CLUSTAL format seed alignment for MF_01850

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TTCA_ANADE       ------------------------------------------------------------
TTCA_ANADF       -------------------------------------------------MRAPRRRCYRV
TTCA_MYXXD       ----------------------------------------------------------MA
TTCA_RHIEC       ---------------------MNIAANIADDPETGDIDDG-----------AGPALFADA
TTCA_RHIL3       ---------------------MNIAANIADDLETGEADT------------SGHALFADA
TTCA_AGRFC       ---------------------MNILTKIDDFVDQAGADKVGADHGPSEENGSSHPLFDNA
TTCA_RHIME       ---------------------MELAQSSPDETDSVIV-DDAAF------EGAAHPLFSRM
TTCA_SINMW       ---------------------MELAQSSLNETTEISAGEEAVF------DAGAHPLFSRM
TTCA_BARHE       ---------------------MEENLERTESLAREAD--------------DCHPIFRIA
TTCA_BART1       --------------MNDVSVEYQAIEEKDVLLASKAD--------------DCHPIFRRA
TTCA_BARBK       ---------------------MEKNINIDDFLKEGFD--------------DCHPMFRNA
TTCA_BRUAB       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_BRUA2       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_BRUO2       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_BRUSU       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_BRUC2       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_BRUSI       ---------------------MNAF-DTDITEHADSS--------------GCHPLFRDV
TTCA_BRUME       ---------------------MNAF-DADITEHADSS--------------GCHPLFRDV
TTCA_OCHA4       ---------------------MNAF-DPDIAEDAGSD--------------GCHPLFRDV
TTCA_CHESB       ---------------------MTFHQPVSETAQPDEA--------------SGHPLFADA
TTCA_RHILO       ---------------------MNMLPDIETLETAAEG--------------GSHPLFADV
TTCA_RHOS4       ------------------------------MFDDQ---------------DEIHPLLAGA
TTCA_RHOS1       ------------------------------MFDDQ---------------DEIHPLLAGA
TTCA_RHOS5       ------------------------------MTDEL---------------DDIHPILQGA
TTCA_RUEPO       ------------------------------MLDEN---------------EDIHPLFAGA
TTCA_RUEST       ------------------------------MLDQDL--------------DDIHPLFQGA
TTCA_ROSDO       ------------------------------MLDHS---------------DEIHPLFHGA
TTCA_DINSH       ------------------------------MLDDA----------------DIHPLFHNA
TTCA_PARDP       ------------------------------MRDETGETQDLEA-------EEIHPLFHGA
TTCA_HYPNA       ------------------------------MADTSLS--------------PVLPLFANT
TTCA_ACAM1       ------------------------------------------------------MSNLFM
TTCA_ALKEH       -----------------------------------------------------MMGSAQT
TTCA_XYLF2       ------------------------------------------------------MDATFP
TTCA_XYLFT       ------------------------------------------------------MDATFP
TTCA_XYLFM       ------------------------------------------------------MDATFP
TTCA_XYLFA       ------------------------------------------------------MDATFP
TTCA_STRMK       ------------------------------------------------------MSAVIS
TTCA_XANAC       ------------------------------------------------------MTAVLP
TTCA_XANC5       ------------------------------------------------------MTAVLP
TTCA_XANOR       ------------------------------------------------------MTAVLP
TTCA_XANOM       ------------------------------------------------------MTAVLP
TTCA_XANOP       ------------------------------------------------------MTAVLP
TTCA_XANCP       ------------------------------------------------------MTAVLP
TTCA_XANCB       ------------------------------------------------------MTAVLP
TTCA_XANC8       ------------------------------------------------------MTAVLP
TTCA_METCA       ------------------------------------------------------MPANAA
TTCA_ACIBC       ----------------------------------------------------------MY
TTCA_ACIBY       ----------------------------------------------------------MY
TTCA_ACIBT       ----------------------------------------------------------MY
TTCA_ACIAD       ----------------------------------------------------------MY
TTCA_PSYA2       ------------MTAATLFTQQTTPQFDKASIDTDVNHHAKTTAIEAMLYDDSDDRNDDF
TTCA_PSYCK       ------------MTAATLFTPSITPQFDKASIDIDVNHHDKTTDIEQMLYDDVDDRNDDF
TTCA_PSYWF       --------------MQTNFSQPQT--FNPADITRNVIDNNQDDMVDSLDSDEED--LDLD
TTCA2_FRATF      ------------------------------------------------------------
TTCA2_FRATH      ------------------------------------------------------------
TTCA2_FRATO      ------------------------------------------------------------
TTCA_FRATM       ------------------------------------------------------------
TTCA1_FRATT      ------------------------------------------------------------
TTCA1_FRAT1      ------------------------------------------------------------
TTCA1_FRATW      ------------------------------------------------------------
TTCA1_FRATN      ------------------------------------------------------------
TTCA2_FRAP2      ------------------------------------------------------------
TTCA_NEIMB       -------------------------------------------------------MSKKT
TTCA_NEIMA       -------------------------------------------------------MSKKI
TTCA_NEIM0       -------------------------------------------------------MSKKT
TTCA_NEIMF       -------------------------------------------------------MSKKT
TTCA_NEIG1       -------------------------------------------------------MSKKT
TTCA_HAEIN       ----------------------------------------------MSELTQLAQQ--EK
TTCA_HAEIE       -------------------------------------------------MTQLAQQ--EK
TTCA_HAEI8       -------------------------------------------------MTQLAQQ--EK
TTCA_ACTPJ       ----------------------------------------------MNQDTQSANTQQEK
TTCA_ACTP2       ----------------------------------------------MNQDTQSANTQQEK
TTCA_HAEDU       ----------------------------------------------MNQNTQPTNNLKDK
TTCA_HAES1       -------------------------------------------------MNLNIITEKDK
TTCA_HISS2       -------------------------------------------------MSLNIITEKDK
TTCA_PASMU       -------------------------------------------------MTMTDTTQQDK
TTCA_ACTSZ       ---------------------------------------------------MTEQTEKDK
TTCA_MANSM       --------------------------------------------------MTELETKENK
TTCA_SALPA       ---------------------------------------------------MQEIQKNTK
TTCA_SALPB       ---------------------------------------------------MQEIQKNTK
TTCA_SALTY       ---------------------------------------------------MQEIQKNTK
TTCA_SALTI       ---------------------------------------------------MQEIQKNTK
TTCA_SALCH       ---------------------------------------------------MQEIQKNTK
TTCA_SALAR       ---------------------------------------------------MQDNQKVKK
TTCA_ECO57       ---------------------------------------------------MQENQQITK
TTCA_SHISS       ---------------------------------------------------MQENQQITK
TTCA_ECOLI       ---------------------------------------------------MQENQQITK
TTCA_ECODH       ---------------------------------------------------MQENQQITK
TTCA_SHIBS       ---------------------------------------------------MQENQQITK
TTCA_SHIB3       ---------------------------------------------------MQENQQITK
TTCA_SHIDS       ---------------------------------------------------MQENQQITK
TTCA_ECOUT       ---------------------------------------------------MQENQQITK
TTCA_ECOK1       ---------------------------------------------------MQENQKNTK
TTCA_ECOL6       ---------------------------------------------------MQENQQITK
TTCA_ECOL5       ---------------------------------------------------MQENQQITK
TTCA_ECOLC       ---------------------------------------------------MSQNQEISK
TTCA_ECO24       ---------------------------------------------------MSQNQEISK
TTCA_ECOHS       ---------------------------------------------------MSQNQEISK
TTCA_SHIFL       ---------------------------------------------------MSQNQEISK
TTCA_SHIF8       ---------------------------------------------------MSQNQEISK
TTCA_ECOSM       ---------------------------------------------------MSQNQEISK
TTCA_CITK8       ---------------------------------------------------MSQNQDISK
TTCA_KLEP7       ---------------------------------------------------MQENQELTK
TTCA_ENT38       ---------------------------------------------------MQQNQEITK
TTCA_CROS8       ---------------------------------------------------MSEIQEISK
TTCA_YERPE       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPP       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPG       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPA       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPN       ---------------------------------------------------MLEKQSVNQ
TTCA_YERP3       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPY       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPS       ---------------------------------------------------MLEKQSVNQ
TTCA_YERPB       ---------------------------------------------------MLEKQSVNQ
TTCA_YERE8       ---------------------------------------------------MQEKQVVNQ
TTCA_PECAS       ---------------------------------------------------MSENQQTNQ
TTCA_SERP5       ---------------------------------------------------MSEQQTVSQ
