLLNHQNEFIQDDLFCVGLTETF
THF1_PROM9      MKAKLTVSDSKKLFHEEFPYVIPGLYKRIVDEILVELNLLNHQNEFKQDYLFCIGLTETF
THF1_PROMM      MSDRKTIADSKRAFNHDFPHVIPSLYRRTTDELLVELHLLSHQKHFHPDALFAIGLSQVF
THF1_SYNPX      MAERHTIADSKRAFHQAFPHVIAPLYRRIADELLVELHLLSHQATFQANSLFAVGLKTVF
THF1_SYNS9      MGERQTIADSKRAFHQAFPHVIAPLYRRLADELLVELHLLSHQSSFKTTPLFAVGLCTVF
THF1_SYNSC      MAASQTIADSKRAFHQAFPHVIAPLYRRLADELLVELHLLSHQSRFEANELFSVGLCTVF
THF1_PROMA      MGEQTTISDSKGLFHKEFPYVIPPVYRKVLDEYLVELNLLSNQSNFKIDTIFSYGLIISF
THF1_PROMT      MSVRATISDSKSDFHKEFPYVIPAIYRKLADELLVELHLLSHQKNFKKDSIFSTGLKEVF
THF1_SYNJA      MNPVRTLSATKAAFFSAYPRPINAAYRRVVEELLVELHLTTVNSAFVYDPFFALGLVTLY
THF1_SYNJB      MNPVRTLSATKAAFFSAYPRPINAVYRRVVEELLVELHLTTVNSTFVYDPFFALGLVTLY
THF1_GLOVI      MTSKRTVSDSKRAFFAAYPRPVNSIYRRVIDELLVEVHLLITNQDFRHDPLFATGLLTAY
THF1_SYNY3      MTKIRTVSDAKRKFFTHYSRPISSIYRRFVEELLVEMHLLSVNIDFTYDPIFALGIVTSF
THF1_THEEB      MQNPRTVSDTKRAFYAAHTRPIHSIYRRFIEELLVEIHLLRVNVDFRYSPLFALGVVTAF
THF1_SYNP6      MTSVPTVSDSKRAFYAAYPRPINPLYRRVVEELLVEIHLLSVNTSFVYDPLFALGVVTAF
THF1_SYNE7      MTSVPTVSDSKRAFYAAYPRPINPLYRRVVEELLVEIHLLSVNTSFVYDPLFALGVVTAF
THF1_NOSS1      MELLRTVSDTKRTFYALHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTTF
THF1_TRIV2      MELLRTVSDTKRTFYALHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTTF
                *    *:: :*  *   ..  :   *::  :* :**::*   :  *    ::. *:   :

THF1_PROMP      KELTKGYKPEEHLRVLFESLCNSSNFEPKKIKEASKKTLEVYKDKSLKEISI-LLKQKSD
THF1_PROM9      KELTKGYKPEKHLDLLFESLCISTNFEAKEIKEISKISQKEFSDKSSKDILK-LLKEKSN
THF1_PROMM      DVFTSGYRPEAHVKTLFDALCRSCGFDPNALRKQAQQTLESVRGHDLEEVQG-WIQQQGK
THF1_SYNPX      ERFTQGYRPMEHPAALLSALCSSNGFDDEQLKQAAQHCLQDAEGHSDDAFQS-WLKEQSL
THF1_SYNS9      DTFSAGYRPEEHITGLLDALCSSNGYDANTFRKESKRCIDAAKTESVDAMDS-HLAGQKL
THF1_SYNSC      DTFIKGYRPEAQTDALFRALCSSNGFDAAKLRKTYASLVEQAKGKDPESLKD-WLSSHAL
THF1_PROMA      ERFTVGYEPDSHISKILESLCNSCNIDIKAIKEYSNNIKKLINEKGIKEIINILTAEIKK
THF1_PROMT      SKFTSGYKPSEHATKLFDAICNCNGFNPTEINNSSEQLVSNAKSFTKEDLNS-FLSKTNN
THF1_SYNJA      DSLMEAYHPPEQREAIFNALCKALHLKPEVLRKNARDLLELMRSGDPVQRYN-LLCLKPE
THF1_SYNJB      DGLMEAYHPPEQREAIFNALCKALHLKPEVLRKNARDLLELMGSGDPRQRLD-LLCLKPE
THF1_GLOVI      QALMEGYTPVEQRDAILRALCTALELSYEQLHTDAAQWRAIAAELPAQEVLE-VMAGKRE
THF1_SYNY3      NSFMQGYQPAEQLPAIFNALCHGVDQNPDQVRQDAKNVAASAHHIGLDA----WVTAAAS
THF1_THEEB      DQFMEGYQPEGDRDRIFHALCVAEEMNPQQLKEDAASWQQ-YQGRPLSQILD-ELNSGQP
THF1_SYNP6      DSFMSSYRPIEAVGPLFTALTQAVRQNPEQYRHDANAIAEQVRGVGSDTIRQ-WLTEAEA
THF1_SYNE7      DSFMSSYRPIEAVGPLFTALTQAVRQNPEQYRHDANAIAEQVRGVGSDTIRQ-WLTEAEA
THF1_NOSS1      DRFMEGYQPERDKESIFSAICQAVEQEPQRYRQDAERLQAVAQSLPVNDLVA-WLSQANH
THF1_TRIV2      DRFMQGYQPERDKESIFSAICQAVEQEPQRYRQDAERLKAVAQSLPVNDLVA-WLSQANH
                . :  .* *      :: ::      .    .                            

