CLUSTAL format seed alignment for MF_01848

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMF_PSYA2            --------------------------MTSKPMTRRPTANNHRNRSPETAK----------
RLMF_PSYCK            --------------------------MTSKPMNRRPTANNHRNRSPETAK----------
RLMF_PSYWF            -------------------------------MTHPVTPKNTTRPTPANKP----------
RLMF_DESPS            ------------------------------------MASQHDKKS----V----------
RLMF_PSYIN            ------------------------------------MTKDIQVKK---------------
RLMF_PSET1            ------------------------------------MKASTSRAK---------------
RLMF_COLP3            ------------------------------------------------------------
RLMF_SHIBS            -----------------------------------------------MSA----------
RLMF_SHIB3            -----------------------------------------------MSA----------
RLMF_ECO55            -----------------------------------------------MSA----------
RLMF_ECO45            -----------------------------------------------MSA----------
RLMF_SHISS            -----------------------------------------------MSA----------
RLMF_ECOK1            -----------------------------------------------MSA----------
RLMF_ECO24            -----------------------------------------------MSA----------
RLMF_ECOUT            -----------------------------------------------MSA----------
RLMF_ECOL5            -----------------------------------------------MSA----------
RLMF_ECO81            -----------------------------------------------MSA----------
RLMF_ECO8A            -----------------------------------------------MSA----------
RLMF_ECOLC            -----------------------------------------------MSA----------
RLMF_ECOBW            -----------------------------------------------MSA----------
RLMF_ECOLI            -----------------------------------------------MSA----------
RLMF_ECOHS            -----------------------------------------------MSA----------
RLMF_ECODH            -----------------------------------------------MSA----------
RLMF_SHIDS            -----------------------------------------------MSA----------
RLMF_ECO57            -----------------------------------------------MSA----------
RLMF_ECO5E            -----------------------------------------------MSA----------
RLMF_ESCF3            -----------------------------------------------MSA----------
RLMF_SHIFL            -----------------------------------------------MSA----------
RLMF_SHIF8            -----------------------------------------------MSA----------
RLMF_ECO27            -----------------------------------------------MSA----------
RLMF_ECOL6            -----------------------------------------------MSA----------
RLMF_ECOLU            -----------------------------------------------MSA----------
RLMF_ECO7I            -----------------------------------------------MSA----------
RLMF_ECOSM            -----------------------------------------------MSA----------
RLMF_SALNS            -----------------------------------------------MSA----------
RLMF_SALTY            -----------------------------------------------MSA----------
RLMF_SALG2            -----------------------------------------------MSA----------
RLMF_SALDC            -----------------------------------------------MSA----------
RLMF_SALEP            -----------------------------------------------MSA----------
RLMF_SALSV            -----------------------------------------------MSA----------
RLMF_SALA4            -----------------------------------------------MSA----------
RLMF_SALHS            -----------------------------------------------MSA----------
RLMF_SALPB            -----------------------------------------------MSA----------
RLMF_SALPA            -----------------------------------------------MSA----------
RLMF_SALPK            -----------------------------------------------MSA----------
RLMF_SALAR            -----------------------------------------------MSA----------
RLMF_CITK8            -----------------------------------------------MSA----------
RLMF_KLEP3            -----------------------------------------------MKA----------
RLMF_KLEP7            -----------------------------------------------MKA----------
RLMF_ENT38            -----------------------------------------------MTA----------
RLMF_CROS8            ------------------------------------------------MN----------
RLMF_PECAS            --------------------------------------------MTKPAV----------
RLMF_PECCP            --------------------------------------------MTKPAV----------
RLMF_PSEAE            ------------------------------------MPRPTSPHPDAERK----------
RLMF_PSEA8            ------------------------------------MPRPTSPHPDAERK----------
RLMF_PSEAB            ------------------------------------MPRPTSPHPDAERK----------
RLMF_PSEA7            ------------------------------------MPRPSSPRPDAERK----------
RLMF_AZOVD            ------------------------------------MPSTPRP-PTSPAQ----------
RLMF_PSEP1            -----------------------------------------------MTP----------
RLMF_PSEPK            -----------------------------------------------MTP----------
RLMF_PSEPG            -----------------------------------------------MT-----------
RLMF_PSEPW            -----------------------------------------------MT-----------
RLMF_PSEE4            -----------------------------------------------MT-----------
RLMF_PSEPF            ------------------------MNAPRTPKPARKKPDSATPAKPVEPR----------
RLMF_PSEFS            ------------------------MTAPSTPKPQRKKPKTATTAKPVVPR----------
RLMF_PSEF5            ------------------------MTAPSTPKPSRKKPKPASPAKPATPR----------
RLMF_PSE14            --------------------------MTDTRKPPRKKPQ--RPAKPAAPR----------
RLMF_PSEU2            --------------------------MTDTRKPPRKKPQ--RPAKPAAPR----------
RLMF_PSESM            --------------------------MTDTPKPPRKKPQ--RPAKPAAPR----------
RLMF_PSEMY            ------------------------------MPQPPKRPRKPAPAAVKTAP----------
RLMF_PSEU5            --------------------------------MPRKTSSQPRP-----AE----------
RLMF_DECAR            ------------------------------------------------------------
RLMF_MARMS            -------------------------------------MVLKSKNTKSKRT----------
RLMF_METFK            ------------------------------------------MSQRSLPD----------
RLMF_YERPE            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPA            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPN            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPS            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPB            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERP3            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPY            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPP            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERPG            --------------------------MLSYAPENAYQRASTMENKKVFPK----------
RLMF_YERE8            --------------------------MLSYAPENAYQRLSTMENKKVFPK----------
RLMF_SERP5            --------------------------MVSYVPEIPLREPVTVEKKKSFPQ----------
RLMF_ALIF1            ------------------------------------MTNTKSNVT---------------
RLMF_ALIFM            ------------------------------------MTNIKSNVT---------------
RLMF_PHOPR            ------------------------------------MTQKKNKPTQ--------------
RLMF_VIBCH            -------MNTPLKPKHGQKTNRKPKANKPVVK----KQQTKQPPTHKVQG----------
RLMF_VIBCM            -------MNTPLKPKHGQKTNRKPKANKPVVK----KQQTKQPPTHKVQG----------
RLMF_VIBC3            -------MNTPLKPKHGQKTNQKPKANKPVVK----KQQTKQPPTHKVQG----------
RLMF_VIBCB            ------MKTNNHNAKQAQTKTAKSNPSKEVTKIKPKRVKNKPTAKAAKSTGLKTNAANES
RLMF_VIBPA            ------MKNNSHNAKQAPSKAAKPKHDNDVNKAKPKRVKKKAAVKAKLSA--------EK
RLMF_VIBVU            ------MTNKRKSAKPLEPAKRAPKP----------RTKKSRDLSASESN----------
RLMF_VIBVY            ------MTNKRKSAKPLEPAKRTPKL----------RTKKSRDLSASESS----------
RLMF_AERHH            ------------------------------------MKTHSDRKS---------------
RLMF_AERS4            ------------------------------------MKTHSDRKS---------------
RLMF_BACFR            ------------------------------------MAERNE------------------
RLMF_BACFN            ------------------------------------MAERNE------------------
RLMF_BACTN            ------------------------------------MAERSE------------------
RLMF_CYTH3            ------------------------------------MAEKNKKEHPVT------------
RLMF_SHEDO            --------------------------MSKLISKQGKRPALSQSGLAKPSTSKKSSASKNA
RLMF_SHEFN            ------------------------------MTRSTTPPMRAKHSSAKRSPSRSAAKVNPV
RLMF_SHEAM            -----------------------------------MAPFFSAMTSKKQSQG---------
RLMF_SHEB5            ----------------MSKPAVKSVPSATAKTATRAVNIRQKVKAPKQAKPEAKGRAKPS
RLMF_SHEB8            ----------------MSKPAVKSVQSATAKTATRAVNIRQKVKAPKQAKPEAKGRVRPS
RLMF_SHEB9            ----------------MSKPAVKSVPSATAKTATRAANPRQKAKAPKQAKPEGKGRAKPS
RLMF_SHEB2            ----------------MSKPAVKSVQSATAKTATRAVNIRQKVKAPKQAKPEGKGSTKPV
RLMF_SHEPC            ----------------MPKP-----PRSTQILSCNAPNGKPKTQHPSAR---AKVKRTPV
RLMF_SHESW            ----------------MPKP-----PRSTQILSCNAPNGKPKTQHPSAR---AKVKRTPV
RLMF_SHESM            ----------------MPKPAI----KTAAKPATSSAGKRGKPITPKSVAKPQAAKPKTV
RLMF_SHESR            ----------------MPKPAI----KTAAKPATSSAGKRGKPNTPKSVAKPKTAKPKTA
RLMF_SHESA            ----------------MPKPAI----KTAAKLAMSSAGKRGKPSTPKSLAKPQTTKPKTA
RLMF_SHEON            ----------------MPKPAI----KTAAKPATSPAGKRAKPNTPQSVAKLKASTAKAA
RLMF_SHESH            MTK----------------HSQKQNRQK---QTTQKQTRRKKPAGKLKAKSEAKLDTRGK
RLMF_SHEWM            MTK----------------PSSKASRKP---VTKSGRNSKRSRSGSSKGDAQVARAIN--
RLMF_SHELP            MTPSRKPARPGAKKVVSQEPSAKASRPKPSSQSKSKAQPKAKPESKPQAKSQAKPQAKSK
RLMF_SHEHH            --------------------MSHKTKPSTQERKAGKPSAPKRKVISKSPNSKLKTIVKGQ
RLMF_SHEPA            --------------------MSHKTKSTTQERKAGKSSAPQRQVVSKS--SLQKKVSK--
RLMF_SACD2            ------------------------------------MHKSANSKTRKQ------------
RLMF_PSEA6            -----------------------------MTITTTVKAKTLAVNNKNAPH----------
RLMF_FLAJ1            ------------------------------------------------------------
RLMF_FLAPJ            ------------------------------------------------------------
A4C015_9FLAO          ------------------------------------------------------------
A2U137_9FLAO          ------------------------------------------------------------
C2G565_9SPHI          ------------------------------------------------------------