TTCA_SODGM       -------------------------------------------------MRKAKNAVVMQ
TTCA_PHOLL       ------------------------------------------------------MSVVDQ
TTCA_AERHH       -----------------------------------------------------MLEELNA
TTCA_AERS4       -----------------------------------------------------MLEELNA
TTCA_COLP3       ---------------------------------------------MTEAQLTLPTTKLSP
TTCA_PSYIN       -----------------------------------------------------MSDVLSK
TTCA_IDILO       ---------------------------------------------------------MAS
TTCA_PSEHT       -----------------------------------------------------MSHSDQA
TTCA_VIBCH       --------------------------------------------------MTAQTQELTK
TTCA_VIBC3       --------------------------------------------------MTAQTQELTK
TTCA_VIBVU       --------------------------------------------------MTEQIQERTK
TTCA_VIBVY       --------------------------------------------------MTEQILERTK
TTCA_ALIF1       ------------------------------------------------------MSELTK
TTCA_VIBCB       -----------------------------------------------------MNQVDTR
TTCA_VIBPA       -----------------------------------------------------MNQKDTR
TTCA_PHOPR       ---------------------------------------------------MRMNQQDTH
TTCA_SACD2       -----------------------------------------------------MTQ-DVR
TTCA_PSEAE       -----------------------------------------------------MGTLSVN
TTCA_PSEAB       -----------------------------------------------------MGTLSVN
TTCA_PSEA7       -----------------------------------------------------MGTLSVN
TTCA_PSEMY       -----------------------------------------------------MGTLSVN
TTCA_PSEU5       -----------------------------------------------------MGNLSVN
TTCA_PSEE4       -----------------------------------------------------MGTLSVN
TTCA_PSEPW       -----------------------------------------------------MGTLSVN
TTCA_PSEPG       -----------------------------------------------------MGTLSVN
TTCA_PSEP1       -----------------------------------------------------MGTLSVN
TTCA_PSEPK       -----------------------------------------------------MGTLSVN
TTCA_PSEF5       -----------------------------------------------------MGTLTVN
TTCA_PSEPF       -----------------------------------------------------MGTLTVN
TTCA_PSE14       -----------------------------------------------------MGTLSVN
TTCA_PSEU2       -----------------------------------------------------MGTLSVN
TTCA_PSESM       -----------------------------------------------------MGTLSVN
TTCA_SHEB8       -----------------------------------------------------MSEELSK
TTCA_SHEB9       -----------------------------------------------------MSEELSK
TTCA_SHEB5       -----------------------------------------------------MSEELSK
TTCA_SHEPC       -----------------------------------------------------MSEELSK
TTCA_SHESW       -----------------------------------------------------MSEELSK
TTCA_SHESA       -----------------------------------------------------MPEELSK
TTCA_SHESM       -----------------------------------------------------MPEELSK
TTCA_SHESR       -----------------------------------------------------MPEELSK
TTCA_SHEON       -----------------------------------------------------MPEELSK
TTCA_SHEAM       -------------------------------------------------MSDVVQDELSK
TTCA_SHELP       ----------------------------------------------------MSEETLSK
TTCA_SHEHH       -----------------------------------------------------MSEELTP
TTCA_SHEPA       -----------------------------------------------------MSEELTP
TTCA_SHESH       -----------------------------------------------------MSEDLSK
TTCA_SHEWM       -----------------------------------------------------MSVDLSA
TTCA_SHEDO       -------------------------------------------------MSDIVVDDFSE
TTCA_SHEFN       ---------------------------------------------------MSEVDTIAK
TTCA_CHRSD       ------------------------------------------------------MHELTG
TTCA_HAHCH       ---------------------------------------------MTAAFK----SEMAQ
TTCA_MARHV       -----------------------------------------MPEAMTASPEKTPASDYER
TTCA_ALCBS       -----------------------------------------------------MSDNADT
TTCA_MARMS       ----------------------------------------------------MMDLSTRP
TTCA_CHRVO       -------------------------------------------------MNAALDDKAAK
TTCA_NITEU       ----------------------------------------------------MVTETLSR
TTCA_NITEC       ----------------------------------------------------MITDTFSR
TTCA_NITMU       --------------------------------------------------MGTGIEMLSR
TTCA_NITOC       ------------------------------------------------------MNKQSR
TTCA_CYTH3       -------------------------------------------------MRHTFTTEIMP
TTCA_PSEA6       -------------------------------------------------MNHVSSTKPDT
TTCA_DICNV       ----------------------------------------------------------MS
TTCA_AZOSB       ------------------------------------------------MPAVAPS-AAES
TTCA_AROAE       ----------------------------------------MTPLSAVATPTPAPAEAADS
TTCA_DECAR       -----------------------------------------------------------M
TTCA_CUPTR       -----------------------------------------------------------M
TTCA_CUPNH       -----------------------------------------------------------M
TTCA_CUPPJ       -----------------------------------------------------------M
TTCA_CUPMC       -----------------------------------------------------------M
TTCA_RALSO       -----------------------------------------------------------M
TTCA_METFK       -----------------------------------------------------MIKHYPD
TTCA_ACISJ       ---------MNTANNTLPTAADWA------------------------GEDAAPDAADTR
TTCA_DELAS       -----------MFNN--PDFSDIA------------------------TCDLE-EPKNSI
TTCA_ACIAC       -------------MTALPQDTDWT------------------------ADASR---PAQA
TTCA_VEREI       ------------MGAVIDDSMPGP------------------------GADATGTGPSDA
TTCA_POLNA       ------------MNAIWIDEQLET----------------------------SARVQNSM
TTCA_POLSJ       ------------MSAVWMDEQVES----------------------------SARVQNSL
TTCA_RHOFT       ------------MNAVWTDNDTQAEDLSPQGRVASQLVRLKSDLQAFADATASAPATREP
TTCA_BORBR       ------------MTLTASPTAART--------------------------------PAEE
TTCA_BORPE       ------------MTLTASPTAART--------------------------------PAEE
TTCA_BORPA       ------------MTLTVSPTAART--------------------------------PAEE
TTCA_BORPD       -----------MQDLIDSPTAART--------------------------------PAEE
TTCA_BORA1       ------------MTRTDIERPVRT--------------------------------QAEE
TTCA_LEPCP       ---MNTPTATLNAPAADAESAAAS--------------------------------AADK
TTCA_METPP       ------------MSAVVIEPGVTQ--------------------------------RQAG
TTCA_BURCM       MNAPHTH--DTVADGAAIEATVADIAD----------------------TGRRALTRREQ
TTCA_BURA4       MNAPHMH--DTAADGAAIEATVADIAD----------------------TGRRALTRREQ
TTCA_BURVG       MNAPQTN--DTAADGAATEAIAAD-------------------------SGRRALTRREQ
TTCA_BURCA       -----MN--DTAADAATLDDAAAP-------------------------AGRPALTRREQ
TTCA_BURCH       MNAPHMN--DTAADAATLDDAAAP-------------------------AGRPALTRREQ
TTCA_BURCC       MNAPHMN--DTAADAATLDDAAAP-------------------------AGRPALTRREQ
TTCA_BURL3       MNAPHMN--DTTADAATLDATAAP-------------------------AGRPALTRREQ
TTCA_BURM1       MNAPQTN--DTAADVATIEASAAE-------------------------VGRRALTRREQ
TTCA_BURMA       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURM9       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURPS       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURP0       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURP1       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURP6       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURM7       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURMS       MNAPHTPHLNEAEAAAAVEANAAE-------------------------LGRRALTRREQ
TTCA_BURTA       MNAPHTPHLNEADAAAAVEANAAE-------------------------IGRRALTRREQ
TTCA_PARPJ       MNAPEILNGAATASPADATEATQTAA-----------------------RAKTPLTRREQ
TTCA_PARXL       MNAPEILNGATAAAPAGTGEATPVHA-----------------------RARSPLTRREQ
TTCA_PARP8       MNAPDTLTGLEANAPVTEEAPAASEA-----------------------ERKRAHTRREQ
TTCA_HERAR       MSQSVIN---EAAISAPAETAAAL------------------------------SFKQGE
TTCA_JANMA       MSQALMN---TAA--ATAETDAAM------------------------------SFKQNE
TTCA_POLAQ       -------------------------------------------------------MGDIR
TTCA_DEIGD       -----------------------------------------------------------M
TTCA_DEIRA       -------------------------------------------------MTQALTPTVSN
TTCA_COXBU       ------------------------------------------------------------
TTCA_COXBR       ------------------------------------------------------------
TTCA_COXBN       ------------------------------------------------------------
TTCA_LEGPL       ------------------------------------------------------------
TTCA_LEGPH       ------------------------------------------------------------
TTCA_LEGPA       ------------------------------------------------------------
TTCA_LEGPC       ------------------------------------------------------------