THF1_PROMP      SNL-------------------YSSRILNLGIYLIIANATDF-KDIKDPEKNKIISDIIN
THF1_PROM9      SKL-------------------YPSRILNLGIYILISNSQDF-KENNDIEKNKMISDIFE
THF1_PROMM      GAPEA---LAKALRNTAGSTTFHYSRLMAVGLLSLLASAQGD-ESSDPEKLSQIAHELSE
THF1_SYNPX      SDGA------------------HYSRLMAVGLLALLEASSDE---SDASSLRQRAVKLSV
THF1_SYNS9      GEGS------------------HYSRLMAIGVLRLFEEAKGDADQPDEADLRKRCKELST
THF1_SYNSC      KEGS------------------HYSRLMAVGLMSLLKAAAADATDSDTEAIVKQSKELAE
THF1_PROMA      SVGGIA-------LSNQSGKDKYYSRLHAIGIYELISNINED---KKEGDDKEIISECVE
THF1_PROMT      DNKGYD----------------YYSRINAIGIYKLVSEMPLF-KEVKEEDLNKEINDISK
THF1_SYNJA      AEDVGG--LKAILQRMTQPP-YAYSRVLAVGLYTAYEAVATSLYKEPEERTRHFLEDVIG
THF1_SYNJB      AEDVGG--LKAILERMTQPP-YAYSRVLAVGLYTAYEVVAKSLYEEPEERTRRFLENVVS
THF1_GLOVI      AGDGRLKAMGDTLAGIANAERFKYSRLFSLGLANILEQAGRA-AAMSEKDRLERLQQICT
THF1_SYNY3      EQASGDNLLLNTLTGIHQRHKFKYSRLFAIGLYTLLADQDPE-VKDNDEKRQDYLTRLSE
THF1_THEEB      SAPLNS-----------LNHTGKYSRLHAVGLYAFLQELAGE----VTIHLNETLDQLAP
THF1_SYNP6      LGNAPE-LVRSSFQAIAGRSEFKYSRLFAIGLFSLLETAAPD-LVQDPEALKTTVTAIAE
THF1_SYNE7      LGNAPE-LVRSSFQAIAGRSEFKYSRLFAIGLFSLLETAAPD-LVQDPEALKTTVTAIAE
THF1_NOSS1      LQQDAD--LQAQLQAIANNSNFKYSRLFAIGLFTLLEQSNPD-LVKDEKQRTEALKSIAA
THF1_TRIV2      LQQDAD--LQAQLQAIASNPNFKYSRLFAIGLFTLLEQSNPD-LVKDEKQRTEALKTIAA
                                        **:  :*:                            

THF1_PROMP      KLNLSFNKAEKDIGIYKSSILKMEQAKELLQEAKIKDKKEKKK-----------------
THF1_PROM9      KLSLSRNKAEKDIGIYKSSISKMEQAKELIQEQRIKDKKKTL------------------
THF1_PROMM      SVGFSKARVEKDLNLYKSNLEKMAQAVELTEQILESERRKREQNESAKLNTGSSEQMSQG
THF1_SYNPX      DLGLPAERVEKDLTVFSSNSERMEQAVELMQETLAADRRKKEKRLAE------AAESTAG
THF1_SYNS9      ALNFPAERVEKDLSLFASNSERMSAAIELVQETIAAERRKKERRQAE------QAQRSES
THF1_SYNSC      GLGLPTDRVEKDLTLFGSNSERMDQAVELVEETIAAEKRKKERRLEE------QAQRTSS
THF1_PROMA      ALGFSKDRVEKDINQYKNSMEKIKEMMELIKLTVEETKRKAKLN----------------
THF1_PROMT      SLGYQYSRVEKDISMYKSNIEKMKQALEIIALNLKTK-----------------------
THF1_SYNJA      NLPFSPERVKKDLELYRSNLDRLKQARAIVEEMVKAARRQQERRQST-------ASLPET
THF1_SYNJB      KLPFSTERVRKDLELYRSSLDRMKQARAVVEEMVKAARRQQERRQSA-------ASLPET
THF1_GLOVI      YLKLDYNRVKRDLDFFHSVLERIKRSKEVVDELSQTERRKREER----------AVSQPG
THF1_SYNY3      LLDLSLDKVVKDLDLYRSNLEKVDQLLKVLEDAAEAERKKKEKQA---------ASTTPA
THF1_THEEB      VIPLPIEKVKRDLELYRSNLDKINQARSLMKELVEQERKRRAQQ----------TSAPPA
THF1_SYNP6      RFHLPSDKLQKDLDLYRSNLEKMEQARITMEEAIQADRRKREQREQEKLAKAAAAEAPAA
THF1_SYNE7      RFHLPSDKLQKDLDLYRSNLEKMEQARITMEEAIQADRRKREQREQEKLAKAAAAEAPAA
THF1_NOSS1      GLHLSDDKFSKDLELYRSNLDKMTQALAVMADMLTADRKKREQRQQQ-------ASTPVA
THF1_TRIV2      GLHLSDDKLSKDLELYRSNLDKMTQALAVMADMLTADRKKREQRQQQ-------ASTPVA
                 .     :  :*:  : .   ::                                     

THF1_PROMP      -----------------
THF1_PROM9      -----------------
THF1_PROMM      VEACSNIS---------
THF1_SYNPX      -----------------
THF1_SYNS9      -----------------
THF1_SYNSC      -----------------
THF1_PROMA      -----------------
THF1_PROMT      -----------------
THF1_SYNJA      -------PAADRRESSG
THF1_SYNJB      SLGDPSKPGS-------
THF1_GLOVI      -----------------
THF1_SYNY3      IE---EAPVTTAESSES
THF1_THEEB      VDASSDAPA--------
THF1_SYNP6      LEASSDNPEPETSETPS
THF1_SYNE7      LEASSDNPEPETSETPS
THF1_NOSS1      -------PPNE------
THF1_TRIV2      -------PPNE------