A0A0A2GZI3_9FLAO      ------------------------------------------------------------
Q26D62_FLABB          ------------------------------------------------------------
RLMF_GRAFK            ------------------------------------------------------------
                                                                                  

RLMF_PSYA2            --------KLGQLHPRNPHQGRYDFVALTHALPELAKHTITNPKGEP-TINFSDSAAVRV
RLMF_PSYCK            --------KLGQLHPRNPHQGRYDFEVLTRALPELAKHTITNPKGES-TINFSDSAAVRV
RLMF_PSYWF            --------AASTLHPRNPHQGRYDFDKLIKALPELEKHAITNPSGEA-TINFSDADAVLT
RLMF_DESPS            --------QSGLLHPRNPHRGRYDLDALCRTCPELKMHIQIKPTGDK-TIDFSDAKAVLC
RLMF_PSYIN            -----------LLHPRNLHRGHYDLKQLCEQSPLLSTFLRTNPKGEQ-TLDFAEPQAVLL
RLMF_PSET1            ------------LHPRNQHLNGYDLDLLTEQHPALSAFIITTPAGTK-SIDFSDNKAVKT
RLMF_COLP3            ------------MHKKNRHNQGYNFTALVKAHPGLLQFIIKNQYNNQDTIDFANPQAVKA
RLMF_SHIBS            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SHIB3            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO55            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO45            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SHISS            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOK1            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO24            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOUT            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOL5            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO81            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO8A            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOLC            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOBW            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOLI            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOHS            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECODH            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SHIDS            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO57            --------QKPGLHPRNRHHSRYDLATLCQVNPELKQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO5E            --------QKPGLHPRNRHHSRYDLATLCQVNPELKQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ESCF3            --------QKPGLHPRNRHHSRYDLATLCQVNPELKQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SHIFL            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SHIF8            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO27            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOL6            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOLU            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECO7I            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_ECOSM            --------QKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQ-SVDFANPLAVKA
RLMF_SALNS            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALTY            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALG2            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALDC            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALEP            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALSV            --------QKSGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALA4            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALHS            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALPB            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALPA            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALPK            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQ-SVDFANPQAVKA
RLMF_SALAR            --------QKPGLHPRNRHQHRYDLAALCQTTPELTSFLTRTPAGEQ-SVDFANPQAVKA
RLMF_CITK8            --------QKPGLHPRNRHHHRYDLATLCQVTPELAQFLTRTPAGEQ-SVDFANPLAVKA
RLMF_KLEP3            --------QKPGLHPRNRHHQRYDLPALCQAHPDLQGYITLNPLGEQ-TIDFANPQAVKA
RLMF_KLEP7            --------QKPGLHPRNRHHQRYDLPALCQAHPDLQGYITLNPLGEQ-TIDFANPQAVKA
RLMF_ENT38            --------EKPGLHPRNRHRSRYDMNALCQSCPQLQAFIVQTPAGEP-SVNFADPLAVKA
RLMF_CROS8            --------RKPGLHPRNRHHSRYDFDALTESCPALGAFVRPSPAGEP-TIDFADPQAVKT
RLMF_PECAS            --------QKSGLHPRNRHRDRYDFPALKQSYPALIPFVKVNAYGDE-SVDFANPEAVKT
RLMF_PECCP            --------QKNGLHPRNRHRDRYDFPTLKHSYPALIPFVTVNAYGDE-SVDFANPEAVKT
RLMF_PSEAE            --------SASPLHPRNRHLGRYDFPRLIAGSPELERFVILNPYGRQ-SIDFADPAAVKA
RLMF_PSEA8            --------SASPLHPRNRHLGRYDFPRLIAGSPELERFVILNPYGRQ-SIDFADPAAVKA
RLMF_PSEAB            --------SASPLHPRNRHLGRYDFPRLIAGSPELERFVILNPYGRQ-SIDFADPAAVKA
RLMF_PSEA7            --------SASPLHPRNRHLGRYDFPGLIAGNPELERFVIVNPYGKP-SIDFADPLAVKA
RLMF_AZOVD            --------DPSPLHPRNRHRGRYDFPALIRRHPALAAFVILNPYGKR-SIDFADPEAVKA
RLMF_PSEP1            --------NKPTLHPRNRHQGRYDFPSLIKAHPDLARFTITNPHGKP-SIDFANPEAVRV
RLMF_PSEPK            --------NKPTLHPRNRHQGRYDFPSLIKAHPDLARFTITNPHGKP-SIDFANPEAVRV
RLMF_PSEPG            --------EKPTLHPRNRHQGRYDFPSLIKAHPDLARFTITNPHGKP-SIDFANPEAVRV
RLMF_PSEPW            --------QKPTLHPRNRHQGRYDFPSLIKAHPDLARFTITNPHGKP-SIDFANPEAVRV
RLMF_PSEE4            --------DKPTLHPRNRHQGRYDFPALIKAHPDLARFTITNPYGKP-SIDFANPEAVRV
RLMF_PSEPF            --------KEASLHPRNRHQGRYDFPALIKTTPELAKFVITNPYGKE-SIDFASPDAVRV
RLMF_PSEFS            --------KEATLHPRNRHTGRYDFQALIKTTPELAQFVIINPYGKE-SIDFASPDAVRV
RLMF_PSEF5            --------EKASLHPRNRHQGRYDFPQLIKSTPELGQFVILNPYGKE-SIDFADPAAVRV
RLMF_PSE14            --------EKATLHPRNRHQGHYDFAKLIKSSPELAAFVILNPYGKE-SIDFADPQAVRV
RLMF_PSEU2            --------EKATLHPRNRHQGQYDFAKLIKSSPELAAFVILNPYGKE-SIDFANPQAVRV
RLMF_PSESM            --------EKATLHPRNRHQGHYDFPKLIKSSPELAAFVILNPYGKE-SIDFANPQAVRV
RLMF_PSEMY            --------AKGELHPRNRHQGRYDFPALIKVSPELGDFVITNPYGKP-SIDFANPAAVKV
RLMF_PSEU5            --------PKAVLHPRNRHSGRYDFPKLIAACPELGEYVILNPYGKQ-SIDFANPDAVRV
RLMF_DECAR            ------------MHPRNKNAEGYDFAALAATSAALAKHIKTTQAGTA-SIDFANPAAVKM
RLMF_MARMS            --------NKLELHPRNPHRARYDFALLADSCPELSGFIQLNQYGNE-SVDFANPNAVKT
RLMF_METFK            --------EKSGLHPRNRHRQRYDFALLVEAHPPLAAFVRLNQYEDA-SIDFADAQAVKT
RLMF_YERPE            --------EKSGLHPRNRHCSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPA            --------EKSGLHPRNRHCSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPN            --------EKSGLHPRNRHCSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPS            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPB            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERP3            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPY            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPP            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SVDFADPLAVKM
RLMF_YERPG            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLTPTAYGDI-SVDFADPLAVKM
RLMF_YERE8            --------EKSGLHPRNRHRSRYDFDALSVSCPELIPFLAPTAYGDI-SIDFASPLAVKM
RLMF_SERP5            --------QKSGLHPRNRHRSRYDFPALIASCPALEPFVKPNAWGDI-SVDFADPAAVKM
RLMF_ALIF1            ---------KKSLHPRNKHTGNYDFPALIKACAELKPFVETNQYGNE-SINFSDPQAVKA
RLMF_ALIFM            ---------KKSLHPRNKHTGNYDFPALIKACAELKPFVETNQYGNE-SINFSDPQAVKA
RLMF_PHOPR            --------KKKGLHPRNPHSQRYDFNALILSCPDLTPFVAENQFGDL-SVDFSDPAAVKM
RLMF_VIBCH            ---EEVAAVKSGLHPRNRHRGQYDFPALIKVVPELQSHVMKNPKGQW-TINFADPISVKL
RLMF_VIBCM            ---EEVAAVKSGLHPRNRHRGQYDFPALIKVVPELQSHVMKNPKGQW-TINFADPISVKL
RLMF_VIBC3            ---EEVAAVKSGLHPRNRHRGQYDFPALIKVVPELQSHVMKNPKGQW-TINFADPIAVKL
RLMF_VIBCB            SDVEVIKTAKSGLHERNAHRGRYDFKKLIAAEPQLKSFVIKNPKGED-SINFSDPKAVKM
RLMF_VIBPA            SDVDFIKIAKSGLHESNAHRGRYDFKKLIASEPALASFVIKNPKGED-SINFSDPNAVKM
RLMF_VIBVU            --CDFVKVTRAGLHSRNKHQGRYDFAKLTQALPSLAPFVIKNPKGEA-SISFSDSTAVKM
RLMF_VIBVY            --CDFVKVTRAGLHSRNKHQGRYDFAKLTQALPSLAPFVIKNPKGEA-SISFSDSTAVKM
RLMF_AERHH            -----------GLHPRNRHQAPYDFDALCQRTPELQPFVFVNEHGTQ-TLDFADPAAVKA
RLMF_AERS4            -----------GLHPRNRHQAPYDFDALCLRTPELRPLVFVNEHGTQ-TLDFADPAAVKA
RLMF_BACFR            ------------LHKRNRHNGQYDFSRLTEEYPPLKKFIVLNAYGTT-SIDFFNPRAVKA
RLMF_BACFN            ------------LHKRNRHNGQYDFSRLTEEYPPLKKFIVLNAYGTT-SIDFFNPRAVKA
RLMF_BACTN            ------------LHTRNKHNGQYDFSLLTENYPPLRKFVLLNPLGIQ-TIDFFNPHAVKA
RLMF_CYTH3            ---------KDRLHPRNKHRERYDFDALIATTPELAQYVTLNIYNDQ-SIDFFNPAAVLC
RLMF_SHEDO            NTETAK-LLTKALHPRNVHKYGYDFAALSKTLPALTPFVGPNAYGNI-SIDFANPDAVKQ
RLMF_SHEFN            SVKPNKPLLSKALHPRNAHLQGYDFATLIIAMPALAAFVRPNPYGNP-SIDFADPKAVKS
RLMF_SHEAM            --------LPKGPHPDNAHRDGYDFSALVASHPPLKPFVRANAYGNL-SIDFALPEAVKA
RLMF_SHEB5            -KDKPRAEIKKALHPRNAHLNGYDFPALYAAFTQLKTFVRPTPYGTL-SIDFADPLAVKT
RLMF_SHEB8            -KDKPRVEIKKALHPRNAHLNGYDFPALISAFPQLKTFVRPTPYGAL-SVDFADPLAVKT
RLMF_SHEB9            -KDKPRAEIKKALHPRNAHLNGYDFPALISAFPRLKTFVRPTPYGAL-SVNFADPLAVKT
RLMF_SHEB2            -KDRPRVEIKKALHPRNAHLNGYDFPALISAFPRLKTFVRPTPYGAL-SIDFADPLAVKT
RLMF_SHEPC            -NTRSIAEIKKALHPRNVHINGYDFNALIKAFPRLNAFVRPTSFGGL-SIDFADPEAVKT
RLMF_SHESW            -NTRSIAEIKKALHPRNVHINGYDFNALIKAFPRLNAFVRPTSFGGL-SIDFADPEAVKT
RLMF_SHESM            SKPKVKPGEKKRLHPRNLHINGYDFPVLMVSYPKLKAFVRPTPYGDL-SIDFADPSAVKT
RLMF_SHESR            SKPKVKPGEKKRLHPRNLHINGYDFPALMASYPKLKAFVRPTPYGAL-SIDFADPLAVKT
RLMF_SHESA            SKLKAKHGEQKRLHPRNLHINGYDFPALMASFPKLKAFVRPTPYGAL-SIDFADPFAVKN
RLMF_SHEON            SKPKAKLGEKKTLHPRNVHLHGYDFVALMASFPKLKAFVRPTAYGAL-SIDFADPLAVKN
RLMF_SHESH            PE----TTEKKGLHERNLHRDGYDFEQLIEASPALKPYVRPNPYGNL-SIDFADPLAVKA
RLMF_SHEWM            -------NQKPGLHPRNLHRDGYDFDKLTKVSPVLTPYVQPNPYGNL-SIDFADPQAVKA
RLMF_SHELP            PVEGKSQGASKGLHPRNLHGQGYDFDALMDTTPELKPFVRPNPYGNL-SIDFADPRAVKL
RLMF_SHEHH            KNTAVKAQTSKPLHPRNVHNKGYDFPALIAAFAALKSFVKPNPYGNL-SIDFADPQAVKM
RLMF_SHEPA            PTATAKLQKSKALHPRNAHNNGYDFAALVTAFPKLKAFVKPNPYGNL-SIDFADPVAVKM
RLMF_SACD2            ---------SKGLHPRNIHRNGYDFDALKACHPPLVQYIKCNPVGAA-TIDFANSAAVKA
RLMF_PSEA6            --------TSATMHPRNVHRNGYPMSALCQSYPTLEAHVIKAKSGQQ-SIDFSKAASVKA
RLMF_FLAJ1            -MKAENNSQKDNLHPRNLHRSRYDFELLISNCPELKAFISINKHGIE-TVDFSNPLAVKT
RLMF_FLAPJ            -MKAKIVPEKTNLHPRNLHKFGYDFEALTTCSSELKNHVFTNEYDTQ-TINFSNPEAVKA
A4C015_9FLAO          -MK------EKNLHPKNKFNTGYNFDALIKINSKLKTFVSKNQFDVI-TIDFSNPEAVKE
A2U137_9FLAO          -MK------NKGLHPDNRFNKGYDFDVLVKQNPILEEFIITNKYNSI-TIDFSNPQAVKE
C2G565_9SPHI          -MKPSPKEIKKTLHSRNKHISGYDFQRLTKKNPALSGFLINNPAGQV-TIDFADPKAVFE