TTCA1_FRATF      ------------------------------------------------------------
TTCA1_FRATO      ------------------------------------------------------------
TTCA1_FRATH      ------------------------------------------------------------
TTCA2_FRATT      ------------------------------------------------------------
TTCA2_FRAT1      ------------------------------------------------------------
TTCA2_FRATW      ------------------------------------------------------------
TTCA2_FRATN      ------------------------------------------------------------
TTCA1_FRAP2      -----------------------------------------------------------M
TTCA_BDEBA       ---------------------------------------------------------MKS
TTCA_SORC5       ------------------------------------------------------------
TTCA_GEOMG       ------------------------------------------------------------
TTCA_GEOSL       ------------------------------------------------------------
TTCA_GEOUR       ------------------------------------------------------------
TTCA_PELPD       --------------------------------------------MLRTPKAASDPMTLTQ
TTCA_PELCD       ------------------------------------------------------------
                                                                             

TTCA_ANADE       --MQQI---------------HRLERKLLRATAEAIRDFDLVS---------QGDRIMVA
TTCA_ANADF       RPMHDV---------------SKLEKRLLRAAANAIRDFELIG---------DGDRIMVA
TTCA_MYXXD       APMNDV---------------QRLEKSLLGHMGRAIADHRLIE---------DGDRIMVG
TTCA_RHIEC       PRSVSF---------------NKLRKRLLRQVRQAFDDFDMLK---------GQKRWLVG
TTCA_RHIL3       PRSVSF---------------NKLRKRLLRQVRQAFDDFDMLK---------GQKRWLVG
TTCA_AGRFC       PRSVSF---------------NKLRKRLLRNVRQAFEDFGMLN---------GQKRWLVG
TTCA_RHIME       PSSVSF---------------NKLRKRLLRQVRQALDDFGMLK---------GSRRWLVG
TTCA_SINMW       PSSVSF---------------NKLRKRLLRQVRQALDDFGMLK---------GSKRWLVG
TTCA_BARHE       PSTVEF---------------NKLRKRLLRHIRQAFDDFSMLS---------SGKKWLVA
TTCA_BART1       PSSVEF---------------NKLRKRLLRHMRQALDDFSMLS---------TGKKWLVA
TTCA_BARBK       PSTVEF---------------NKLRKRLLRNMRQAIDDFSMLS---------SGEKWLVA
TTCA_BRUAB       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUA2       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUO2       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUSU       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUC2       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUSI       PATVEF---------------NKLRKRLLRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_BRUME       PATVEF---------------NKLRKRLVRLTRQAIEDFAMVK---------PGDRWMVC
TTCA_OCHA4       PTTVEF---------------NKLRKRLLRLTRQAIEDFSMVK---------PGERWMVC
TTCA_CHESB       PSSVEF---------------NKLRKRLLRQVRQAFEDFTMVK---------PGDRWLVA
TTCA_RHILO       PSSVEF---------------NKLRKRLLRLTRQAIEDFSMVE---------PGQRWLVA
TTCA_RHOS4       PQTTEF---------------RKLRKRIVREVREAIETYGMVE---------RGARWLVC
TTCA_RHOS1       PQTTEF---------------RKLRKRIVREVREAIETYGMVE---------RGARWLVC
TTCA_RHOS5       PQTTEF---------------RKLRKRIVRNVREALDQYGMVDG--------RDARWLVC
TTCA_RUEPO       PATTEF---------------KKLRKRIVRYTREAIEQYGMVERRA-DG---STPKWLVC
TTCA_RUEST       PQTTEF---------------KKLRKRIVRYTREAVEQYGMVERRE-DG---SLPKWLVC
TTCA_ROSDO       PKTTEF---------------RKLRKRLVRQTRDAIERYGMIE---------KDARWLVC
TTCA_DINSH       PGTTEF---------------KKLRKRIIRNVREAIDLYGMVEREAREG---TKPRWLVC
TTCA_PARDP       PGSTEF---------------RKLRKRLVRETRAAIETYDMIR---------PGDRWLVC
TTCA_HYPNA       PSSVSF---------------KKLRKRLVRGALEVIDTYGLVDRRAIETGEKPHPKWLVC
TTCA_ACAM1       TATQL---HPSKQ-------LKKLQARLRGLVGKAIRDYNLIE---------AGDRIMVC
TTCA_ALKEH       LATRH---APNPRGLVMGMGLKTLQKRLSHLTGNAIRDYRMIE---------EGDRVMVC
TTCA_XYLF2       -SQHNITARPAPG--RIRREQCKLAKRLRRQVGQAIADFGMIE---------ANDKIMVC
TTCA_XYLFT       -SQHNITARPAPG--RIRREQCKLAKRLRRQVGQAIADFGMIE---------ANDKIMVC
TTCA_XYLFM       -SQRNITTRPAPD--RIRREKCKLAKRLRRQVGQAIADFGMIE---------ANDKIMVC
TTCA_XYLFA       -PQRNITARPAPD--RIRREQCKLAKRLRRQVGQAIADFGMIE---------ANDKIMVC
TTCA_STRMK       LPDPQPRAARDPR--VAEREQHKLAKRLRRQVGEAIADFGMIE---------AGDKVMVC
TTCA_XANAC       LPQPLADPAPRDPRQRLQREQLRLGKRLQRQVGQAIADFGMIA---------PGDKIMVC
TTCA_XANC5       LPQPLADPAPRDPRQRLQREQLRLGKRLQRQVGQAIADFGMIA---------PGDKVMVC
TTCA_XANOR       LPHPLADPAPRDPRQRLQREQLRLGKRLQRQVGQAIADFGMIS---------PGDKIMVC
TTCA_XANOM       LPHPLADPAPRDPRQRLQREQLRLGKRLQRQVGQAIADFGMIS---------PGDKIMVC
TTCA_XANOP       LPHPLADPAPRDPRQRLQREQLRLGKRLQRQVGQAIADFGMIS---------PGDKIMVC
TTCA_XANCP       LPLPLADPAPRTP--RLQREPLRLAKRLRHAVGQAIADFGMIA---------PGDKVMVC
TTCA_XANCB       LPLPLADPAPRTP--RLQREPLRLAKRLRHAVGQAIADFGMIA---------PGDKVMVC
TTCA_XANC8       LPLPLADPAPRTP--RLQREPLRLAKRLRHAVGQAIADFGMIA---------PGDKVMVC
TTCA_METCA       APLYA----------KERYEFNKLQKRLRRLTGQAIADYGMIQ---------EGDRVMVC
TTCA_ACIBC       APVESNEGFNFKPELPTSSAYYRLLKKLRRQVGHAIRDFNMIE---------DGDKVMVC
TTCA_ACIBY       APVESNEGFNFKPELPTSSAYYRLLKKLRRQVGHAIRDFNMIE---------DGDKVMVC
TTCA_ACIBT       APVESNEGFNFKPELPTSSAYYRLLKKLRRQVGHAIRDFNMIE---------DGDKVMVC
TTCA_ACIAD       SPVESEQGFNFKPELPTSSAYYRLLKKLRRQVGHAIRDFKMIE---------DGDKVMVC
TTCA_PSYA2       MDEQADKILADTQSLTESAYFRKLQKKLRRQVSWAIRDFNMIE---------DGDVVMVC
TTCA_PSYCK       MDEQADNILADTQSLTESVHFRKLQKKLRRQVSWAIRDFNMIE---------DGDVVMVC
TTCA_PSYWF       LDLELSDEQEIAHKGVKSARFKKLQKKLRKQVSHAIRDFNMIE---------DGDVVMVC
TTCA2_FRATF      -----------MTNNTDKQTLKKLERQILRKTTQVINQYNMIE---------DGDKIMVC
TTCA2_FRATH      -----------MTNNTDKQTLKKLERQILRKTTQVINQYNMIE---------DGDKIMVC
TTCA2_FRATO      -----------MTNNTDKQTLKKLERQILRKTTQVINQYNMIE---------DGDKIMVC
TTCA_FRATM       -----------MTNNTDKQTLKKLERQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA1_FRATT      -----------MTNNTDKQTLKKLERQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA1_FRAT1      -----------MTNNTDKQTLKKLERQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA1_FRATW      -----------MTNNTDKQTLKKLERQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA1_FRATN      -----------MTNNTDKQTLKKLERQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA2_FRAP2      ------------MTEINKQSLKKLEKQILRKTAQAINQYNMIE---------DGDKIMVC
TTCA_NEIMB       KQELEN---------------NKLSKRLRHAVGDAINDFNMIE---------PDDKIMVC
TTCA_NEIMA       KQELEN---------------NKLSKRLRHAVGDAINDFNMIE---------PGDKIMVC
TTCA_NEIM0       KQELEN---------------NKLSKRLRHAVGDAINDFNMIE---------PGDKIMVC
TTCA_NEIMF       KQELEN---------------NKLSKRLRHAVGDAINDFNMIE---------PDDKIMVC
TTCA_NEIG1       KQELEN---------------NKLSKRLRHAVGDTINDFNMIE---------PGDKIMVC
TTCA_HAEIN       KQTYNF---------------NKLQKRLRRNVGNAIADFGMIE---------DGDKVMVC
TTCA_HAEIE       KQTYNF---------------NKLQKRLRRNVGNAIADFGMIE---------DGDKVMVC
TTCA_HAEI8       KQTYNF---------------NKLQKRLRRNVGNAITDFGMIE---------DGDKVMVC
TTCA_ACTPJ       KIAYNF---------------NKLQKRLRRNVGNAIADFNMIE---------DGDKVMVC
TTCA_ACTP2       KIAYNF---------------NKLQKRLRRNVGNAIADFNMIE---------DGDKVMVC
TTCA_HAEDU       KITYNF---------------NKLQKRLRRNVGNAIANFNMIE---------AGDKVMVC
TTCA_HAES1       KQSYNL---------------NKLQKRLRRNVGNAIADFNMIE---------NGDKVMVC
TTCA_HISS2       KQSYNL---------------NKLQKRLRRNVGNAIADFNMIE---------NGDKVMVC
TTCA_PASMU       KHTYNF---------------NKLQKRLRRNVGNAIADFNMIE---------EGDKVMVC
TTCA_ACTSZ       KQIYNL---------------NKLQKRLRRNVGNAIADFNMIE---------EGDKVMVC
TTCA_MANSM       KQIYNF---------------NKLQKRLRRNVGNAIADFNMIE---------DGDKVMVC
TTCA_SALPA       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SALPB       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SALTY       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SALTI       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SALCH       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SALAR       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECO57       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHISS       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOLI       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECODH       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHIBS       KEQYSL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHIB3       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHIDS       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOUT       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOK1       KEIYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOL6       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOL5       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOLC       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECO24       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOHS       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHIFL       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SHIF8       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ECOSM       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_CITK8       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_KLEP7       KEKYNI---------------DKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_ENT38       KEQYNL---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRIMVC
TTCA_CROS8       KEQYNL---------------NKLQKRLRRNVGEAIADYNMIE---------EGDRIMVC
TTCA_YERPE       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPP       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPG       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPA       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPN       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERP3       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPY       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPS       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERPB       KEQYNF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_YERE8       KEQYDL---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRVMVC
TTCA_PECAS       KEQYNL---------------NKLQKRLRRNVGEAIADFNMIE---------EGDRIMVC
TTCA_SERP5       KEQYNL---------------NKLQKRLRRNVGQAIADFNMIE---------EGDRIMVC
TTCA_SODGM       KQQYNI---------------NKLQKRLRRHVGQAIADYAMIE---------EGDRIMVC
TTCA_PHOLL       KQQYNL---------------NKLQKRLRRDVGQAIADFNMIE---------EGDRIMVC
TTCA_AERHH       KEKYSF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDKVMVC
TTCA_AERS4       KDKYSF---------------NKLQKRLRRNVGQAIADFNMIE---------EGDKIMVC
TTCA_COLP3       TQKTQF---------------IKLEKKLRRNVGQAIAQYNMIE---------DGDKVMVC
TTCA_PSYIN       KQQFSL---------------KKLNKSLRKSTGQAIADYNMIE---------EGDRVMVC
TTCA_IDILO       ENKYSF---------------NKLQKRIRRDAGKAIQDFGMIE---------DGDHIMVC
TTCA_PSEHT       KAQFNL---------------TKLQKRLRRQTGQAVMDFNMIE---------EGDRIMVC
TTCA_VIBCH       AQQYNF---------------NKLQKRIRRNTGQAIADFNMIE---------DGDRIMVC
TTCA_VIBC3       AQQYNF---------------NKLQKRIRRNTGQAIADFNMIE---------DGDRIMVC
TTCA_VIBVU       AQQYNF---------------NKLQKRIRRNTGQAIADFNMIE---------DGDRIMVC
TTCA_VIBVY       AQQYNF---------------NKLQKRIRRNTGQAIADFNMIE---------DGDRIMVC
TTCA_ALIF1       AQQYNF---------------NKLQKKIRRNTGNAIADYNMIE---------DGDRIMVC
TTCA_VIBCB       KETLEF---------------NKLQKRLRRNVGNAITDYNMIE---------EGDVVMAC
TTCA_VIBPA       KETLEF---------------NKLQKRLRRNVGNAITDYNMIE---------EGDVVMAC
TTCA_PHOPR       KENLEF---------------NKLQKKLRRNVGNAITEYNMIE---------ESDVVMAC
TTCA_SACD2       RSKLEF---------------NKLQKRLRRNVGKAIADYNMIE---------DGDKVMVC
TTCA_PSEAE       Q--------------------NKLQKRLRRLAGEAITDFNMIE---------DGDKVMVC
TTCA_PSEAB       Q--------------------NKLQKRLRRLAGEAITDFNMIE---------DGDKVMVC
TTCA_PSEA7       Q--------------------NKLQKRLRRLAGEAITDFNMIE---------DGDKVMVC
TTCA_PSEMY       Q--------------------NKLQKRIRRLAGEAITDFNMIE---------DGDKVMVC
TTCA_PSEU5       Q--------------------NKLQKRLRRLAGEAVTDFNMIE---------DGDKVMVC
TTCA_PSEE4       Q--------------------NKLQKRLRRLAGEAITDYNMIE---------DGDKVMVC
TTCA_PSEPW       Q--------------------NKLQKRLRRLAGEAITDYNMIE---------DGDKVMVC
TTCA_PSEPG       Q--------------------NKLQKRLRRLAGEAITDYNMIE---------DGDKVMVC
TTCA_PSEP1       Q--------------------NKLQKRLRRLAGEAITDYNMIE---------DGDKVMVC
TTCA_PSEPK       Q--------------------NKLQKRLRRLAGEAITDYNMIE---------DGDKVMVC
TTCA_PSEF5       Q--------------------NKLQKRLRRQAGEAVADFNMIE---------EGDKVMVC
TTCA_PSEPF       Q--------------------NKLQKRLRRLAGEAVTDFNMIE---------DGDKVMVC
TTCA_PSE14       Q--------------------NKLQKRLRRLAGEAVADFNMIE---------EGDKVMVC
TTCA_PSEU2       Q--------------------NKLQKRLRRLAGEAVADFNMIE---------EGDKVMVC
TTCA_PSESM       Q--------------------NKLQKRLRRLAGEAVADFNMIE---------EGDKVMVC
TTCA_SHEB8       KHTTRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDKIMCC
TTCA_SHEB9       KHTTRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDKIMCC
TTCA_SHEB5       KHTNRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDKIMCC
TTCA_SHEPC       KHTTRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHESW       KHTTRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHESA       KQITRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHESM       KQITRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHESR       KQITRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHEON       KQTTRL---------------NKLQKRLRREVGSAIADYNMIE---------DGDRVMCC
TTCA_SHEAM       KQTTRL---------------NKLQKRLRREVGSAIADYNMIE---------EGDRVMCC
TTCA_SHELP       KQITRL---------------NKLQKRLRREVGSAIADYNMIE---------EGDTVMCC
TTCA_SHEHH       QQVTRM---------------AKLQKRLRTEVGRAIGDYNMIE---------EGDRVMCC
TTCA_SHEPA       QQVTRM---------------TKLQKRLRTEVGRAIGDYNMIE---------EGDRVMCC
TTCA_SHESH       LHTSRM---------------NKLQRKLRGEVGKAIGDYNMIE---------EGDRVMCC
TTCA_SHEWM       QQVTRM---------------KKLQKKIRSEVGKAISDYNMVE---------EGDRIMCC
TTCA_SHEDO       KQAARL---------------NKLSKRLHREVGKAIADYQMIE---------EGDRIMCC
TTCA_SHEFN       QNITRM---------------NKLQKRLRHEVGSAIADYNMIE---------DGDRVMCC
TTCA_CHRSD       KDKLAF---------------NKLQKRLRRQVGNAIVDYGMIR---------DGDKVMVC
TTCA_HAHCH       RDRLEL---------------NKLRKLLRREVGRAIADFNMIE---------DGDKVMCC
TTCA_MARHV       RQKLEL---------------NKLQKRLRREVGQAIADFSMIE---------AGDKVMCC
TTCA_ALCBS       KKRTRL---------------NKLQKKLRRETGRAIADFNMIS---------EGDKVMVC
TTCA_MARMS       KEKLEL---------------NKLQKRLRRLTGQAIADFNMIE---------DGDKVMVC
TTCA_CHRVO       KAAFEG---------------NKLAKRLRHHVGDAINDFNMIE---------EGDRVMVC
TTCA_NITEU       KADYNA---------------NKLRKRLRRLVGTAIADFNMIE---------KGDRVMVC
TTCA_NITEC       KSEYST---------------NKLRKRLRRLVGTAIADFNMIE---------SGDRIMVC
TTCA_NITMU       KEQHNA---------------NKLHKRLRRLVGTAIADFNMIE---------SGDRVMVC
TTCA_NITOC       KAQYNA---------------NKLQKRLRRLVGQAIETFNMIE---------DGDRLMVC
TTCA_CYTH3       LPTPE----------------EKNINRLRKSFWEAVEEFDLIE---------PGDKIMVC
TTCA_PSEA6       APSKHLTSSHIDATDQNNKRLKKLTTKLRRKTGQAIADFNMIE---------EGDKVMVC
TTCA_DICNV       VSQ------------------NKLCKRLRRLVGKAIDDYQMIA---------DGDRIMVC
TTCA_AZOSB       RHSNTF---------------LRLKKKLERGVGEAIADYNMIG---------DGDTVMVC
TTCA_AROAE       RFSNTF---------------LRLKKKLERGVGKAIADFNMIG---------DGDTVMVC
TTCA_DECAR       TPSNTL---------------QKLRKYLEGRTGKAIIDYNMIE---------DGDTVLVC
TTCA_CUPTR       SHSNNF---------------YRLETRLQSQTGKAIGDFGMIE---------DGDTVLVC
TTCA_CUPNH       SHSNNF---------------YRLETRLQSQTGKAIGDFGMIE---------DGDTVLVC
TTCA_CUPPJ       SHSNNF---------------YRLETRLQSQTGKAIGDFGMIE---------DGDTVLVC
TTCA_CUPMC       SHSANF---------------YRLETRLQSLTGKAIGDFGMIE---------DGDTVLVC
TTCA_RALSO       TFSNNF---------------HRLETRLQSQAGRAIGDFKMIE---------DGDTVLVC
TTCA_METFK       NASNSF---------------LKLRNSLISATGKAIGDYNMIE---------DGDTILVC
TTCA_ACISJ       KIERES---------------HKLEKRLCREVGRAITDFNMIE---------EGDKIMVC
TTCA_DELAS       KIEREQ---------------VKLEKRLCREVGRAITDFNMIE---------EGDKIMVC
TTCA_ACIAC       RIEREA---------------HKLEKRLCREVGRAIVDYRMIE---------EGDKVMVC
TTCA_VEREI       RTERET---------------RKLEKRLCRAVGKAIDDFHMIE---------AGDKVMVC
TTCA_POLNA       KIERED---------------HKLEKRLCREVGRAIVDFNMIE---------EGDKVMVC
TTCA_POLSJ       KIERED---------------HKLEKRLCREVGRAIVDFNMIE---------EGDKVMVC
TTCA_RHOFT       KIERET---------------HKLEKRLCRQVGQAIMDFNMIE---------EGDRVMVC
TTCA_BORBR       KARFEG---------------NKLAKRLARETTRAIADYNMIE---------AGDKVMVC
TTCA_BORPE       KARFEG---------------NKLAKRLARETTRAIADYNMIE---------AGDKVMVC
TTCA_BORPA       KARFEG---------------NKLAKRLARETTRAIADYNMIE---------AGDKVMVC
TTCA_BORPD       KIRHEG---------------NKLSKRLARETTRAIADYNMIE---------AGDRVMVC
TTCA_BORA1       KARYEG---------------NKLSKRLARETTRALSDYNMIE---------EGDRVMVC
TTCA_LEPCP       KAAFEL---------------NKLSKRLHRQVGQAITDFNMIQ---------EGDRVMVC
TTCA_METPP       KPAFEA---------------NKLSKRLHRLVGQAIGDFNMIE---------PGDKLMVC
TTCA_BURCM       KEAYEN---------------NKLFKRIVRQVGQAIGDYNMIE---------QGDKVMVC
TTCA_BURA4       KEAYEN---------------NKLFKRIVRQVGQAIGDYNMIE---------QGDKVMVC
TTCA_BURVG       KEAYEN---------------NKLFKRIARQVGQAIGDYNMIE---------AGDKVMVC
TTCA_BURCA       KEAYEN---------------NKLFKRIVRQVGQAIGDYNMIE---------QGDKVMVC
TTCA_BURCH       KEAYEN---------------NKLFKRIVRQVGQAIGDYNMIE---------QGDKVMVC
TTCA_BURCC       KEAYEN---------------NKLFKRIVRQVGQAIGDYNMIE---------QGDKVMVC
TTCA_BURL3       KDAYEN---------------NKLFKRIVRQVGQAIGDFNMIE---------QGDKVMVC
TTCA_BURM1       KEAYED---------------NKLFKRIVRQVGQAIGDYNMIE---------DGDKVMVC
TTCA_BURMA       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURM9       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURPS       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURP0       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURP1       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURP6       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURM7       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURMS       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_BURTA       KEAYEN---------------NKLFKRLVRQVGQAIGDYNMIE---------HGDKVMVC
TTCA_PARPJ       KEAYEN---------------NKLFKRLARQVGEAIVDFNMIE---------NGDKVMVC
TTCA_PARXL       KEAYEN---------------NKLFKRLARQVGEAIVDFNMIE---------DGDKVMVC
TTCA_PARP8       KEQYEN---------------NKLFKRLARQVGQAIGDFNMIE---------DGDKVMVC
TTCA_HERAR       KIVYEN---------------NKLHKRLCRQVGQAIGDFNMIE---------DGDKIMVC