A0A0A2GZI3_9FLAO      ------------MHPDNKNIGPYLFKQLRKVNKDLAPHILETNRGIQ-TIDFSNPKAVLE
Q26D62_FLABB          ------------MHDNNLHKHGYDLDLLSQTYPDLKFHFITKEDGMI-SIDFTNPSSVLA
RLMF_GRAFK            ------------MHPDNIHKDSYDFEALTESNPQLSEFVFQNKYGTQ-TINFANPEAVLQ
                                   *  *     * :  *      *             ::.*    :*  

RLMF_PSYA2            LNQALLAHYYGVKFWDIPEGYLCPPIPGRADYIHYIADLLAQTTHVNKDNTPPTGKE---
RLMF_PSYCK            LNQALLANYYGVKFWDIPEGYLCPPIPGRADYIHYIADLLAQTTHVNKDNTPPTGKE---
RLMF_PSYWF            LNKALLAHHYNIKYWDLPKGYLCPPIPGRADYIHQVADLL------NNNNSGSENKK---
RLMF_DESPS            LNRALLAHYYQVSNWQIPEGYLCPPIPGRADYIHYLADLLA-----EDLPTSAKGKK---
RLMF_PSYIN            LNQVLLKQFYHVDFWQIPKGYLCPPIPGRVDYIHYLADLLGD----TFHGKIPEGKQ---
RLMF_PSET1            LNQALLKAHYNVDFWDIPQHNLCPPIPGRVDYIHYLADLLAD----DNQTQIPTGRQ---
RLMF_COLP3            LNLSLLKSEYHVKFWDIPDGYLCPAIPGRVDYIHHLQDLLAA----TPKTLLPNKTP---
RLMF_SHIBS            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_SHIB3            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO55            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO45            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_SHISS            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOK1            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO24            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOUT            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOL5            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO81            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO8A            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOLC            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOBW            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOLI            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOHS            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECODH            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_SHIDS            LNKALLAHFYAVANWDIPDGFLCPPVPGRADHIHHLADLLAE----A-SGTIPANA----
RLMF_ECO57            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO5E            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ESCF3            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPARA----
RLMF_SHIFL            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_SHIF8            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECO27            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIQANA----
RLMF_ECOL6            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-SGTIPANA----
RLMF_ECOLU            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-TGSIPANA----
RLMF_ECO7I            LNKALLTHFYAVANWDIPDGFLCPPVPGRADYIHYLADLLAE----A-TGSIPANA----
RLMF_ECOSM            LNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAE----A-TGSILANA----
RLMF_SALNS            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALTY            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALG2            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALDC            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALEP            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALSV            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALA4            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALHS            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALPB            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALPA            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALPK            LNKALLAHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGE----T-TGSIPAQA----
RLMF_SALAR            LNKALLAHFYAVTHWDIPQGFLCPPVPGRADYIHHLADLLGE----T-TGSIPVQA----
RLMF_CITK8            LNKALLAYFYQVANWDIPEGFLCPPVPGRADYIHHLADLLGE----T-TGAIPADA----
RLMF_KLEP3            LNKALLAHFYAVKHWDIPDGFLCPPVPGRADYIHHLADLLAQ----D-SGEVPKQA----
RLMF_KLEP7            LNKALLAHFYAVKHWDIPDGFLCPPVPGRADYIHHLADLLAG----D-SGEVPKDA----
RLMF_ENT38            LNKALLAHFYGVTQWDIPEGFLCPPVPGRADYVHHLADLLAE----DNAGTIPPQA----
RLMF_CROS8            LNQALLAHFYGVREWDIPDGFLCPPVPGRADYIHHLADLLAE----GNGGALPAQA----
RLMF_PECAS            LNQALLQHFYQIEHWTIPDGFLCPPIPGRADYVHHLADLLAE----DNRSVVPRDA----
RLMF_PECCP            LNQALLQHFYQIEHWEIPDGFLCPPIPGRADYIHHLADLLAE----DNRAVVPREA----
RLMF_PSEAE            FNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGA----SHDGLIPRGPG---
RLMF_PSEA8            FNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGA----SHDGLIPRGPG---
RLMF_PSEAB            FNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGA----SHDGLIPRGPG---
RLMF_PSEA7            FNRALLQQFYDVREWNIPEGYLCPPIPGRADYLHYLADLLGA----SHDGVIPRGTG---
RLMF_AZOVD            LNRALLAEHYGIRQWDIPPGYLCPPIPGRADYLHGLADLLAA----EHGGIIPRGAA---
RLMF_PSEP1            FNRALLKAQYGIQHWDIPADYLCPPIPGRADYIHVAADLLAD----DNAGDVPRGTQ---
RLMF_PSEPK            FNRALLKAQYGIQHWDIPADYLCPPIPGRADYIHVAADLLAD----DNAGDVPRGAQ---
RLMF_PSEPG            FNRALLKAQYGIQHWDIPADYLCPPIPGRADYIHVAADLLAD----DNAGEVPKGAQ---
RLMF_PSEPW            FNRALLKAQYGIQHWDIPADYLCPPIPGRADYIHVAADLLAE----DNAGEVPKGAQ---
RLMF_PSEE4            FNRALLKAQYGVQHWDIPADYLCPPIPGRADYIHVLADLLAE----DNAGDVPRGAQ---
RLMF_PSEPF            FNRALLKSFYGIQHWDIPADYLCPPVPGRADYIHFLADLLAS----NNDGVVPRGAI---
RLMF_PSEFS            FNRALLKSFYGIQHWDIPADYLCPPVPGRADYVHFLADLLAS----VNDGKIPRGSI---
RLMF_PSEF5            FNRALLKAFYGIAHWDIPADFLCPPVPGRADYVHFLADLLAS----HNQGEIPRGAA---
RLMF_PSE14            FNRALLKAFYGIAHWDIPADYLCPPIPGRADYLHFLADLLAE----DNEGVIPRGAS---
RLMF_PSEU2            FNRALLKAFYGIAHWDIPADYLCPPIPGRADYLHFLADLLAE----DNEGVIPRGAS---
RLMF_PSESM            FNRALLKAFYGIAHWDIPADYLCPPIPGRADYLHFLADVLAE----DHEGVIPRGAS---
RLMF_PSEMY            FNRALLAQYYGIRHWDIPDGYLCPPIPGRADYLHNLADLLAT----DNDGQIPRGAG---
RLMF_PSEU5            FNRALLRQFYGIQHWDIPAGYLCPPVPGRADYLHGLADLLAA----DNAGVIPRGAA---
RLMF_DECAR            LNRAILMHHYGVKGWDIPAGYLCPPIPGRADYIHSVADLLAT----CNKKNIPSGPG---
RLMF_MARMS            LNRALLNHFYGVAFWDIPPGYLCPPIPGRADYIHYLADLLAA----SNLGVIPRGKG---
RLMF_METFK            LNQALLKCYYGIAAWDIPPQFLCPPIPGRADYVHCLADLLAA----GNDGNMPYGGN---
RLMF_YERPE            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPA            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPN            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPS            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPB            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERP3            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPY            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPP            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERPG            LNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLAS----CNGEVIPKGKN---
RLMF_YERE8            LNKALLKHFYGIEYWDIPADFLCPPIPGRADYVHHLADLLAS----CNDGVIPQGKN---
RLMF_SERP5            LNRALLQHFYGIEHWDIPADYLCPPIPGRADYLHHLADLLAT----SNDGEIPRGKG---
RLMF_ALIF1            LNKALLAHFYNVPFWDIPQGYLCPPIPGRADYIHNIADLLAI----TNEGTIPTGKK---
RLMF_ALIFM            LNKALLAHFYNVPFWDIPQGYLCPPIPGRADYIHNIADLLAI----TNEGTIPTGKK---
RLMF_PHOPR            LNKALLHHFYNVENWDIPPGYLCPPIPGRADYIHHIADLLAK----SNEGVIPQGKH---
RLMF_VIBCH            LNKALLVLHYGVTYWDIPEGFLCPPIPGRADYIHRVADLLLK----G-NPQLNH-SQ---
RLMF_VIBCM            LNKALLVLHYGVTYWDIPEGFLCPPIPGRADYIHRVADLLLK----G-NPQLNH-SQ---
RLMF_VIBC3            LNKALLALHYGVTYWDIPEGFLCPPIPGRADYIHRVADLLLK----E-NPKLNP-SQ---
RLMF_VIBCB            LNKALLAAHYDIEYWDIPDTYLCPPIPGRADYVHRVAELLDG----EVKGKYAH-HK---
RLMF_VIBPA            LNKALLAAYYNIDFWDIPEHYLCPPIPGRADYIHRVAELLDG----EVKGKYRH-QN---
RLMF_VIBVU            LNKALLSAYYQVANWDIPAGYLCPPIPGRADYIHRLAELLEG----EVKGKFPH-EK---
RLMF_VIBVY            LNKALLSAHYQVANWDIPAGYLCPPIPGRADYIHRLAELLEG----EVKGTFPH-EK---
RLMF_AERHH            LNKALLALHYGIAHWDLPAGYLCPPIPGRVDYLHRVADLLAE----SAGKVP--------
RLMF_AERS4            LNKALLALHYGIAHWDLPAGYLCPPIPGRVDYLHRVADLLAE----SAGCVP--------
RLMF_BACFR            LNKALLISCYGIRYWDIPKNYLCPPIPGRADYIHYIADLIQP----DISDESTGLKT---
RLMF_BACFN            LNKALLISYYGIRYWDIPKNYLCPPIPGRADYIHYIADLIQP----DISDESTGLKT---
RLMF_BACTN            LNKALLISYYGIRYWDIPRNYLCPPIPGRADYVHYIADLIDP----ERVSNTANEEN---
RLMF_CYTH3            LNQALLKHYYGIDEWNIPEGYLCPPIPGRADYIHNIAALL-----------GTSAND---
RLMF_SHEDO            LNAALLLHHYSIRDWDIPHGYLCPPIPGRVDYLHYLADLLSA----PHKGKA--------
RLMF_SHEFN            LNAALLLSEYHINGWDIPEGYLCPPVPGRVDYLHYIADLLAV----KGKVVK--------
RLMF_SHEAM            LNCALLKHHYGISRWDIPKGFLCPPIPGRVDYLHHLEDLL-------RQTPG--------
RLMF_SHEB5            LNAALLKHHYGIGAWDIPQGALCPPIPGRVDYVHYVADLLAE----GDKSCA--------
RLMF_SHEB8            LNAALLKHHYGIGSWNIPEGALCPPIPGRVDYVHYVADLLAE----GDKSCA--------
RLMF_SHEB9            LNAALLKHHYGIGSWNIPEGALCPPIPGRVDYVHYVADLLAE----GDKSCA--------
RLMF_SHEB2            LNAALLKHHYGIGAWDIPQGALCPPIPGRVDYVHYVADLLAE----GDKSCA--------
RLMF_SHEPC            LNTALLKHHYGIDFWDIPKGALCPPIPGRVDYLHYLADLLAE----GDHHLV--------
RLMF_SHESW            LNTALLKHHYGIDFWDIPKGALCPPIPGRVDYLHYLADLLAE----GDHHLV--------
RLMF_SHESM            LNAALLQHHYGLAFWDIPKGALCPPIPGRVDYLHYLADLLFE----GGKVKR--------
RLMF_SHESR            LNAALLLHHYGLAFWDIPKGALCPPIPGRVDYLHYLADLLFE----GGKVKR--------
RLMF_SHESA            LNAALLKHHYGLAFWDIPKGALCPPIPGRVDYLHYLADLLFE----GAKVKR--------
RLMF_SHEON            LNAALLKQHYQIDFWDIPKGALCPPIPGRVDYVHYLADLLFE----GATAPR--------
RLMF_SHESH            LNLALLQLHYRIEYWDIPAGFLCPPIPGRVDYLHYIADLLAG----IDSDTVGDKAEEQV
RLMF_SHEWM            LNAAILKLDYQIDNWDIPEGFLCPPIPGRVDYLHYIYDLLAG----VEEFE--NKSETEM
RLMF_SHELP            LNLALLRLHYGLSYWDIPEGFLCPPIPGRVDYLHYLADLLAE----STPASKGGKRK---
RLMF_SHEHH            LNAALLKLHYDVEHWDIPAGFLCPPIPGRADYIHYVADLLAV----KKSSKK--------
RLMF_SHEPA            LNAALLKFHYGVGHWDIPDGFLCPPIPGRADYIHHVADLLAV----KKSSKK--------
RLMF_SACD2            LNTALLQHHYKIESWSIPDGALCPPIPGRIDYIHYIAELLGC----PLPSGK--------
RLMF_PSEA6            LNAALLIHYYGLNMWDIPEGYLCPPVPGRADYIHGLADLLAK----DNKGVVPTGNR---
RLMF_FLAJ1            LNKALLQTYYDIQNWDIPKNYLCPPIPGRADYIHYLADLLAE----TNNGKIPEGNS---
RLMF_FLAPJ            LNNALLIAYYNIKNWGIPQDYLCPPIPGRADYLHYIADLLAT----TNNQIIPEGEN---
A4C015_9FLAO          LNKALLFSYDKVTTWDFPKENLCPPIPGRLDYVHYLSDLIST----EKN-----------
A2U137_9FLAO          LNKALLFTYKNISVWDFPDENLCPPIPGRLDYIHHLSDLLGN----EKN-----------
C2G565_9SPHI          LNKTLLLLHYDLQHWEIGKNSLCPPIPGRADYIHYVADLLAK----DHNGNIPRGPQ---
A0A0A2GZI3_9FLAO      LNRAILLNDYSLNWYDIPEGYLAPAIPGRADYILYLKDFLNT------------DKQ---
Q26D62_FLABB          LNSALLKEHYGVNHWELPTDYLSPPIPSRVDYILHLADLVG-------------EKN---
RLMF_GRAFK            LNKALLKFHYQVENWSIPKQYLCPPIPGRADYIHYLNDLLSE----ENI-----QGE---
                      :*  :*     :  : :    *.*.:*.* *::     .:                    

RLMF_PSYA2            -------------------------------IHALDIGTGASAIYPIVGSQSYGWRFTAS
RLMF_PSYCK            -------------------------------IHALDIGTGASAIYPIVGSQSYGWRFTAS
RLMF_PSYWF            -------------------------------PHVLDIGTGASLIYPIIGSQSYGWYFTAT
RLMF_DESPS            -------------------------------IRVLDIGTGANCIYPIIGSQSYGWHFVGT
RLMF_PSYIN            -------------------------------VKVLDIGTGANCIYPILGSQSYGWSFVGT
RLMF_PSET1            -------------------------------VKVLDIGTGANLVYPLTGGHEYNWHFTGT
RLMF_COLP3            -------------------------------INVLDIGTGASCIYPILGQREYDWHFVAS
RLMF_SHIBS            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SHIB3            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO55            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO45            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SHISS            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOK1            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO24            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOUT            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOL5            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO81            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO8A            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOLC            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOBW            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOLI            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOHS            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECODH            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SHIDS            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO57            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO5E            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ESCF3            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SHIFL            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SHIF8            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO27            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOL6            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOLU            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECO7I            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_ECOSM            --------------------------------SILDIGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALNS            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALTY            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALG2            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALDC            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALEP            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALSV            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALA4            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALHS            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALPB            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALPA            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALPK            --------------------------------TILDVGVGANCIYPLIGVHEYGWRFTGS
RLMF_SALAR            --------------------------------NILDVGVGANCIYPLIGAYEYGWRFTGS
RLMF_CITK8            --------------------------------SVLDVGTGANCIYPLIGVHEYGWRFTGS
RLMF_KLEP3            --------------------------------TILDIGTGANLIFPLIGVHEYGWRFTGS
RLMF_KLEP7            --------------------------------TILDIGTGANLIYPLIGAHEYGWRFTGS
RLMF_ENT38            --------------------------------TVLDIGTGANLIYPLIGVAEYGWRFTGS
RLMF_CROS8            --------------------------------SVLDIGVGANCIYPLIGQHEYGWRFTGT
RLMF_PECAS            --------------------------------SVLDVGCGANCVYPLIGHREYGWRFTGS
RLMF_PECCP            --------------------------------SVLDIGCGANCIYPLIGYREYGWRFTGS
RLMF_PSEAE            -------------------------------LRALDVGTGANCIYPLLGHHEYGWRFVGA
RLMF_PSEA8            -------------------------------LRALDVGTGANCIYPLLGHHEYGWRFVGA
RLMF_PSEAB            -------------------------------LRALDVGTGANCIYPLLGHHEYGWRFVGA
RLMF_PSEA7            -------------------------------LRALDVGTGANCIYPLLGHHEYGWRFVGA
RLMF_AZOVD            -------------------------------LRVLDIGVGANCIYPLIGHREYGWRFLGA
RLMF_PSEP1            -------------------------------VRALDVGVGANCIYPLLGHSDYRWRFLGS
RLMF_PSEPK            -------------------------------VRALDIGVGANCIYPLLGYSDYRWRFLGS
RLMF_PSEPG            -------------------------------VRALDIGVGANCIYPLLGHSDYRWRFLGS
RLMF_PSEPW            -------------------------------VRALDIGVGANCIYPLLGHCDYRWRFLGS
RLMF_PSEE4            -------------------------------VRALDIGVGANCIYPLLGHSDYRWRFLGS
RLMF_PSEPF            -------------------------------VNVLDIGMGANCVYPLIGNSEYRWHFLGS
RLMF_PSEFS            -------------------------------VKVLDIGMGANCVYPLIGYMEYRWNFLGS
RLMF_PSEF5            -------------------------------VRVLDVGVGANCIYPLIGYSDYRWQFLGS
RLMF_PSE14            -------------------------------IKALDIGTGANCIYPLLGHSDYGWQFVGS
RLMF_PSEU2            -------------------------------IKALDIGTGANCIYPLLGHSDYGWQFVGS
RLMF_PSESM            -------------------------------VKALDIGTGANCIYPLLGHSDYGWQFVGS
RLMF_PSEMY            -------------------------------IHALDIGVGANCIYPLIGHCEYGWHFIGA
RLMF_PSEU5            -------------------------------VRVLDIGTGANCIYPLIGHREYGWRFTGS
RLMF_DECAR            -------------------------------VRVLDIGVGANMVYPLIGHAEYGWSFLGV
RLMF_MARMS            -------------------------------VKVLDVGVGANCVYPIIGHQEYGWQFVGS
RLMF_METFK            -------------------------------VRVLDIGTGANLVYPIIGQKEYGWHFVGT
RLMF_YERPE            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPA            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPN            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPS            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPB            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERP3            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPY            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPP            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERPG            -------------------------------IALLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_YERE8            -------------------------------VAVLDIGVGANCIYPIIGQREYGWRFTGT
RLMF_SERP5            -------------------------------VAILDVGIGANCIYPIVGLREYGWRFTGS
RLMF_ALIF1            -------------------------------VKGLDVGVGANCVYLIIGNREYQWSFVGS
RLMF_ALIFM            -------------------------------VKGLDVGVGANCVYPIIGNREYQWSFVGS
RLMF_PHOPR            -------------------------------INGLDIGMGANCVYPIIGHRAYGWRFVGS
RLMF_VIBCH            -------------------------------VRALDIGVGANCIYPIVGVTEYGWSWVGS
RLMF_VIBCM            -------------------------------VRALDIGVGANCIYPIVGVTEYGWSWVGS
RLMF_VIBC3            -------------------------------VTALDIGVGANCIYPIVGVTEYGWSWVGS
RLMF_VIBCB            -------------------------------VRALDVGVGANCIYPIVGVTQYGWHYTGS
RLMF_VIBPA            -------------------------------VRALDVGVGANCIYPIVGVTQYGWHYTGS
RLMF_VIBVU            -------------------------------VQALDIGVGANAIYPIIAICDYRWRYTGS
RLMF_VIBVY            -------------------------------VQALDIGVGANAIYPIIAICDYRWRYTGS
RLMF_AERHH            ---------------------------TGKGVRVLDIGVGANCIYPLLGAREYGWRFVGS
RLMF_AERS4            ---------------------------TGKGVRVLDIGVGANCIYPLLGAREYGWRFVGS
RLMF_BACFR            ------------------------AIPNARQYRCLDIGVGANCIYPIIGQTEYGWTFVGS
RLMF_BACFN            ------------------------AVPNTRQYRCLDIGVGANCIYPIIGQTEYGWTFVGS
RLMF_BACTN            ------------------------GDKPKRQCRCLDIGVGANCIYPIIGHVEYGWMFVGS
RLMF_CYTH3            ------------------------VIPVGPAIKCLDIGVGANCVYPIIGNNEYGWSFVGA
RLMF_SHEDO            ----------------------------NRNIRALDIGTGANGIYPLLGIESYSWQFVAS
RLMF_SHEFN            ----------------------------GASIRGLDIGTGANGIYPLLGIQTYGWQFVAS
RLMF_SHEAM            ----------------------------TDGLPLLDIGTGANGIYALLAASRFGRAVVAT
RLMF_SHEB5            ----------------------------MDKARVLDIGTGANGIYPILGCQVYGWQYVAS
RLMF_SHEB8            ----------------------------MDKARVLDIGTGANGIYPILGCQVYGWQYVAS
RLMF_SHEB9            ----------------------------MDKARVLDIGTGANGIYPILGCQVYGWQYVAS
RLMF_SHEB2            ----------------------------ISKARVLDIGTGANGIYPILGSQVYGWQFVAS
RLMF_SHEPC            ----------------------------MDRVSVLDIGTGANGIYPILGCQVFGWHFVAS
RLMF_SHESW            ----------------------------MDRVSVLDIGTGANGIYPILGCQVFGWHFVAS
RLMF_SHESM            ----------------------------AAAIRALDIGTGANGVYAILGHQVYDWQFVAS
RLMF_SHESR            ----------------------------AAAIRALDIGTGANGVYAILGHQVYDWQFVAS
RLMF_SHESA            ----------------------------AAAIHALDIGTGANGVYAILGHQVYDWQFVAS
RLMF_SHEON            ----------------------------VEQVCALDIGTGANGIYAILGQQVYGWQFVAS
RLMF_SHESH            EEIGTRQNVPYASKPESSAPKQRYKSQKRMKINALDIGTGANGIYPILGIQAYGWRFVAS
RLMF_SHEWM            E----GQNVPPVNSHTIKP--------KKMKIKALDIGTGANAIYPLLGIQTYGWRFVAS
RLMF_SHELP            --------LPNVTRAP-----------KGERVVALDIGTGANGIYPLLGHQVYGWRFVAS
RLMF_SHEHH            ------------------------RVPKGPRVKVLDIGTGANVIYPLLGIQSYGWSFVGS
RLMF_SHEPA            ------------------------RIPKGPKVRVLDIGTGANVIYPLLGIQSYGWDFVGS
RLMF_SACD2            --------------------INTANTCTNNAVKMLDVGTGANGIYTLLACAVYGWRCVGS
RLMF_PSEA6            -------------------------------VIGLDIGVGANAIYPIIGSQTYGWDFVGS
RLMF_FLAJ1            -------------------------------VMGLDIGTGANLIYPILGNSIYNWSFVAT
RLMF_FLAPJ            -------------------------------VIGLDIGIGANCIYPIIGNAIYDWSFVGT
A4C015_9FLAO          -------------------------------VKILDIGTGATCIYPLLGVAEYDWSFVAS
A2U137_9FLAO          -------------------------------IKILDIGTGATCIYPLLGVAEYNWSFVAT
C2G565_9SPHI          -------------------------------VKVLDIGTGSSLIYPIIGHQEYKWSFVGT
A0A0A2GZI3_9FLAO      -------------------------------AQGLDVGTGANFIYPLLGGSLFNWKMKGV
Q26D62_FLABB          -------------------------------ITGLDIGTGANMIYPILGTAIYNWKMIGS
RLMF_GRAFK            -------------------------------IRGIDIGVGANAIYPILASRIYDWKMLGT
                                                        :*:* *:. :: : .   :     . 

RLMF_PSYA2            DIDPISVNTAALICETNPKLKSA----VKVKLQPEPKRIFANIIGRQDYFDVVVCNPPFH
RLMF_PSYCK            DIDPISVNTAALICETNPKLKSA----VKVKLQTEPKFIFKNIIGRQDYFDVVVCNPPFH
RLMF_PSYWF            DIDPVSINTAKAICEINPNLKKL----VTVKQQKNPKNIFKGIIGEHDYFDITVCNPPFH
RLMF_DESPS            DIDPLAIKIAGMIVQANSCLNGK----ITLKQQLDKKLIFKGIINE-DKFDLTMCNPPFH
RLMF_PSYIN            DIDPLSVKMAGLIIKSNVSLKPF----IKVQLQANKQAIFAGIIKPKDKFTLTMCNPPFH
RLMF_PSET1            DIDPAAIKVAKQIAQFN---NLK----ITLKQQKNAANIFKGVINSKDLYHLTLCNPPFH
RLMF_COLP3            DVDPISIKVAKHIISSDKSLNRN----INCRLQPNSNQIFNGIIAEDEFYHLTICNPPFH
RLMF_SHIBS            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SHIB3            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO55            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO45            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SHISS            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOK1            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO24            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOUT            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOL5            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO81            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO8A            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOLC            ETSSQALSSAQAIISSNPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOBW            ETSSQALSSAQAIISSNPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOLI            ETSSQALSSAQAIISSNPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOHS            ETSSQALSSAQAIISSNPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECODH            ETSSQALSSAQAIISSNPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SHIDS            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO57            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO5E            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ESCF3            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SHIFL            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SHIF8            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO27            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOL6            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOLU            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECO7I            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_ECOSM            ETSSQALSSAQAIISANPGLNRA----IRLRRQKESGAIFNGIIHKNEQYDATLCNPPFH
RLMF_SALNS            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALTY            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALG2            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALDC            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALEP            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALSV            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALA4            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALHS            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALPB            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALPA            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALPK            EVSDAAMSSAQAIIQANTGLSRA----IRLRRQKDPAAIFTGIIHKNEFYDATLCNPPFH
RLMF_SALAR            EISEAAMSSAQAIIQANTGLSRA----IRLRRQKDSTAIFTGIIHKNEYYDATLCNPPFH
RLMF_CITK8            EVHAQALASAQVIISGNPGLTRS----IRLRRQKDPAAIFNGIIHKNEQYDATLCNPPFH
RLMF_KLEP3            EISPEAFASAQAIVNGNPGLTRQ----IRLRRQKESQAIFHGVIHKNETYDATLCNPPFH
RLMF_KLEP7            EINPQAFASAQAIINGNPGLTRQ----IRLRRQKESQAIFHGVIHKNETYDATLCNPPFH
RLMF_ENT38            ETGKDAYASAQAIVNGNEGLTRA----IRLRRQKEASDIFNGIIHKNESYDATMCNPPFH
RLMF_CROS8            DTSDEAIRSASAIIDANPGLNRA----IRLRRQKSPGAIFNGIIHKNESYDATLCNPPFH
RLMF_PECAS            EVNPLAMKAANETIEANSGLNRS----IRLRRQKNSKAILAGIIHKNDSFDAVMCNPPFH
RLMF_PECCP            EINPIAMKAANQTIEANPGLNRA----IRLRRQKSSTAILAGIIHKNETFDAVMCNPPFH
RLMF_PSEAE            DIDPQSLASAAAILAANPRFAAA----IELRRQPDRRQIFQGLIGVDERFDMTLCNPPFH
RLMF_PSEA8            DIDPQSLASAAAILAANPRFAAA----IELRRQPDRRQIFQGLIGVDERFDMTLCNPPFH
RLMF_PSEAB            DIDPQSLASAAAILAANPRFAAA----IELRRQPDRRQIFQGLIGVDERFDMTLCNPPFH
RLMF_PSEA7            DIDPQSLASAAAILAANPRFAAA----IELRRQPDRRHIFEGLVDSAERFDMTLCNPPFH
RLMF_AZOVD            DIDPIALASAEAIVRANPGLAAA----IRLRRQNDPAHIFQGLLRSDERFDLSLCNPPFH
RLMF_PSEP1            DIDPVALASAKAIVQAN-GLGKA----ITLRQQANRAHILSGLLQEGERFDLTLCNPPFH
RLMF_PSEPK            DIDPVALASAKAIVQAN-GLGKA----ITLRQQANRAHILSGLLQEGERFDLTLCNPPFH
RLMF_PSEPG            DIDPVALASAKAIVQAN-GLGKA----IILRQQANRAHILSGLLQEGERFDLTLCNPPFH
RLMF_PSEPW            DIDPVALASAKAIVQAN-GLSKA----IALRQQNNAKLILGGLLEEDERFDLTLCNPPFH
RLMF_PSEE4            DIDTTALASAKAIVQAN-KLDKA----IGLRQQTQPKHILAGLLQADERFDVTLCNPPFH
RLMF_PSEPF            EIDPTAVAAARAIVQSN-DLNKV----IQLRQQENRKHILIGLLEPGERFDLTMCNPPFH
RLMF_PSEFS            EVDPIAVAAAKAIVQSN-DLSKV----IQLRQQTNPKQILLSLLEPGERFDLTMCNPPFH
RLMF_PSEF5            DIDSTALAAAKAIVQAN-DLNKA----ISLRQQGNPKQILTGLLDSTERFDLTMCNPPFH
RLMF_PSE14            DIDSTAIAAATTIIKAN-GLSKA----ISVRQQDNRKQILLGLLDSSERFHVSLCNPPFH
RLMF_PSEU2            DIDSTAIAAATTIVKAN-GLSKA----ISVRQQANRRQILLGLLDSSERFHVSLCNPPFH
RLMF_PSESM            DIDSTAVAAATAIVKAN-GLHKA----ISVRLQGNRKQILLGLCDSNERFDVSLCNPPFH
RLMF_PSEMY            DIAPAALASARAIVAANPQLAGG----IELRQQANAEQIFLGLLQADERVDLTLCNPPFH
RLMF_PSEU5            DIDATALASARTIVAAN-RLDKV----IELRRQDTSTQLFKGILAADERFELTLCNPPFH
RLMF_DECAR            DIDEAALANAQSIIGKNPELASD----IELRHQPVWDNIFTGLLRSGEVFDLSICNPPFH
RLMF_MARMS            DVNPVAVATCDTIVKSNPCLKGA----ISARLQTQSAKLFDGVWKEKDRFDLTLCNPPFH
RLMF_METFK            DINVEALENAQGIVAANPGLAGA----IELRLQRNVGAVFSGVVQESERFDLTMCNPPFH
RLMF_YERPE            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPA            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPN            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPS            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPB            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERP3            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPY            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPP            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERPG            DIDSHALSAAKMVVSMNPTLKNT----LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFH
RLMF_YERE8            DIDPQALSAAKMVVSMNPTLKNT----LRLKQQKNPQAIFDGILAVNERYDATLCNPPFH
RLMF_SERP5            EIDPVSLNSAKMIVEMNPTLRNS----VRLRLQKQPEFIFNGIIGVAEKFDATLCNPPFH
RLMF_ALIF1            DIDPQSIKMASFIANNNPSLKG-----IECRLQKNEENIFKGIIKPTEFFDFTMCNPPFH
RLMF_ALIFM            DIDPQSIKMASFIANNNPSLKG-----IECRLQKNEENIFKGIIKPTEFFDFTMCNPPFH
RLMF_PHOPR            DVDALSIKSAKFIVESNRSLAGG----IKCRLQKKSDNIFTGIINANDIFDFTMCNPPFH
RLMF_VIBCH            DVDPVSIQQASLIVQSNSKLQGH----IECRLQKNSQHIFNGIIGANERYTVTTCNPPFH
RLMF_VIBCM            DVDPVSIQQASLIVQSNSKLQGH----IECRLQKNSQHIFNGIIGANERYTVTTCNPPFH
RLMF_VIBC3            DVDPVSIQQASLIVQSNSKLQGH----IEFRLQKNSQHIFNGIIGANERYTLTTCNPPFH
RLMF_VIBCB            DVDPKSIESARTIVERNVSLNGK----IELRQQTSESNIYRGIIQPNDRYDITTCNPPFH
RLMF_VIBPA            DVDPKSIDSAANIVERNVALNGK----IELVQQMSESHIYRGVIKPNDRFDVTTCNPPFH
RLMF_VIBVU            DVDPKSIESAQRIADSNPVLQGQ----LELKLQDQSQHIFQGIIGPTDYFHVTTCNPPFH
RLMF_VIBVY            DVDPKSIESAQRIADSNPVLQGQ----LELKLQDQSQHIFQGIIGPTDYFHVTTCNPPFH
RLMF_AERHH            DIDPVSVKAATLLAKSN-GLGSQ----IECRLQGKAGDIFQGIVAQRERFALTLCNPPFH
RLMF_AERS4            DIDPVSVKAAALLAKSN-GLGGQ----IECRHQGNAKHVFRGIISPQERFALTLCNPPFH
RLMF_BACFR            DIDPVSIDNARKIVTCNPALAHK----IELRLQRDSRKIFEGIIAPNEYFDVTLCNPPFH
RLMF_BACFN            DIDPVSIDNARKIVTCNPALAHK----IELRLQRDSRKIFEGIIAPNEYFDVTLCNPPFH
RLMF_BACTN            DIDPVSIENARKIVTCNPVLAHK----IDLRLQKDNRRIFDGIIAPDEYFDVTICNPPFH
RLMF_CYTH3            DVDPVSVASAKNIVDKNKVLQGN----VEIRLQNHPLDIFYGIIGEGERFDVTICNPPFH
RLMF_SHEDO            DIDKVSLDNVDEILAKNPQLAAK----LSLRLQLNPKAIFNGVIEKDEYFDVSLCNPPFH
RLMF_SHEFN            DIDPVSIDNVAKIAQQNEKITAH----LQLRLQPQPEHIFKNIIAADERFDVTLCNPPFH
RLMF_SHEAM            DIAKASLTNVATILKANPGLEKR----ISLRFQSNPRHILTGVTQTNEQFAACVCNPPFH
RLMF_SHEB5            DINAHSLTNVQSIIEQNPVLQGR----ISLRLQPDDKAVFKGVIQAEERFELTLCNPPFH
RLMF_SHEB8            DINAHSLTNVQSIIEQNPVLQGR----ISLRLQPDDKAVFKGVIQAEERFELTLCNPPFH
RLMF_SHEB9            DINAHSLANVQSIIEQNPVLQGR----ISLRLQPDDKAVFKGIIQAEERFELTLCNPPFH
RLMF_SHEB2            DISAHSLTNVQSIIEQNPALQGR----ISLRLQPDDKAVFKGIVQPEERFELTLCNPPFH
RLMF_SHEPC            DINSISLANVQGIIAQNPALHGR----LNLRLQGDESAIFKGVIQPQERFELTLCNPPFH
RLMF_SHESW            DINSISLANVQGIIAQNPALHGR----LNLRLQGDESAIFKGVIQPQERFELTLCNPPFH
RLMF_SHESM            DINPQSLTNVQRIIDNNPSLQGH----LSLRRQQDDKAVFKGIIQASDRFELTLCNPPFH
RLMF_SHESR            DINPQSLTNVQRIIDNNPSLQGH----LSLRRQQDDKAVFKGIIQASDRFELTLCNPPFH
RLMF_SHESA            DINPQSLINVQRIIDNNPSLQGH----LSLRRQQDDKAVFKGIIQASDRFELTLCNPPFH
RLMF_SHEON            DINPQSLANVQRIIDNNSCLQGH----VTLRRQRDENAIFKGIIEAADRFELTLCNPPFH
RLMF_SHESH            DVDPLSIENVNRIVGQNKALQGK----LKTRLQTDHQKVFHGIIQADDRFDITLCNPPFH
RLMF_SHEWM            DVDPISLANVKAIVEGNNCLLGK----LEVRLQNDHQKVFSGIIKPDDRFDITLCNPPFH
RLMF_SHELP            DIDPVSLKNVERIIANNPQLAGK----LSLRLQSDSKQIFTGIIRAEDRFDLTLCNPPFH
RLMF_SHEHH            DVDPLSIANAQQVFASNPAIAAR----FNSRLQTNAKHVFHGVIEPNERFDITLCNPPFH
RLMF_SHEPA            DVDPLSIANAQQIFAGNSDIANK----FSSRLQADSKHVFHGVIEANERFDLTLCNPPFH
RLMF_SACD2            DINSESLANVKAVLANNPTLNAN----ISLRLQPNKDAFFSQIIQTDDYFDVSVCNPPFH
RLMF_PSEA6            DIDDVALKSATTLANNNPKLKPL----LAVRKQHDKAYIFAGIIQPDDHFTFSLCNPPFH
RLMF_FLAJ1            DIYKTSIENASKIIEANPRLIDA----VSLQQQTEPRFIFKNIIIPEDRFTFTMCNPPFH
RLMF_FLAPJ            DIDEKAIQNCKKIIENNPKLIDA----ISLQQQVESRFIFKNIILTDDKFAFTICNPPFH
A4C015_9FLAO          DIDFASLDTAQDIIDDN-NLSAK----IELRKQANESQILKGIIKEEDSFSAVMCNPPFF
A2U137_9FLAO          DIDLDALDTAQDNIDDN-NFTDN----IELRQQFKEEHILKDILEDDDSFSATMCNPPFY
C2G565_9SPHI          DIDSQSLHHAYMNSSKNEALKKS----IVLREQKDKAHVFAGVILPGEKYDLVLCNPPFY
A0A0A2GZI3_9FLAO      DIDPKAVQNANQLLEKNTHLKG----FLSAVYQQQRAQIFEGAILPVEQYDFTMCNPPFY
Q26D62_FLABB          EVDRDSYDFAKSLQEKITMPKSRKISNIKLRFQEDRGSILKNIIKPQELYDFTMCNPPFY
RLMF_GRAFK            DIEEKSVAIAQANIETNPTIAK----NIEIRHQEDRGSIFKGMIKKGEYYHFSICNPPFH
                      :    :                     .    *     .        :      *****.

RLMF_PSYA2            ASLEEAMEANSRKQHNLQRHRGKNENEQI------SRSSTKSGNAAQNLNFGGQHKELWS
RLMF_PSYCK            ASLEEAMEANSRKQHNLQRHRGKNENEQI------SRSSTKPGNAAQNLNFGGQHKELWS
RLMF_PSYWF            GSMQDVLDANNRKQSKLQKNRARRNP---------NGQANKFADAKNNLNFGGQNAELWT
RLMF_DESPS            ASLAEAEAGNQRKRKNLGHG--------------------KENRAQEKLNFGGQNAELWC
RLMF_PSYIN            ASMEKALAGSARKIKNLSND---------------------QNNLSRVLNFAGQEGELCC
RLMF_PSET1            ASSEDAVKGSERKWKNLGKA------------------------PSSTLNFGGQNNELWC
RLMF_COLP3            SSLAEASKGTARKIKNLNKG------------------NHSSKNQDKTLNFGGQKAELWC
RLMF_SHIBS            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SHIB3            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO55            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO45            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SHISS            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOK1            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO24            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOUT            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOL5            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO81            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO8A            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOLC            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOBW            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOLI            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOHS            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECODH            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SHIDS            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO57            DSAAAARAGSECKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO5E            DSAAAARAGSECKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ESCF3            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SHIFL            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SHIF8            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECO27            DSATAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOL6            NSATAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOLU            DSAAAARAGSERKRRNLGLNK------------------------DDVLNFGGQQQELWC
RLMF_ECO7I            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_ECOSM            DSAAAARAGSERKRRNLGLNK------------------------DDALNFGGQQQELWC
RLMF_SALNS            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALTY            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALG2            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALDC            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALEP            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALSV            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALA4            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALHS            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALPB            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALPA            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALPK            DSAAAARAGSERKRRNLGQNK------------------------DDALNFGGQQQELWC
RLMF_SALAR            DSAAAARAGSERKRRNLGQKR------------------------DDVLNFGGQQQELCC
RLMF_CITK8            DSAASARAGSERKRRNLGQDK------------------------NDALNFGGQQQELWC
RLMF_KLEP3            DSAESARAGGERKRRNLGLGA------------------------DSALNFGGQQQELWC
RLMF_KLEP7            DSAESARAGGERKRRNLGLGA------------------------ESGLNFGGQQQELWC
RLMF_ENT38            DSAETARAGSERKRRNLGQAE------------------------DGALNFGGQQHELWC
RLMF_CROS8            DSADAAEAGNARKRRNLGLAA------------------------DSGLNFGGQQQELWC
RLMF_PECAS            ASAEDAREGSQRKLHNLGLDK------------------------RSPLNFGGQQDELWC
RLMF_PECCP            ASAEDARQGSQRKLHNLGLDK------------------------RSPLNFGGQQDELWC
RLMF_PSEAE            ASLDEATRGSRRKWKNLGKLD---PTR-----------------TLPLLNFGGQGAELYC
RLMF_PSEA8            ASLDEATRGSRRKWKNLGKLD---PTR-----------------TLPLLNFGGQGAELYC
RLMF_PSEAB            ASLDEATRGSRRKWKNLGKLD---PTR-----------------TLPLLNFGGQGAELYC
RLMF_PSEA7            ASLDEATRGSRRKWKNLGKLD---PGR-----------------TLPLLNFGGQGAELHC
RLMF_AZOVD            ASPEEAVRGSRRKWRNLGKLD---PRR-----------------KLPLLNFGGQGAELYC
RLMF_PSEP1            ASRDEATRGSQRKWKNLGKQD---PKR-----------------KLPVLNFGGQNNELWC
RLMF_PSEPK            ASRDEATRGSQRKWKNLGKQD---PKR-----------------KLPVLNFGGQNNELWC
RLMF_PSEPG            ASRDEATRGSQRKWKNLGKQD---PKR-----------------KLPVLNFGGQNNELWC
RLMF_PSEPW            ASREEATRGSQRKWKNLGKQD---PKR-----------------KLPVLNFGGQNNELWC
RLMF_PSEE4            ASREEATRGSQRKWKNLGKQD---PKR-----------------KLPVLNFGGQNNELWC
RLMF_PSEPF            ASMEEATKGSERKWRALGKAD---PKR-----------------KLPVLNFGGQSAELWC
RLMF_PSEFS            ASMDEATKGSERKWRALGKAD---PKR-----------------KLPVLNFGGQSAELWC
RLMF_PSEF5            ASLDEATRGSQRKWRALGKAD---PKR-----------------KLPVLNFGGQARELWC
RLMF_PSE14            ASLDEAQRGSQRKWRALGKAD---PKR-----------------KLPVLNFGGQSQELWC
RLMF_PSEU2            ASLEEAQRGSQRKWRALGKAD---PKR-----------------KLPVLNFGGQSQELWC
RLMF_PSESM            ASLDEAQRGSQRKWRALGKAD---PKR-----------------KLPVLNFGGQSQELWC
RLMF_PSEMY            ASADEATRGSTRKWRNLGKLD---PRR-----------------KLPVLNFGGQAAELWC
RLMF_PSEU5            ASQAEAASGSQRKWRNLGKLD---PSR-----------------KLPKLNFGGQAAELWC
RLMF_DECAR            NSPDDVHAVSQRKWNNLNKPG---AKRGA---------------AEPRLNFGGGGSELWC
RLMF_MARMS            TSESAMIDESQRKWRGVKGKK-TTTQKPV-------------------LNFGGTAAELWC
RLMF_METFK            ASQAAAMAGTERKWHHLERSRGKPTGKGVRR----VR---SGRMSGNRLNFGGQAAELYC
RLMF_YERPE            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPA            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPN            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPS            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPB            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERP3            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPY            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPP            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERPG            GSAEEAAATTRRKLHKLGKNE--VAAKPV-------------------QNFGGKNSELWC
RLMF_YERE8            GSAEEAAATTRRKLHKLGKSE--VAAKPV-------------------QNFGGKNSELWC
RLMF_SERP5            GSEQEAQASTRRKLHKLGKGE--VADKPV-------------------QNFGGKNNELWC
RLMF_ALIF1            ASEAEATAGTERKQKNLAANKAKKGHA------------FQEMQNAKALNFGGQKAELWC
RLMF_ALIFM            ASEAEATAGTERKQKNLAANKAKKGHS------------FQEMQNAKALNFGGQKAELWC
RLMF_PHOPR            ASLEEATAGSERKVRNLSANAHKKGSNKKAE----L--FAKSNTNKPVLNFGGQKAELWC
RLMF_VIBCH            ASLADAQQGTQRKLTNLQANQRKKGRLAT------------PTLSHSRLNFGGQKAELWC
RLMF_VIBCM            ASLADAQQGTQRKLTNLQANQRKKGRLAT------------PTLSHSRLNFGGQKAELWC
RLMF_VIBC3            ASLADAQQGTQRKLTNLQANQRKKGRLAT------------PTLSHSRLNFGGQKAELWC
RLMF_VIBCB            RSAEEAAMGSQRKLDNLKANQRKKGVKVQAH----QAKTPQVKANKPALNFGGQNAELWC
RLMF_VIBPA            RSAEDAAMGSQRKLDNLKANQRKKGVKQQ---------NSPVKQGKPTLNFGGQNAELWC
RLMF_VIBVU            ASAQEAAFGTQRKLDNLAANRLKKGVTAKAG-------SQKISKNKPILNFGGQNSELWC
RLMF_VIBVY            ASAQEAAFGTQRKLDNLAANRLKKGVTAKAG-------SQKISKNKPILNFGGQNSELWC
RLMF_AERHH            ASLAEASKGTERKLRNLGKEATAKP----------------------VLNFGGQKAELWC
RLMF_AERS4            GSLDEASKGSERK---LGKTVQGQP----------------------VLNFGGQKAELWC
RLMF_BACFR            SSKEEAEDGTLRKLSSLKGKKVTKA----------------------RLNFGGNANELWC
RLMF_BACFN            SSKEEAEDGTLRKLSSLKGKKVTKA----------------------QLNFGGNANELWC
RLMF_BACTN            SSKKEAEEGTLRKLSSLKGEKVKKT----------------------KLNFGGNANELWC
RLMF_CYTH3            ASAEDAAAGTLRKLSNLQHKKVTKA----------------------NLNFGGQHNELWC
RLMF_SHEDO            RSLADANAGTQRKLSNLAKNRGQSQ-------QQ------AVQ-AKVALNFGGQKAELWC
RLMF_SHEFN            SSLAEASEGSLRKVKNLAKNQQQKH-------GQQSRKLAVSQ-AKPTLNFGGQKAELWC
RLMF_SHEAM            ASAAEAALGTNRKLEGLAKSRGQRH-------IS------GPG-KPQTLNFGGQDAELWC
RLMF_SHEB5            ASMAEASEGTKRKVNNLQLNRGSSV-------KAA-----------PKLNFGGQAAELWC
RLMF_SHEB8            ASMAEASEGTKRKVNNLQLNRGSSV-------KAA-----------PKLNFGGQAAELWC
RLMF_SHEB9            ASMAEASEGTKRKVNNLQLNRGSSV-------KAA-----------PKLNFGGQAAELWC
RLMF_SHEB2            ASMAEASEGTKRKVNNLQLNRGSSV-------KAA-----------PKLNFGGQAAELWC
RLMF_SHEPC            ASLAEAAEGSLRKVRNLQLNRGRTA-------KPV-----------AKLNFGGQGAELWC
RLMF_SHESW            ASLAEAAEGSLRKVRNLQLNRGRTA-------KPV-----------AKLNFGGQGAELWC
RLMF_SHESM            GSLKEASQGSLRKVRNLQLNRGEQP-------KATS----------ATLNFGGQAAELWC
RLMF_SHESR            GSLKEASEGSLRKVRNLQLNRGEQP-------KATS----------ATLNFGGQAAELWC
RLMF_SHESA            GSLKEASEGSLRKVRNLQLNRGEQP-------KATS----------ATLNFGGQAAELWC
RLMF_SHEON            ASLREASEGSQRKVRNLQLSRGEKP-------KATG----------ASLNFGGQAAELWC
RLMF_SHESH            ASLSEASEGSLRKVKNLAANRAAKG-------HKPEPAASKAKPDANELNFGGQKAELWC
RLMF_SHEWM            ASLKEASEGSQRKLKNLAENRASKG-------HKLEPKAPK---DKSQLNFGGQKAELWC
RLMF_SHELP            ASLAEASRGSERKLKNLAANKRAKG-------HEVAKSKEK-------LNFGGQKAELWC
RLMF_SHEHH            ASLAEASEGTARKLKNLAANRAKSS-----EAKPLRSTKPVVTKTETPLNFGGQKAELWC
RLMF_SHEPA            ASLAEASEGTARKLKNLAANRAKSSQVMSPQVQPSGKVKPATDKNHGVLNFGGQKAELWC
RLMF_SACD2            ASQEEASKGTNRKLHNLARSRNKAH-------TAKQ----------PSLNFGGQHAELWC
RLMF_PSEA6            KSAEEAAMGSLRKVKGLGRNKQKSNN-----------TGNAQPITANKLNFAGQSNELWC
RLMF_FLAJ1            ASAEEANKSTSRKVSNLNPKEKKNT--------------------NPVLNFGGQNAELWC
RLMF_FLAPJ            NSAAEATKSSARKVNNL--QEIRTK--------------------NPVLNFGGQNTELWC
A4C015_9FLAO          KSAEEAQGANKRKNKNLGNN--------------------------TVRNFSGNNNELWY
A2U137_9FLAO          KSAEEAQGANKRKSRNLGNN--------------------------AVRNFSGNNNELWY
C2G565_9SPHI          GSREENWKSTTRKFQNVNKNKEA----------------------LPVQNFGGNANELWY
A0A0A2GZI3_9FLAO      SSEKEAFKATKEKSKNLKLKEV-------------------------ERNFAGQSNELWC
Q26D62_FLABB          NSEDEAIKANLRKNKNLGNSVS-------------------------ERNFAGKSHELWC
RLMF_GRAFK            ASQEEANKATSRKFKNLGLEKGS------------------------ALNFGGQANELWC
                       *          *   :                                **.*   **  

RLMF_PSYA2            EGGEIAFLTKMAKESQDFAEHVGWFTTLVSKSENVKPMQLLLKQLGVAQMRIIEMSQGQK
RLMF_PSYCK            EGGEIAFLTKMAKESQDFAEHVGWFTTLVSKSENVKPLQLLLKQLGVAQMRIIEMSQGQK
RLMF_PSYWF            EGGEFSFISRMINESVGYAQQVNWFTTLVSRAENLKPLDALLRKVGARQIKTINMQHGQK
RLMF_DESPS            PGGEIVFLRQMAEESVAFAKQVRWFSSLLSKGKNVAPLKKLLKQLGCKRIKVVEMAQGQK
RLMF_PSYIN            AGGEIRFLKQMIQESKDYARQVCWFTSLVSKSDNIAPLKQQLEKVGAEHVKVIKMAQGQK
RLMF_PSET1            EGGEVQFISNMIKESAAVAEQVMWFTSLVSKKDNIAALEQELKQHPIAQYKIVDMAQGQK
RLMF_COLP3            PGGELAFIGKMIKESKAYQKQVLWFTCLVSKKDHLSKLKLSLKKSDAKQIKVIDMAQGQK
RLMF_SHIBS            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_SHIB3            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO55            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO45            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_SHISS            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOK1            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO24            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOUT            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOL5            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO81            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO8A            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOLC            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOBW            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOLI            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOHS            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECODH            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_SHIDS            EGGEVTFIKKMIEESKGFAKQMMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO57            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO5E            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ESCF3            EGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_SHIFL            EGGEVNFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_SHIF8            EGGEVNFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO27            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOL6            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOLU            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECO7I            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_ECOSM            EGGEVAFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRVLTEVGAVKVVKKEMAQGQK
RLMF_SALNS            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALTY            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALG2            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALDC            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALEP            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALSV            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALA4            EGGEVAFIKKMIAESQSFRRQVLWFTTLVSRGENLPPLYRALAEAGAVKVVKKEMAQGQK
RLMF_SALHS            EGGEVAFIKKMIAESQTFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALPB            EGGEVAFIKKMIAESQTFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALPA            EGGEVAFIKKMIAESQTFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALPK            EGGEVAFIKKMIAESQTFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQK
RLMF_SALAR            EGGEVTFIKKMIAESQTFRRQVLWFTTLVSRGENLPPLYRALTEVGAVKVVKKEMAQGQK
RLMF_CITK8            EGGEVAFIKTMIAESQAFGRQVMWFTTLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQK
RLMF_KLEP3            EGGEVAFISQMIRESQAFARQVKWFTSLVSRGDNLPPLYRLLTKVGAVKVVKKEMAQGQK
RLMF_KLEP7            EGGEVAFISQMIRESQAFARQVKWFTSLVSRGDNLPPLYRLLTEVGAVKVVKKEMAQGQK
RLMF_ENT38            EGGEVAFIEKMIAESKLFARQVKWFTTLVSRGDNLPPLYRALTAVGAVKVVKKEMAQGQK
RLMF_CROS8            EGGEVGFITQMIAESKLFARQVLWFTTLVSKGDNLPLLYRALEQAGAVKVVKKEMAQGQK
RLMF_PECAS            EGGELAFIGQMIKDSVSFGRQCLWFTSLVSRKEHLPEIYRALEAVDAEKVRTIDMAQGQK
RLMF_PECCP            EGGESAFIGQMIKESAGFARQCLWFTSLVSRKENLPEIYRALEAVDAEKVRTIDMAQGQK
RLMF_PSEAE            EGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQK
RLMF_PSEA8            EGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQK
RLMF_PSEAB            EGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQK
RLMF_PSEA7            EGGEAAFLASMAGESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQK
RLMF_AZOVD            PGGEAAFVARMIAESAQFAGQVCWFSSLISKTANLPAARAALQRAGAREVRVVPMAQGQK
RLMF_PSEP1            EGGEIRFVTQLIGESVQYAERVLWFTSLVSKASNLPGIEAALKKSGAKAVRIIEMGQGQK
RLMF_PSEPK            EGGEIRFVTQLIGESVQYAERVLWFTSLVSKASNLPGIEAALKKSGAKAVRIIEMGQGQK
RLMF_PSEPG            EGGEIRFVSQLVGESVQYAERVLWFTSLVSKASNLPGIEAALKKAGAKAVRIIEMGQGQK
RLMF_PSEPW            EGGEIRFVSQLVGESLQYAVQVLWFTSLVSKASNLPGIEAALKKAGVKAVRIVEMGQGQK
RLMF_PSEE4            EGGEIRFVSQLVGESVQYAEQVLWFTSLVSKASNLPGIEAALKKAGVKALRIVEMGQGQK
RLMF_PSEPF            EGGEARFVTQLIAESANFAHKVLWFSTLVSKASNLPAIETALKKAGALESQVVEMSQGQK
RLMF_PSEFS            EGGEARFVTQLIAESAHFAHKVLWFSTLVSKASNLPAIETALKKAGVLESQVVEMSQGQK
RLMF_PSEF5            EGGEIRFVSQLISESASVGQQVLWFSTLVSKASNLPAIESALKKAGALESQVVEMSQGQK
RLMF_PSE14            EGGEIGFVTRLIQESATLPSQVVWFSTLVSKASNLPPIQNALKKAGALEVKVIEMGQGQK
RLMF_PSEU2            DGGEIGFITQLIQESALLPSQVAWFSTLVSKASNLPPIHSALKKAGALEVKVVEMGQGQK
RLMF_PSESM            EGGEIGFVTQLIQESARLPGLVVWFSTLVSKASNLPPIQSALKKAGALEVKVVEMGQGQK
RLMF_PSEMY            PGGEAAFLKRMASESAQVAGQVLWFSSLVSKGSNVELLQGWLAKAGAAEVRILGMSQGQK
RLMF_PSEU5            EGGEAAFVARMADESVAYAKQVYRFSTLVSKGGNVAPLMVRLQRLGALQVQALDMAQGQK
RLMF_DECAR            NGGERAFVKRMIEQSCNIPKRVMWFTSLLSQGDNLPHIEAALKKAKVVESRIIPMAQGQK
RLMF_MARMS            DGGEAGFVSRMVKESVQYADRCFWFTSLVARQGNLDAIYRTLKDVGARQVKTIEMAQGQK
RLMF_METFK            EGGEEGFISRMIKESAAVGAQCLWFTTLVSKAATLPAVYRSLRAVDAYKVKTIDMAQGQK
RLMF_YERPE            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPA            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPN            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPS            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPB            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERP3            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPY            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPP            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERPG            EGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQK
RLMF_YERE8            EGGEEGFVSRMVAESATKAQNCFWFTSLISKKTTLPAIYHALRYANAVEVRTIDMAQGQK
RLMF_SERP5            EGGEEAFVRKMVEESVSKAQNCLWFTSLISKHTTLPSIYHAAKLAGVAEVRTIEMAQGQK
RLMF_ALIF1            EGGELAFILKMAQQSREFSLQVQWFTTLISKKENVAELYKELEKIGVKTIKTIEMAQGQK
RLMF_ALIFM            EGGELAFILKMAQQSREFSLQVQWFTTLISKKENVAELYKELEKIGVKTIKTIEMAQGQK
RLMF_PHOPR            PGGEDAFIQRMITESSDKPENCFWYSTLVSKKENLPALYKALKQVNAVDVRTIDMAQGQK
RLMF_VIBCH            PGGEAAFIGKMAVESQQFAQQVLWFRTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQK
RLMF_VIBCM            PGGEAAFIGKMAVESQQFAQQVLWFSTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQK
RLMF_VIBC3            PGGEAAFIGKMAVESQQFAQQVLWFSTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQK
RLMF_VIBCB            EGGEAAFIRKMANESQAFSAQVLWFTTLISKKDNVRPMRKQLEKLGVKAIRIVEMSQGQK
RLMF_VIBPA            EGGEAAFIRRMANESQAFSSQVLWFTTLISKKDNVRPMRKQLEKLGVKAIRVVEMSQGQK
RLMF_VIBVU            QGGESSFLKRMANESERFAHQVLWFSTLVSKKDNVRPLRKQLEKLGVRSIRVVEMSQGQK
RLMF_VIBVY            QGGESSFLKRMANESERFAHQVLWFSTLVSKKDNVRPLRKQLEKLGVRSIRVVEMSQGQK
RLMF_AERHH            EGGEAAFLASMITQSKAFASQCLWFSSLVSKKENLPAAKQGLSRIGARQVRVLEMAQGNK
RLMF_AERS4            EGGEAGFLATMIVQSKEFAAQCLWFSSLVSKKENLPAAKKALAQVGARQVRVIDMAQGNK
RLMF_BACFR            EGGELRFLLTMIEESRNYRKNCGWFTSLVSKEKNLGKLTAKLKSTDIAEHRIIEMHQGTK
RLMF_BACFN            EGGEFRFLLTMIEESRNYRKNCGWFTSLVSKEKNLGKLTAKLKSTDIAEHRIIEMHQGTK
RLMF_BACTN            EGGELRFLLNMISESRKYRKNCGWFTSLVSKEKNLDKLYAKLKAVHVSEYKIIRMCQGTK
RLMF_CYTH3            EGGESAFVREMILESKKFAASCLWFSTLISKQTNLQKAYDQLEVLAPFDVRTIPMGQGNK
RLMF_SHEDO            EGGEAAFLANMISESKGFAAQCLWFTSLVSKSENLKPCYAQLAKQGTSEVKTIEMHQGNK
RLMF_SHEFN            QGGEQQFLANMIKQSRDYANQVLWFTSLVSKSDNLKPCYQLLKQLNAVEVKTIEMTQGNK
RLMF_SHEAM            DGGERSFLLRLIDESARLPDLCVWFTTLVSKSDNLRPCKRRLEQRGASEIKVIEMQQGQK
RLMF_SHEB5            QGGERQFLATMIRESQMFADQCLWFTSLVSKQENLKPCYQALAQLNVDTVKTIEMQQGNK
RLMF_SHEB8            QGGERQFLATMIRESQMFADQCLWFTSLVSKQENLKPCYQALAQLNVDTVKTIEMQQGNK
RLMF_SHEB9            QGGEGQFLATMIRESQMFADQCLWFTSLVSKQENLKPCYQALAQLNVDTVKTIEMQQGNK
RLMF_SHEB2            QGGERQFLATMIRESQMFADQCLWFTSLVSKQENLKPCYQALAQLKVDTVKTIEMQQGNK
RLMF_SHEPC            QGGEPQFLATMIDESQAFADQCLWFTSLVSKKENLKPCYQALAKLAVDTVKTIEMQQGNK
RLMF_SHESW            QGGEPQFLATMIDESQAFADQCLWFTSLVSKKENLKPCYQALAKLAVDTVKTIEMQQGNK
RLMF_SHESM            QGGEKQFLATMIRESQAFAEQCLWFTSLVSKQENLKPCYQALEKLGVDTVKTIEMQQGNK
RLMF_SHESR            QGGEKQFLATMIRESQAFAEQCLWFTSLVSKQENLKPCYQALEKLGVDTVKTIEMQQGNK
RLMF_SHESA            QGGEKQFLATMIRESQAFAEQCLWFTSLVSKQENLKPCYQALEKLGVDTVKTIEMQQGNK
RLMF_SHEON            QGGEKQFLATMIRESHMFAEQCLWFTSLVSKQENLKPCYQALAKLGVDTVKTIEMQQGNK
RLMF_SHESH            EGGEKQFLANMIRESKDFATQCLWFTSLVSKKENLQPCYAALEKVGAVTVKTIDMAQGNK
RLMF_SHEWM            EGGEKQFLHNMICESKVFATQCLWFTSLVSKKENLEACYTELKRVGAITVKTIDMAQGNK
RLMF_SHELP            EGGEQAFLGQMIRESQKFGSQCLWFTSLVSKKENLKPCYRLLEQVGAKRVETLEMAQGNK
RLMF_SHEHH            EGGELQFLQTMISESHEFASQCLWFTTLVSKKENLKPAKALLAKVKAEEVKEMEMHQGNK
RLMF_SHEPA            EGGELQFLRTMIEESHDFASQCLWFTTLVSKKENLNPAKALLAKIKAEEVKEIEMHQGNK
RLMF_SACD2            NGGERLFLKKMIKESQAFAQQVGWFTSLVSKSENVQPALKLIRKLGATEVREIEMMQGNK
RLMF_PSEA6            DGGELAFIQRMIKESVEYQSQVGWFTCLVSKSLHLKAIETSARYFGAKQFMKVDMGQGQK
RLMF_FLAJ1            NGGEIGFITQMIYESVKYASQVLWFTTLVSKKENLSSIYKTLKKVNAVSVKTIEMSQGQK
RLMF_FLAPJ            DGGEIGFITQMIYESAKYPMQVLWFTTLVSKRENLSSIYKTLNKVSAVEIKTIDMAQGQK
A4C015_9FLAO          IGGEKAFLHNYLYESSLYKEKSKWFTSLVSKKENIESLQKSSAKLGALEFKVIPMTQGNK
A2U137_9FLAO          VGGEKAFLHTYLYESSLQPKKSKWFTSLVSKKENVESLKASSQKLGVTEFKTIPMQQGNK
C2G565_9SPHI          EGGEKAFIRTMIYESMDYKAQLGWCTTLVANKDNLKPLVAVLEFKKAKDIEIIKMEQGNK
A0A0A2GZI3_9FLAO      NGGEALFIKRMVKESVHFKDQVGWFTTLVSKSEHLPKIRKQLEKLKA-EHKTVDMSQGNK
Q26D62_FLABB          NGGEALFVKRLIKESVAYQSQVGWFTSLISRKENLPKLEKQLTKLKA-TYKIVPMNSGNK
RLMF_GRAFK            NGGEALFIKRMIKESVLFKSQVGYFTSLVSKKENLPKIYKHLNKLKA-DFKTIEMGQGNK
                       ***  *:     :*            *::.   :                   *  * *

RLMF_PSYA2            STRILAWRFNTDEE---------------------------------------
RLMF_PSYCK            STRILAWRFNTDEE---------------------------------------
RLMF_PSYWF            ASRILAWRFK-------------------------------------------
RLMF_DESPS            ISRFIAWSFSQE-----------------------------------------
RLMF_PSYIN            VSRFIAWSFLPQPQNF-------------------------------------
RLMF_PSET1            VSRFIAWSYFDKATREQICEELE------------------------------
RLMF_COLP3            ISRFIAWSFYDVN----------------------------------------
RLMF_SHIBS            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SHIB3            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO55            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO45            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SHISS            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOK1            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO24            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOUT            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOL5            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO81            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO8A            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOLC            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOBW            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOLI            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOHS            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECODH            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SHIDS            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO57            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO5E            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ESCF3            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SHIFL            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SHIF8            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO27            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOL6            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOLU            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECO7I            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_ECOSM            QSRFIAWTFMNDEQRRRFVNRQR------------------------------
RLMF_SALNS            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALTY            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALG2            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALDC            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALEP            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALSV            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALA4            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALHS            QSRFIAWTFMGDDQRRRFITRKR------------------------------
RLMF_SALPB            QSRFIAWTFMGDDQRRRFITRKR------------------------------
RLMF_SALPA            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALPK            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_SALAR            QSRFIAWTFMDDDQRRRFITRKR------------------------------
RLMF_CITK8            QSRFIAWTFMDDDQRRRFMARKR------------------------------
RLMF_KLEP3            QSRFIAWSFMDDAKRRRPF----------------------------------
RLMF_KLEP7            QSRFIAWSFMDDAKRRRPF----------------------------------
RLMF_ENT38            QSRFIAWTFMDDAKRRKSF----------------------------------
RLMF_CROS8            QSRFIAWSFLDTAQRERWAQNRLR-----------------------------
RLMF_PECAS            QSRFVAWSFLDTAARARWLQKR-------------------------------
RLMF_PECCP            QSRFVAWSFLDTAARTRWLQKR-------------------------------
RLMF_PSEAE            QSRFVAWTYLDKKQRRAWRKERWTAALLEPLGE--------------------
RLMF_PSEA8            QSRFVAWTYLDKKQRRAWRKERWTAALLEPLGE--------------------
RLMF_PSEAB            QSRFVAWTYLDKKQRRAWRKERWTAALLEPLGE--------------------
RLMF_PSEA7            QSRFVAWTYLDKKQRRAWRRERWSAAV--PLGE--------------------
RLMF_AZOVD            QSRFVAWTFLDDAARRHWREERRKTPRRETARD--------------------
RLMF_PSEP1            QSRMVAWSFHDDAARQAWHAQRKSQA---------------------------
RLMF_PSEPK            QSRMVAWSFLDDAARQAWHAQRKSQA---------------------------
RLMF_PSEPG            QSRMVAWSFHDAAARLAWHAQRKSQA---------------------------
RLMF_PSEPW            QSRMVAWSFHDHSQRQAWNERRKSQA---------------------------
RLMF_PSEE4            QSRMVAWSFHDDAARQAWHARRKSQA---------------------------
RLMF_PSEPF            QSRFVAWTFQTKSEQQIWRRERWVRK---------------------------
RLMF_PSEFS            QSRFVAWTFQTKNEQQIWR-QRWVRD---------------------------
RLMF_PSEF5            QSRFVAWTFKDKAQQQAWSQERWMRKN--------------------------
RLMF_PSE14            QSRFVAWTFLDKAQRTPH-----------------------------------
RLMF_PSEU2            QSRFVAWTFLDKAQRAPG-----------------------------------
RLMF_PSESM            QSRFVAWTFLDKAQRTPG-----------------------------------
RLMF_PSEMY            QSRLVAWTFKDGEARGAWRQSRWR-----------------------------
RLMF_PSEU5            KSRFVTWTFLDAAEQAAWRTERWPRS---------------------------
RLMF_DECAR            QSRLVAWTFCGNGEREKWRRERWTAAPSYAVPAFAEQTAPLTAEATPPAADPV
RLMF_MARMS            ISRFVAWSFLGDDQIDYWKDNYWQN----------------------------
RLMF_METFK            KSRFVAWTFHDTAGQRAWRRQHWRDV---------------------------
RLMF_YERPE            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPA            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPN            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPS            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPB            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERP3            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPY            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERPP            VSRFVAWTFLTLEQQAAWVAERWA-----------------------------
RLMF_YERPG            VSRFVAWTFLTPEQQAAWVAERWA-----------------------------
RLMF_YERE8            VSRFVAWTFLTPEQQAAWKAERW------------------------------
RLMF_SERP5            ISRFVAWTFHDAEQQAAWAAERWR-----------------------------
RLMF_ALIF1            ISRFVAWTYQANVNL--------------------------------------
RLMF_ALIFM            ISRFVAWTYQANVNL--------------------------------------
RLMF_PHOPR            VTRIVAWTFLSKGQQTQWREERWSA----------------------------
RLMF_VIBCH            ISRFIAWSFQNAEQRKLWWQAKC------------------------------
RLMF_VIBCM            ISRFIAWSFQNAEQRKLWWQAKC------------------------------
RLMF_VIBC3            ISRFIAWSFQNAEQRKLWWQAKC------------------------------
RLMF_VIBCB            VSRFMAWSYMDKAQRKAWIELK-------------------------------
RLMF_VIBPA            ISRFMAWSFMDKQQRKTWIELK-------------------------------
RLMF_VIBVU            VSRFVAWSFMDKQQRGEWIKLRG------------------------------
RLMF_VIBVY            VSRFVAWSFMDKLQRGEWIKLRG------------------------------
RLMF_AERHH            ISRVLAWSFQDEAASRQWWSPMAHDNA--------------------------
RLMF_AERS4            VSRILAWSFLDEVACGQWWQPALRGGV--------------------------
RLMF_BACFR            TSRILAWRF--------------------------------------------
RLMF_BACFN            TSRILAWRF--------------------------------------------
RLMF_BACTN            NSRILAWRFLE------------------------------------------
RLMF_CYTH3            SSRLIAWTFQSKEAQAKWVSARWK-----------------------------
RLMF_SHEDO            ITRILAWSYLSLSQRQAWAKLRDQSR---------------------------
RLMF_SHEFN            ATRILAWSFLTPAIHQQWATLRP------------------------------
RLMF_SHEAM            ITRILAWRFESVT----------------------------------------
RLMF_SHEB5            ITRVLAWSFQSAAKRKIWRAEHLAN----------------------------
RLMF_SHEB8            ITRVLAWSFQSAAKRKLWRAEHLAN----------------------------
RLMF_SHEB9            ITRVLAWSFQSAAKRKLWRAEHLAR----------------------------
RLMF_SHEB2            ITRVLAWSFQSAAKRKLWRAEHLAR----------------------------
RLMF_SHEPC            MTRILAWSFQSAAKRKIWRNAHLSD----------------------------
RLMF_SHESW            MTRILAWSFQSAAKRKIWRNAHLSD----------------------------
RLMF_SHESM            ITRLLAWSFHSQAKRLQWRNQIVSGT---------------------------
RLMF_SHESR            FTRVLAWSFHSQAKRLQWRNQIVSGT---------------------------
RLMF_SHESA            VTRVLAWSFHSQAKRLQWRNQVISGA---------------------------
RLMF_SHEON            VTRVLAWSFHSQAKRLRWRSELVTPTE--------------------------
RLMF_SHESH            LTRVLAWSYLTPKQQALWAKYRS------------------------------
RLMF_SHEWM            LTRVLAWSFLTPSQRGLWAKYRS------------------------------
RLMF_SHELP            LTRVLAWTFLTPEQHSLWGLYRV------------------------------
RLMF_SHEHH            ITRVLAWTFLKPEQRELWAQYRDVEN---------------------------
RLMF_SHEPA            ITRVLAWTFLKPEQRELWVQYRDAQ----------------------------
RLMF_SACD2            KTRVIAWRFKP------------------------------------------
RLMF_PSEA6            ISRFVAWKFRD------------------------------------------
RLMF_FLAJ1            NSRIVAWSFLNNTEQKSWKF---------------------------------
RLMF_FLAPJ            NSRIVAWTFLSELQQKAWRF---------------------------------
A4C015_9FLAO          VTRIACWRF--------------------------------------------
A2U137_9FLAO          VTRIVCWRF--------------------------------------------
C2G565_9SPHI          ISRILAWRWS-------------------------------------------
A0A0A2GZI3_9FLAO      KSRFLAWRFKE------------------------------------------
Q26D62_FLABB          KSRFIAWKFDRKPTE--------------------------------------
RLMF_GRAFK            KSRIIAWKFD-------------------------------------------
                       :*.  * :