TTCA_JANMA       KIVYEN---------------NKLHKRLCRQVGQAIGDFNMIE---------DGDKVMVC
TTCA_POLAQ       KVVFEE---------------NKLEKKLCRLVGQAIGDFGMIE---------DGDKVMVC
TTCA_DEIGD       TQIADP---------------SILFPPLVKGAAQAITDYRMIE---------EGDRVMVC
TTCA_DEIRA       TAQPDP---------------ARLLAPIVRQVGQAIGDYRMIE---------QGDRVMVC
TTCA_COXBU       MSEK------------------RVEKKLIHYVKKALNDYRMIN---------TGDRVMVC
TTCA_COXBR       MSEK------------------RVEKKLIHYVKKALNDYRMIN---------TGDRVMVC
TTCA_COXBN       MSEK------------------RVEKKLIHYVKKALNDYHMIN---------TGDRVMVC
TTCA_LEGPL       MSSNPS----------------SVEKKLLHYTGKAIADFNMIQ---------RGDKVMVC
TTCA_LEGPH       MSSNPS----------------SVEKKLLHYTGKAIADFNMIQ---------RGDRVMVC
TTCA_LEGPA       MSSNPS----------------SVEKKLLHYTGKAIADFNMIQ---------RGDRVMVC
TTCA_LEGPC       MSSNPS----------------SVEKKLLHYTGKAIADFNMIR---------HGDRVMVC
TTCA1_FRATF      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKAMLC
TTCA1_FRATO      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKAMLC
TTCA1_FRATH      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKAMLC
TTCA2_FRATT      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKVMLC
TTCA2_FRAT1      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKVMLC
TTCA2_FRATW      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKVMLC
TTCA2_FRATN      ----MT----------------KTEKKLRHYITKAIADYKLLD---------KGDKVMLC
TTCA1_FRAP2      TEIKIS----------------KTEKKLRHYITKAIADYKLIE---------KGDKVMLC
TTCA_BDEBA       AVNFEL----------------PLAVKIRKQIVQALNDFNMIE---------DGDKVMVC
TTCA_SORC5       ---------------------MQLRRKLARAMGRAITDFDMIA---------DGDRILCA
TTCA_GEOMG       MEFVDE----------------KRYRKIKNGVGRAVADFNLIE---------EGDRIAVA
TTCA_GEOSL       MEFIDN----------------IRYKKIKNAVGRAVADFGLIR---------DGDRIAVA
TTCA_GEOUR       MALIED----------------RLFTRIKNRVGRAIADYNLIE---------EGDRIAVA
TTCA_PELPD       QEMREL----------------PLFRRLRHAVGKAVADFAMIR---------EGDRIAVG
TTCA_PELCD       MPIVED----------------RLFRKIKKLTGKAIGDFNLIE---------EGDRIAVA
                                            :      ..  . ::                  

TTCA_ANADE       VSGGKDSYTLLHLLMRLRERAPIDFDLVAVNLDQGQPGFPAHVVEDHLRSLGVPYRMLQR
TTCA_ANADF       VSGGKDSYTLLHVLMRLRERAPIDFDLVAVNLDQGQPGYPAEIVERHFQAVGVPHRMLYA
TTCA_MYXXD       VSGGKDSYTMLHLLRELQRRAPVKFELLAVNLDQGHPGFPADKLEAYFQREGYPYKLLKE
TTCA_RHIEC       LSGGKDSYGLLALLLDLKWRGLLSVELIACNLDQGQPNFPKHVLPDYLTKIGVRHRIEYR
TTCA_RHIL3       LSGGKDSYGLLALLLDLKWRGLLPVELIACNLDQGQPNFPKHVLPDYLTKIGVRHRIEYR
TTCA_AGRFC       LSGGKDSYGLLALLLDLKWRGLLPVELVACNLDQGQPNFPKHVLPEYLAKIGVAHRIEYR
TTCA_RHIME       VSGGKDSYSLLALLMDLQWRGLLPVELVACNLDQGQPNFPKHVLPDYLRSIGVKHRIEYR
TTCA_SINMW       VSGGKDSYSLLALLMDLKWRGLLPVELVACNLDQGQPNFPKHVLPDYLQSIGVRHRIEYR
TTCA_BARHE       LSGGKDSYGLLALLLDLKWRGLLPVEILACNLDQGQPGFPKHILPDFLNSYQIPHRIEYQ
TTCA_BART1       LSGGKDSYGLLALLLDLKWRGLLPVEILACNLDQGQPGFPKHILPDFLSSYKIPYRIEYQ
TTCA_BARBK       LSGGKDSYGLLALLLDLKWRGLLPVEILACNLDQGQPGFPKHILPDFLKSYKIPHRIEYQ
TTCA_BRUAB       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUA2       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUO2       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUSU       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUC2       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUSI       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_BRUME       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLTRYGIEHRIEYQ
TTCA_OCHA4       LSGGKDSYGLLALLLDLKWRGLLPVELLAVNLDQGQPNFPKHILPDFLNRYEIEHRIEYQ
TTCA_CHESB       LSGGKDSYGLLAVLLDLKWRGLLPVELLACNLDQGQPNFPKHILPDYLTRLGVPHRIEYQ
TTCA_RHILO       LSGGKDSYGLLALLLDLKWRGLLPVELLACNLDQGQPNFPKHILPDYLNANGIAHRIEYQ
TTCA_RHOS4       LSGGKDSYTLLAVLHELKWRGLLPVDLLACNLDQGQPGFPATVLPEFLSRMGVPHRIEYQ
TTCA_RHOS1       LSGGKDSYTLLAVLHELKWRGLLPVDLLACNLDQGQPGFPATVLPEFLSRMGVPHRIEYQ
TTCA_RHOS5       LSGGKDSFTLLAALIELKWRGLLPVELLACNLDQGQPGFPATVLPEFLARMGIPHRIEYQ
TTCA_RUEPO       LSGGKDSYTLLAVLYELKWRGLLPVDLLACNLDQGQPGFPSTVLPEFLDRMGVPNRIEYQ
TTCA_RUEST       LSGGKDSYTLLAVLYELKWRGLLPVDLLACNLDQGQPGFPATVLPEFLEKMQVPHRIEYQ
TTCA_ROSDO       LSGGKDSYTLLAVLYELKWRGLLPVELLACNLDQGQPGFPATVLPEFLKKMEVPHRVEYQ
TTCA_DINSH       LSGGKDSYTLLAALTELQWRGLLPVEILACNLDQGQPGFPATVLPEFLERMGVPHRIEYQ
TTCA_PARDP       LSGGKDSYTLLAVLHELKWRGLLPVELLACNLDQGQPGFPATVLPEFLTQRQVPHRIEYQ
TTCA_HYPNA       LSGGKDSYGLLAVLLDLQWQGALPVDLIACNLDQGQPGFPKHILPEWLTQNGVTHKIITE
TTCA_ACAM1       LSGGKDSYTLLDILLHLQRAAPIDFEILAVNLDQKQPNFPEQVLPNYLNQLQVPYRIVEE
TTCA_ALKEH       LSGGKDSYALLDVLLRLQKRAPVRFELVAVNLDQKQPGFPEHVLPEYLASLGVPYRILEA
TTCA_XYLF2       LSGGKDSYTLLDMLLQLRAKAPVPFELTAVNLDQKQPGFPKHVLPEYLSSIGVPYHIIEQ
TTCA_XYLFT       LSGGKDSYTLLDMLLQLRAKAPVPFELTAVNLDQKQPGFPKHVLPEYLSSIGVPYHIIEQ
TTCA_XYLFM       LSGGKDSYTLLDMLLQLRAKAPVPFELTAVNLDQKQPGFPKHVLPEYLSSIGVPYHIIEQ
TTCA_XYLFA       LSGGKDSYTLLDMLLQLRAKAPVPFELTAVNLDQKQPGFPKHVLPEYLSSIGMPHHIIEQ
TTCA_STRMK       LSGGKDSYTLLDVLLQLQKKAPVPFELVAVNLDQKQPDFPEHVLPEYLAGLGVPYHIIEQ
TTCA_XANAC       LSGGKDSYTLLDMLLQLQRKAPVPFSLVAVNLDQKQPDFPAHVLPAYLRGLGVPFAIVEQ
TTCA_XANC5       LSGGKDSYTLLDMLLQLQRKAPVPFSLVAVNLDQKQPDFPAHVLPAYLRGLGVPFDIVEQ
TTCA_XANOR       LSGGKDSYTMLDMLLQLQRKAPVPFTLVAVNLDQKQPDFPAHVLPAYLDALGVPFDIVEQ
TTCA_XANOM       LSGGKDSYTMLDMLLQLQRKAPVPFTLVAVNLDQKQPDFPAHVLPAYLDALGVPFDIVEQ
TTCA_XANOP       LSGGKDSYTMLDMLLQLQRKAPVPFTLVAVNLDQKQPDFPAHVLPAYLDALGVPFDIVEQ
TTCA_XANCP       LSGGKDSYTLLDMLLQLQRSAPVPFTLVAVNLDQKQPDFPADVLPTYLRAQQVPFDIIEQ
TTCA_XANCB       LSGGKDSYTLLDMLLQLQRSAPVPFTLVAVNLDQKQPDFPADVLPTYLRAQQVPFDIIEQ
TTCA_XANC8       LSGGKDSYTLLDMLLQLQRSAPVPFTLVAVNLDQKQPDFPADVLPTYLRAQQVPFDIIEQ
TTCA_METCA       LSGGKDSFTLLDILLKLRINAPVNFDLVAVNLDQKQPGFPADVLPNYLSEQGIPFHIIEQ
TTCA_ACIBC       VSGGKDSYTLLDILLQFKRIAPINFDIVAVNLDQKQPGFPEDVLPRYMEENNIPYYILEK
TTCA_ACIBY       VSGGKDSYTLLDILLQFKRIAPINFDIVAVNLDQKQPGFPEDVLPRYMEENNIPYYILEK
TTCA_ACIBT       VSGGKDSYTLLDILLQFKRIAPINFDIVAVNLDQKQPGFPEDVLPRYMEENNIPYYILEK
TTCA_ACIAD       VSGGKDSYTLLDILLQFKRIAPINFDIVAVNLDQKQPGFPEDVLPRYMEENNIPYYILEK
TTCA_PSYA2       VSGGKDSYTLLDILLLLKRIAPIHFDIVAVNLDQKQPGYPEEVLPAYLNEQGIAHYILEK
TTCA_PSYCK       VSGGKDSYTLLDILLLLKRIAPIHFDIVAVNLDQKQPGYPEEVLPAYLNEQGIAHYILEK
TTCA_PSYWF       VSGGKDSYTLLDILLFLKRIAPINFDVVAVNLDQKQPGYPEEVLPNYLQQQGIPHYILEK
TTCA2_FRATF      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA2_FRATH      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA2_FRATO      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA_FRATM       LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA1_FRATT      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA1_FRAT1      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA1_FRATW      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIER
TTCA1_FRATN      LSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIQR
TTCA2_FRAP2      LSGGKDSYCLLEMLLLLQQKAPIKFDIVAVNLDQKQPGFPEEVLPNYLKTKNIEFHIIER
TTCA_NEIMB       LSGGKDSYALLDILRQLQASAPIDFQLVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEE
TTCA_NEIMA       LSGGKDSYALLDILRRLQASAPIDFQLVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEE
TTCA_NEIM0       LSGGKDSYALLDILRQLQASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEE
TTCA_NEIMF       LSGGKDSYALLDILRQLQASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEE
TTCA_NEIG1       LSGGKDSYALLDILRRLQASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEE
TTCA_HAEIN       LSGGKDSYTLLDILLNLQQSAPIKFDIVAVNLDQKQPGFPEHVLPEYLESIGVDYKIVQE
TTCA_HAEIE       LSGGKDSYTLLDILLNLQQSAPIKFDIVAVNLDQKQPGFPEHVLPEYLESIGVDYKIVQE
TTCA_HAEI8       LSGGKDSYTLLDILLNLQQNAPIKFDIVAVNLDQKQPGFPEHVLPEYLESIGVDYKIVQE
TTCA_ACTPJ       LSGGKDSYTLLDILLNLKLSAPIHFDIVAVNLDQKQPGFPEHILPEYLESIGVEYKIVEE
TTCA_ACTP2       LSGGKDSYTLLDILLNLKLSAPIHFDIVAVNLDQKQPGFPEHILPEYLESIGVEYKIVEE
TTCA_HAEDU       LSGGKDSYTLLDILLNLKLSAPINFDIVAVNLDQKQPGFPEHILPEYLASIGVEYKIVQE
TTCA_HAES1       LSGGKDSYTLLDILLNLRLNAPIHFDIVAVNLDQKQPGFPEHILPEYLKSISVDYKIVAE
TTCA_HISS2       LSGGKDSYTLLDILLNLRLNAPIHFDIVAVNLDQKQPGFPEHILPEYLKSISVDYKIVAE
TTCA_PASMU       LSGGKDSYTLLDILLNLRLNAPIHFEIVAVNLDQKQPGFPEHILPEYLQSIGVDYKIVEE
TTCA_ACTSZ       LSGGKDSYTLLDILLNLKFSAPIHFDIVAVNLDQKQPGFPEHVLPQYLESIGVEYKIVEE
TTCA_MANSM       LSGGKDSYTLLDILLNLRHNAPVHFDIVAVNLDQKQPGFPEHILPEYLSSIGVEYKIVEE
TTCA_SALPA       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_SALPB       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_SALTY       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_SALTI       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_SALCH       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEPLGVEYKIVEE
TTCA_SALAR       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_ECO57       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_SHISS       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_ECOLI       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_ECODH       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_SHIBS       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_SHIB3       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPVYLEKLGVEYKIVEE
TTCA_SHIDS       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLLEYLEKLGVEYKIVEE
TTCA_ECOUT       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEE
TTCA_ECOK1       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEE
TTCA_ECOL6       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEE
TTCA_ECOL5       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEE
TTCA_ECOLC       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_ECO24       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_ECOHS       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_SHIFL       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_SHIF8       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEE
TTCA_ECOSM       LSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEE
TTCA_CITK8       LSGGKDSYTMLEILRNLQQSAPVNFSLVAVNLDQKQPGFPEHILPEYLENLGVEYKIVEE
TTCA_KLEP7       LSGGKDSYTMLEILRNLQKSAPISFSLVAVNLDQKQPGFPEHILPAYLEQLGVEYKIVEE
TTCA_ENT38       LSGGKDSYTMLEILRNLQQSAPVKFSLVAVNLDQKQPGFPEHILPEYLEQQGVEYKIVEE
TTCA_CROS8       LSGGKDSYTMLEILRNLQQSAPVNFSLVAVNLDQKQPGFPEHILPEYLSSLGVEYKIVEE
TTCA_YERPE       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPP       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPG       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPA       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPN       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERP3       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPY       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPS       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERPB       LSGGKDSYTMLDILQSLQKSAPINFSLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_YERE8       LSGGKDSYTMLDILQNLQKSAPINFTLIAVNLDQKQPGFPEDILPAYLDKQGVEYKIVEE
TTCA_PECAS       LSGGKDSFTMLEILRNLQQSAPINFSLVAVNLDQKQPGFPEHILPQYLDNIGVEYKIVEE
TTCA_SERP5       LSGGKDSYTMLEILRNLQQSAPVNFSLVAVNLDQKQPGFPEHILPAYLESLGVEYQIVEE
TTCA_SODGM       LSGGKDSYTLLEILRNLQQSAPVNFSLVAVNLDQKQPGFPAHVLPEYLAAQGVEYHIVTE
TTCA_PHOLL       LSGGKDSYTLLSILQNLQKSAPVNFSLVAVNLDQKQPGFPEHILPAYLGELGVEYKIVEE
TTCA_AERHH       LSGGKDSFAMLDILMSLKASAPIHFDLVAVNLDQKQPGFPEHVLPEYLTTLGIDFKIVEE
TTCA_AERS4       LSGGKDSFAMLDILMSLKASAPIHFDLVAVNLDQKQPGFPEHVLPEYLATLGVDFKIVEE
TTCA_COLP3       LSGGKDSYAMLSILMLLKESAPIHFDIIAVNLDQKQPGFPEHILPEYLDKLGIEYHIVEE
TTCA_PSYIN       LSGGKDSFTMLDILLELRAAAPIHFEIIAVNLDQKQPDFPEHILPEYLQKLGVDYKIVEE
TTCA_IDILO       LSGGKDSYTLLDTLLYLQKVAPVRFSLVAVNLDQKQPGFPEHVLPAYLNKLGVDYKIVEE
TTCA_PSEHT       LSGGKDSYTMLDMLQHLKRVAPIKFELFVVNLDQKQPGFPEHVLPQYLDKLNVEYKIVEE
TTCA_VIBCH       LSGGKDSFTMLDILMSLQKSAPISFELVAVNLDQKQPGFPEHVLPEYLESLGVEYKIVEE
TTCA_VIBC3       LSGGKDSFTMLDILMSLQKSAPISFELVAVNLDQKQPGFPEHVLPEYLDSLGVEYKIVEE
TTCA_VIBVU       LSGGKDSFTMLDILISLQKSAPISFSLVAVNLDQKQPGFPAHVLPEYLESLGVEYKIVEE
TTCA_VIBVY       LSGGKDSFTMLDILMSLQKSAPISFSLVAVNLDQKQPGFPAHVLPEYLESLGVEYKIVEE
TTCA_ALIF1       LSGGKDSFTMLDILMSLKKSAPISFDLIAVNLDQKQPGFPAHILPEYLEKLGVEYKIVEE
TTCA_VIBCB       ISGGKDSFAMLDILLNLQKAAPIKFEVVAVNLDQKQPGFPEHILPDYFETLNIPYYIVDK
TTCA_VIBPA       ISGGKDSFAMLDILLNLQKAAPIKFEVVAVNLDQKQPGFPEHILPEYFETLNIPYYIVDK
TTCA_PHOPR       ISGGKDSFAMLDILLGLQKSAPINFKVIAVNLDQKQPGFPEHILPNYFESLGIPYYIVDK
TTCA_SACD2       LSGGKDSYAMLDILMGLQKAAPIKFDIVAVNMDQKQPGFPEHILPEYLDSLGIEYHIVER
TTCA_PSEAE       LSGGKDSYTMLDILLYLQKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEK
TTCA_PSEAB       LSGGKDSYTMLDILLYLQKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEK
TTCA_PSEA7       LSGGKDSYTMLDILLYLQKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEK
TTCA_PSEMY       LSGGKDSYTMLDVLLYLQKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLESIGVAYHIIEK
TTCA_PSEU5       LSGGKDSYTMLDVLLYLQKVAPIRFEVVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIIEK
TTCA_PSEE4       LSGGKDSYTMLDVLLHLQKVAPIKFDIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_PSEPW       LSGGKDSYTMLDVLLHLQKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_PSEPG       LSGGKDSYTMLDVLLHLQKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_PSEP1       LSGGKDSYTMLDVLLHLQKVAPITFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_PSEPK       LSGGKDSYTMLDVLLHLQKVAPITFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_PSEF5       LSGGKDSYTMLDVLLHLQKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVEK
TTCA_PSEPF       LSGGKDSYTMLDVLMHLQKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVEK
TTCA_PSE14       LSGGKDSYTMLDVLMHLQKVAPIKFDIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVEK
TTCA_PSEU2       LSGGKDSYTMLDVLMHLQKVAPIKFDIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVEK
TTCA_PSESM       LSGGKDSYTLLDVLMHFQKVAPIRFDIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVEK
TTCA_SHEB8       LSGGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEHVLPAYLDKLNVPYHILEK
TTCA_SHEB9       LSGGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEHVLPAYLEKLNVPYHILEK
TTCA_SHEB5       LSGGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEHVLPAYLEKLNVPYHILEK
TTCA_SHEPC       LSGGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEDILPAYLDKLKVPYHILEK
TTCA_SHESW       LSGGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEDILPAYLDKLKVPYHILEK
TTCA_SHESA       LSGGKDSYAMLDILLNLQQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEK
TTCA_SHESM       LSGGKDSYAMLDILLNLQQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEK
TTCA_SHESR       LSGGKDSYAMLDILLNLQQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEK
TTCA_SHEON       LSGGKDSYAMLDILLNLQQRAPVQFEIIAVNLDQKQPGFPEDVLPAYLDSLNVPYHILEK
TTCA_SHEAM       LSGGKDSYAMLDILINLQQRAPVSFEIVAVNLDQKQPGFPEHVLPAYLETLGVPFHILEK
TTCA_SHELP       LSGGKDSYAMLDILVNLLQRAPVNFNLVAVNLDQKQPGFPEDILPAYLDSLKVPYHILEK
TTCA_SHEHH       LSGGKDSYAMLDILLNLQQRAPIKFEIVAVNLDQKQPGFPEDILPAYLDTLGVAYHILEK
TTCA_SHEPA       LSGGKDSYAMLDILLNLQQRAPIKFEIVAVNLDQKQPGFPEDILPAYLDTLGVAYHILEK
TTCA_SHESH       LSGGKDSYAMLDILLNLQQRAPIKFEIVAVNLDQKQPGFPEEVLPAYLDTLNVPYHIIEK
TTCA_SHEWM       LSGGKDSYAMLDILLDLQQRAPIKFEIVAVNLDQKQPGFPEHVLPAYLDSLGVAYHILEK
TTCA_SHEDO       LSGGKDSYAMLDILLNLQKRAPISFEIVAVNLDQKQPGFPEHILPAYLDNLGVAYHILEK
TTCA_SHEFN       LSGGKDSYTMLDILLTLQQRAPIKFEIVAVNLDQKQPGFPEHVLPAYLDKLGVAYHILEK
TTCA_CHRSD       LSGGKDSYTMLDILMNLQRNAPVAFELVAVNLDQKQPGFPEHVLPEYLERVGVPYHIVER
TTCA_HAHCH       LSGGKDSYAMLDILLNLKKHAPISFEVIAVNLDQKQPGFPEHVLPEYLSSLGVEYYVIER
TTCA_MARHV       LSGGKDSYAMLDILLNLQKSAPVRFELIAVNLDQKQPGFPEHVLPDYLESMGIEYHIIEK
TTCA_ALCBS       LSGGKDSYTMLEILRNLQHSAPVNFELVAVNMDQKQPGFPEHILPEYLEKEGVAYHILEK
TTCA_MARMS       LSGGKDSYTMLEILRNLQASAPINFSIVAVNLDQKQPGFPEHILPAYLEELGVDFHILER
TTCA_CHRVO       LSGGKDSYTLLDILRGLQKSAPINFSIVAVNLDQKQPGFPEHVLPEYLKSIGVEYRIVEE
TTCA_NITEU       LSGGKDSYALLDILRNLQAHAPLDFELIAVNLDQKQPGFPEHVLPGYLSEINMPFRIVEQ
TTCA_NITEC       LSGGKDSYALLDILRNLQAHAPLDFELIAVNLDQKQPGFPEHVLPGYLSEINMPFRIVEQ
TTCA_NITMU       LSGGKDSYALLDILRSLQAHAATQFELIAVNLDQKQPGFPEHVLPNYLTSIGMPFRIVEQ
TTCA_NITOC       LSGGKDSYALLDILLSLQKHAPVKFDLIAVNLDQKQPGFPEHVLPHYLESLGVSYRIVEQ
TTCA_CYTH3       LSGGKDSYTMLDMFIHAQTVRK-NFEIIAVNLDQKQPDYPEHILPEYLTHLGVNFKIVEK
TTCA_PSEA6       LSGGKDSYTMLDMLLHMQKAAPISFSIIAVNLDQKQPGFPEHVLPNYLEGLGVDFAIIEE
TTCA_DICNV       LSGGKDSYALLDILLALQKSAPIHFEIIAVNLNQKFPNFPERVLPDYLEKLGVKYDIIEH
TTCA_AZOSB       VSGGKDSYTLLSCLLALRERAPVDFRIVAMNLDQKQPGFPDDVLPAYFESIGVEYRIVTE
TTCA_AROAE       VSGGKDSYTLLSCLLALRERAPVDFRIIAMNLDQKQPGFPAEVLPAYFESIGVEYRIVTE
TTCA_DECAR       VSGGKDSYTLLAMLMALQQRAPVKFRLIAMNLDQKQPGFPADILPRYFESIGIEYRIVEA
TTCA_CUPTR       MSGGKDSYTMLSVLMALQKRAPIKFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEA
TTCA_CUPNH       MSGGKDSYTMLSVLMALQKRAPIKFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEA
TTCA_CUPPJ       MSGGKDSYTMLSVLMALQKRAPIQFKLIAMNLDQKQPGFPEHVLPEYLKSTGVEYVIVEA
TTCA_CUPMC       MSGGKDSYTMLSVLTALQKRAPIQFKLIAMNLDQKQPGFPEHVLPAYLKSLGVEYVIVEA
TTCA_RALSO       LSGGKDSYTMLSVLMALQKRAPIDFKLIAMNLDQKQPGFPEDVLPGYLKKVGVEYVIVEA
TTCA_METFK       MSGGKDSYTMLMMLLALQERAPVNFKLIAMNLDQKQPGFPAHILPAYLEQLGVDHRIVEA
TTCA_ACISJ       MSGGKDSYTLLDILRKLQKRAPVKFDIVAVNLDQKQPGFPEHVLPDYFKSIGVQYHIENQ
TTCA_DELAS       MSGGKDSYTMLDVLRKLQKRAPVKFELVAVNLDQKQPGFPDHVLPEYFKSIGVDYHIETQ
TTCA_ACIAC       MSGGKDSYTLLDILIKLQKRAPIHFDLVAVNLDQKQPGFPEHILPEYLAATGVPFHIENQ
TTCA_VEREI       MSGGKDSYTLLDILLKLRARAPIAFDLVAVNLDQKQPGFPAHVLPGYLASAGVPYHIETE
TTCA_POLNA       VSGGKDSYAMLDILLKLQKRAPINFELVAVNLDQKQPGFPEHVLPEYLSKLGVPYHIENQ
TTCA_POLSJ       VSGGKDSYAMLDILLKLQKRAPIRFDLIAVNLDQKQPGFPKHVLPDYLGKLDVPFHIENQ
TTCA_RHOFT       VSGGKDSYGLLDILLKMQQRAPINFEIVAVNLDQKQPGFPAHILPEYLAKLGIEFHIETQ
TTCA_BORBR       LSGGKDSYALLDILLSLQKRAPFAFEIIAVNLDQKQPGFPPEILPDYLRALGVPFHIETQ
TTCA_BORPE       LSGGKDSYALLDILLSLQKRAPFAFEIIAVNLDQKQPGFPPEILPDYLRALGVPFHIETQ
TTCA_BORPA       LSGGKDSYALLDILLSLQKRAPFAFEIIAVNLDQKQPGFPPEILPGYLRALGVPFHIETQ
TTCA_BORPD       LSGGKDSYALLDILLSLRKRAPFSFDIVAVNLDQKQPGFPPEVLPNYLTSLGVPFHIETQ
TTCA_BORA1       LSGGKDSYAMLDILMALQKRAPFRFELIAVNLDQKQPGFPADILPNYLSSLGVPFHIETQ
TTCA_LEPCP       LSGGKDSYGMLDILLGLQQRAPITFSIVAVNLDQKQPGFPEHILPAYLKARGVEFHIENQ
TTCA_METPP       VSGGKDSYALLDILLNLQQRAPIDFSLVAVNLDQKQPDFPEHVLPEYLASRGVPFHIENQ
TTCA_BURCM       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTQIGVPFHIENQ
TTCA_BURA4       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTQIGVPFHIENQ
TTCA_BURVG       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTQIGVPFHIENQ
TTCA_BURCA       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLKQVGVPFHIENQ
TTCA_BURCH       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLKQVGVPFHIENQ
TTCA_BURCC       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLKQVGVPFHIENQ
TTCA_BURL3       LSGGKDSYAMLDVLLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLKQVGVPFHIENQ
TTCA_BURM1       LSGGKDSYAMLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTQIGVPFHIENQ
TTCA_BURMA       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURM9       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURPS       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURP0       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURP1       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURP6       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURM7       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURMS       LSGGKDSYALLDILLRLRERAPIDFDIVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_BURTA       LSGGKDSYALLDILLRLRERAPIDFDLVAVNLDQKQPGFPEHVLPEYLTKIGVPFHIENQ
TTCA_PARPJ       LSGGKDSYAMLEILMRLRERAPINFDIVAVNLDQKQPGFPEHVLPEYLKQLDIPFHIENQ
TTCA_PARXL       LSGGKDSYAMLEILMRLRERAPINFDIVAVNLDQKQPGFPEHVLPEYLKQLDIPFHIENQ
TTCA_PARP8       LSGGKDSYAMLDVLMRLRERAPIHFDIVAVNLDQKQPGFPEHVLPEYLSKLDIPYHIENQ
TTCA_HERAR       LSGGKDSYALLDILMTLRERAPIKFDIVAVNLDQKQPNFPEHILPAYLKQLDIPFHIENQ
TTCA_JANMA       LSGGKDSYALLDILMTLRERAPIKFDIVAVNLDQKQPNFPDHILPAYLKQLDIPFHIENQ
TTCA_POLAQ       VSGGKDSYAMLDILMKLRERAPIDFEIVAVNLDQKQPNFPAETLPNYLRSLGIPFHIEEQ
TTCA_DEIGD       LSGGKDSYTLLDILLHLQKRAPIHFEVVAVNLDQGQPGFPKHVLPEYLTRLGVPFDILTE
TTCA_DEIRA       LSGGKDSYTLLDVLLHLQKKAPIDFEVVAVNLDQGQPGFPKDVLPRYLTALGVRHDILTE
TTCA_COXBU       LSGGKDSYTLLSLLNSIRIEGNYKFDIFAFVLDQSQPGWDDSALRGWLDDKKIPYEILTR
TTCA_COXBR       LSGGKDSYTLLSLLNSIRIEGNYKFDIFAFVLDQSQPGWDDSALRGWLDDKKIPYEILTR
TTCA_COXBN       LSGGKDSYTLLSLLNSIRIEGNYKFDIFAFVLDQSQPGWDDSALRGWLDDKKIPYEILTR
TTCA_LEGPL       LSGGKDSFTLLTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTR
TTCA_LEGPH       LSGGKDSFTLLTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTR
TTCA_LEGPA       LSGGKDSFTLLTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTR
TTCA_LEGPC       LSGGKDSFTLLTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTR
TTCA1_FRATF      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA1_FRATO      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA1_FRATH      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA2_FRATT      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA2_FRAT1      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA2_FRATW      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA2_FRATN      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDDLGVSYEIETK
TTCA1_FRAP2      LSGGKDSFGLLKVLHGLIEDKTYDIDLHVYTLDQSQPGWDDSQLRKYLDNLGVSYEIETK
TTCA_BDEBA       VSGGKDSSVLLALLTEIQRRSERKFQIEAAILDQKQPGFDVSKFKVWVESLGVPFHIVEK
TTCA_SORC5       VSGGKDSYAMHALLVDLARRAPVRFSVIAVNIDQGHPGYPGHLLTDYMAAGGHEFRMISE
TTCA_GEOMG       VSGGKDSYTLLHILEALRRRAPVKYDLVAFTIDSGYPGFRSDVIAAHLKEHGFSHHVEAT
TTCA_GEOSL       VSGGKDSYTLLHILEGLRRRAPVKYELVAVTIDSGYPGFRSDVIASYLREQGFAHHLETT
TTCA_GEOUR       VSGGKDSYTLLHILETLRKRAPVRYEIMAINIDSGYPGFRADIIEEHLREHGFVAHMEKT
TTCA_PELPD       VSGGKDSYTLLLLLEELRRRAPIDFQLVAVIIDSGYPGYRGDIVRDYVTSLGIPCHLETT
TTCA_PELCD       VSGGKDSWTLLHILDSLRRRAPIRYELIAVNVDPGFPGYRTDIMEAHLREYGFANRMERT
                 :******  :   :            : .  ::   *.:    .   .        :   

TTCA_ANADE       DTYSVVRRLVPEGKTTCPVCSRLRRGVLYNAAVEMGCTKIALGHHRDDLVETLLLSALYS
TTCA_ANADF       DTYSIVRRLVPEGKTTCPVCSRLRRGVLYNAAAEMGCTKIALGHHRDDLVETLLLSALYS
TTCA_MYXXD       DTYSIVLEKTPPGKTQCSVCSRMRRGILYTAAVELGCTKIALGHHRDDLIHTLLLNLFFA
TTCA_RHIEC       DTYSIVKEKVPEGATYCSLCSRLRRGNLYRIAREEGCDALVLGHHREDILETFFMNFFHG
TTCA_RHIL3       DTYSIVKEKVPEGATYCSLCSRLRRGNLYRVAREEGCDALVLGHHREDILETFFMNFFHG
TTCA_AGRFC       DTYSIVKEKVPSGGTYCSLCSRLRRGNLYRIAREEGCDALLLGHHREDILETFFMNFFHG
TTCA_RHIME       DTYSIVKEKVPAGATYCSLCSRLRRGNLYRIGREEGCDALVLGHHREDILETFFMNFFHG
TTCA_SINMW       DTYSIVKEKVPAGATYCSLCSRLRRGNLYRIAREEGCDALVLGHHREDILETFFMNFFHG
TTCA_BARHE       DTYSIVTDKLVHTQTYCSLCSRLRRGNLYRIAREEGCSALVLGHHRDDVLETFFMNLFHG
TTCA_BART1       DTYSIVTDKLAQTQTYCSLCSRLRRGNLYRIAREEGCSALILGHHRDDVLETFFMNLFHG
TTCA_BARBK       DTYSIVTGKLAQTQTYCSLCSRLRRGHLYRIAREEGCSALVLGHHRDDVLETFFMNLFHG
TTCA_BRUAB       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUA2       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUO2       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUSU       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUC2       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUSI       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_BRUME       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_OCHA4       DTYSIVTDKLPETSTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHREDILETFFMNLFHG
TTCA_CHESB       DTYSVVTEKIPENRTYCSLCSRLRRGHLYRIAREEGCSSLVLGHHREDILETFFMNFFHG
TTCA_RHILO       DTYSVVTNKLPEGSTYCSLCSRLRRGHLYRIAREEGCSALVLGHHREDILETFFMNLFHG
TTCA_RHOS4       DTYSIVMDKIPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHRDDILETFFMNLFHG
TTCA_RHOS1       DTYSIVMDKIPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHRDDILETFFMNLFHG
TTCA_RHOS5       DTYSIVVDKIPQGRTYCSLCSRLRRGNLYRIAREEGCSAIVLGHHRDDILETFFMNLFHG
TTCA_RUEPO       DTYSVVVDKVPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHRDDILETFFMNLFHG
TTCA_RUEST       DTYSIVMDKVPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHRDDILETFFMNLFHG
TTCA_ROSDO       DTYSIVMDKVPQGRTLCALCSRLRRGHLYRIAREEGCSAVVLGHHRDDILETFFMNLFHG
TTCA_DINSH       DTYSIVMDKVPAGRTYCALCSRLRRGNLYRIAREEGCSAVLLGHHRDDILETFFMNLFHG
TTCA_PARDP       DTYSIVKEKVPEGRTYCSLCSRLRRGNLYRIAREEGCQAVVLGHHRDDILETFFMNLFHG
TTCA_HYPNA       DTYSIVTDKVPEGRTYCSMCSRLRRGILYRVAREEGCEAIVLGHHRDDALATFMMNLIHG
TTCA_ACAM1       DTYSTVKRVIPEGKTMCGLCSRLRRGILYRVAQEEQATKIALGHHREDIIETLFLNLFHA
TTCA_ALKEH       DTYSTVERVIPEGKTKCSLCSRLRRGLLYGAAEEMGCSKIALGHHRDDILETFFLNLFYG
TTCA_XYLF2       DTYSVVTRVVPEGKTLCALCSRMRRGALYAYAETQGFTKIALGHHRDDMVATFFMNLFHH
TTCA_XYLFT       DTYSVVTRVVPEGKTLCALCSRMRRGALYAYAETQGFTKIALGHHRDDMVATFFMNLFHH
TTCA_XYLFM       DTYSVVTRVVPEGKTLCALCSRMRRGALYAYAETQGFTKIALGHHRDDMVATFFMNLFHH
TTCA_XYLFA       DTYSVVTRVVPEGKTLCALCSRMRRGALYAYAETQGFTKIALGHHRDDMVATFFMNLFHH
TTCA_STRMK       DTYSVVSRVIPEGKTMCSLCSRLRRGALYNYAETHGFTKIALGHHRDDMVATFFMNLFHH
TTCA_XANAC       DTYSVVSRVIPAGKTMCSLCSRLRRGALYAYAQTHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANC5       DTYSVVSRVIPAGKTMCSLCSRLRRGALYAYAQTHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANOR       DTYSVVSRVVPAGKTMCSLCSRLRRGALYAYAQTHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANOM       DTYSVVSRVVPAGKTMCSLCSRLRRGALYAYAQTHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANOP       DTYSVVSRVVPAGKTMCSLCSRLRRGALYAYAQTHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANCP       DTYSVVSRVIPQGKTMCSLCSRLRRGALYAYAQAHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANCB       DTYSVVSRVIPQGKTMCSLCSRLRRGALYAYAQAHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_XANC8       DTYSVVSRVIPQGKTMCSLCSRLRRGALYAYAQAHGVTKIALGHHRDDIVATFFMNLFHH
TTCA_METCA       DTYSVVKSIIPEGKTTCGLCSRLRRGLLYRYAADHGITKIALGHHRDDILETFFLNLFYG
TTCA_ACIBC       DTYSITKRLTPEGKTYCAVCSRLRRGSLYGFAQEIGATKVALGHHRDDIIATFFLNLFHG
TTCA_ACIBY       DTYSITKRLTPEGKTYCAVCSRLRRGSLYGFAQEIGATKVALGHHRDDIIATFFLNLFHG
TTCA_ACIBT       DTYSITKRLTPEGKTYCAVCSRLRRGSLYGFAQEIGATKVALGHHRDDIIATFFLNLFHG
TTCA_ACIAD       DTYTITKRLTPEGKTYCAVCSRLRRGSLYGFAQEIGATKVALGHHRDDIIATFFLNLFHG
TTCA_PSYA2       DTYSIVKSVVPEGKTYCSACSRLRRGSLYGFAKQIGATKIALGHHRDDMLATFFLNLFHG
TTCA_PSYCK       DTYSIVKSVVPEGKTYCSACSRLRRGSLYGFAKQIGATKIALGHHRDDMLATFFLNLFHG
TTCA_PSYWF       DTYSVVKSVVPEGKTYCSACSRLRRGSLYGFAKQIGATKIALGHHRDDILATFFLNLFHG
TTCA2_FRATF      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA2_FRATH      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA2_FRATO      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA_FRATM       DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA1_FRATT      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA1_FRAT1      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA1_FRATW      DTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYN
TTCA1_FRATN      DTYSVVKRVIPEGKTTCGLCSRMRRGILYDFAEENSVTKVALGHHRDDIIETFFLNLFYN
TTCA2_FRAP2      DTYSVVKRVIPDGKTTCGLCSRMRRGILYDFAEQNNITKVALGHHRDDIIETFFLNLFYN
TTCA_NEIMB       DTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATLFLNMFYG
TTCA_NEIMA       DTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATLFLNMFYG
TTCA_NEIM0       DTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFLNMFYG
TTCA_NEIMF       DTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFLNMFYG
TTCA_NEIG1       DTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFLNMFYG
TTCA_HAEIN       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFLNMFYG
TTCA_HAEIE       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFLNMFYG
TTCA_HAEI8       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFLNMFYG
TTCA_ACTPJ       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_ACTP2       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_HAEDU       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYN
TTCA_HAES1       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_HISS2       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_PASMU       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_ACTSZ       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFLNMFYG
TTCA_MANSM       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFLNMFYG
TTCA_SALPA       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SALPB       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SALTY       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SALTI       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SALCH       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SALAR       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECO57       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SHISS       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOLI       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECODH       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SHIBS       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGTTKIALGHHRDDILQTLFLNMFYG
TTCA_SHIB3       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SHIDS       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOUT       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOK1       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOL6       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOL5       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOLC       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECO24       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ECOHS       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SHIFL       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGTTKIALGHHRDDILQTLFLNMFYG
TTCA_SHIF8       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGTTKIALGHHRDDILQTLFLNMFYG
TTCA_ECOSM       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_CITK8       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_KLEP7       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_ENT38       NTYGIVKDKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_CROS8       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPE       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPP       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPG       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPA       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPN       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERP3       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPY       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPS       NTYGIVKEIIPDGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERPB       NTYGIVKEIIPDGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_YERE8       NTYGIVKEIIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_PECAS       NTYGIVKDKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SERP5       NTYSIVKDKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_SODGM       DTYHIVKDKIPEGKTTCSLCSRLRRGILYRTATELGATRIALGHHQDDILQTLFLNMFYG
TTCA_PHOLL       NTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYG
TTCA_AERHH       DTYAIVKEKVPEGKTTCALCSRLRRGILYRTAQELGCTKIALGHHRDDILETLFLNMFYG
TTCA_AERS4       DTYSIVKDKVPEGKTTCALCSRLRRGILYRTAQELGCTKIALGHHRDDILETLFLNMFYG
TTCA_COLP3       DTYGIVKEKVPEGKTTCSLCSRLRRAVLYKAAKKIGATKIALGHHRDDMIETLMLNMFYG
TTCA_PSYIN       DTYSIVQDKIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDLLATLMLNMFFG
TTCA_IDILO       DTYSIVKEKIPEGKTTCSLCSRLRRGILYRTAKELKATKIALGHHRDDMIETLFLNMFHG
TTCA_PSEHT       DTYSIVTDIIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDMIETLFLNMFYG
TTCA_VIBCH       DTYAIVQDKVPEGKTTCALCSRLRRGILYRTAKELGATKIALGHHRDDILETLFLNMFYG
TTCA_VIBC3       DTYSIVQDKVPEGKTTCALCSRLRRGILYRTAKELGATKIALGHHRDDILETLFLNMFYG
TTCA_VIBVU       DTYSIVQDKIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDILETLFLNMFYG
TTCA_VIBVY       DTYSIVQDKIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDILETLFLNMFYG
TTCA_ALIF1       DTYSIVQDKIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDILETMFLNMFYG
TTCA_VIBCB       DTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKIGATKLALGHHMDDIVETMFLNMFHG
TTCA_VIBPA       DTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKIGATKLALGHHMDDIVETMFLNMFHG
TTCA_PHOPR       DTYSVVREKIPEGKTTCGLCSRLRRGTLYSFAEKIGATKIALGHHMDDMVETMFLNMFYG
TTCA_SACD2       DTYSVVKSVIPEGKTTCGLCSRLRRGTLYGFAERIGATKIALGHHRDDIVETLFLNMFYG
TTCA_PSEAE       DTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFLNMFYG
TTCA_PSEAB       DTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFLNMFYG
TTCA_PSEA7       DTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFLNMFYG
TTCA_PSEMY       DTYSVVKEKIPEGKTTCSLCSRLRRGTLYTYADEIGATKMALGHHRDDILETFFLNMFYG
TTCA_PSEU5       DTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFLNMFYG
TTCA_PSEE4       DTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEPW       DTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEPG       DTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEP1       DTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEPK       DTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEF5       DTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFYN
TTCA_PSEPF       DTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSE14       DTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSEU2       DTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFN
TTCA_PSESM       DTHSVVKELIPEGKTTCSLCSRLRRGTLYTFADQIGATKMALGHHRDDIIETFFLNMFFN
TTCA_SHEB8       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHEB9       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHEB5       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHEPC       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHESW       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHESA       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYG
TTCA_SHESM       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYG
TTCA_SHESR       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYG
TTCA_SHEON       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
TTCA_SHEAM       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFYG
TTCA_SHELP       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETMFLNMFYA
TTCA_SHEHH       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETMFLNMFFA
TTCA_SHEPA       DTYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETMFLNMFFA
TTCA_SHESH       DTYSVVREKIPEGQKTCSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETLFLNMFFA
TTCA_SHEWM       DTYSIVRDKIPEGQKTCSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETLFLNMFFA
TTCA_SHEDO       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFA
TTCA_SHEFN       DTYSIVKEKIPEGKTTCSLCSRLRRGTLYGFAQHIGATKIALGHHRDDIIETMFLNMFYA
TTCA_CHRSD       DTYSVVKEKTPEGKTTCALCSRLRRGTLYGFAEEIGANKVALGHHREDMLETLFLNMFFG
TTCA_HAHCH       DTYSIVKDKIPEGKTTCGLCSRLRRGILYDFAVEHKCTKIALGHHRDDIMETLFLNMFYG
TTCA_MARHV       DTYSIVKEKVPEGKTTCGLCSRLRRGILYNFAEEHGVTKIALGHHRDDLLETLFLNMFYG
TTCA_ALCBS       DTYSIVKEKVPEGKTTCGLCSRLRRGSLYGFAEEIGANKIALGHHRDDIVETLFLNMFYG
TTCA_MARMS       DTYSIVKEIVPEGKTTCGLCSRLRRGSLYGFAEEIGATKIALGHHRDDILETLFLNMFFG
TTCA_CHRVO       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVADELGATKIALGHHRDDILHTLFLNMFYG
TTCA_NITEU       DTYSVVKRVIAEGKTTCSLCSRLRRGVLYRVATELGATKIALGHHRDDILETFFLNMFYG
TTCA_NITEC       DTYSVVKRVIPEGKTTCSLCSRLRRGVLYRVATELGATKIALGHHRDDILETFFLNMFYG
TTCA_NITMU       DTYSVVKRLIPEGKTTCSLCSRLRRGVLYRVADELGATKIALGHHRDDILETLLLNLFHG
TTCA_NITOC       DTYSVVKRVIPEGKTTCSLCSRLRRGILYGTAEELGATKIALGHHRDDILETFFLNMFHG
TTCA_CYTH3       DTYSIVIDKTPAGKTMCSLCSRLRRGSLYATAEELGVTKIALGHHREDVLETFFLNLFFS
TTCA_PSEA6       DTYSIVVDKVPEGKTTCSLCSRLRRGILYSNAIKMGVTKIALGHHRDDMLETLFLNMFHN
TTCA_DICNV       DTYQVVMEKIPAGKTMCSLCSRLRRGILYRYAEEHGITKIALGHHKIDVIETFFLNLFFT
TTCA_AZOSB       DTYSIVKDKIPEGKTTCSLCSRLRRGIIYRTAKEIGATRIALGHHRDDMLETLFLNMFFG
TTCA_AROAE       DTYSIVKDKIPEGKTTCSLCSRLRRGIIYRVARELGATRIALGHHRDDMLETLFLNLFFG
TTCA_DECAR       DTYSVVKEKIPEGKTTCSLCSRLRRGIIYRTAKELGANKIALGHHRDDMVHTLFLNLLFG
TTCA_CUPTR       DTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFG
TTCA_CUPNH       DTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVQTFFLNMFFG
TTCA_CUPPJ       DTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFG
TTCA_CUPMC       DTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFG
TTCA_RALSO       DTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFG
TTCA_METFK       DTYSIVKEKIPEGKTTCSLCSRLRRGIIYRTAQELGANKIALGHHRDDIVETLFLNMFFG
TTCA_ACISJ       DTYSVVKRVVPEGKTTCSLCSRLRRAILYKVADDLGCTKLALGHHRDDIVATLMLNMFYG
TTCA_DELAS       DTYSVVKRVVPEGKTTCGLCSRLRRAILYKVADELGCTKVALGHHRDDIVQTLMLNMFYG
TTCA_ACIAC       DTYSIVKRVVPEGKTTCGLCSRLRRGILYRVADELGCTKIALGHHRDDILQTLLLNMFFG
TTCA_VEREI       DTYGIVKRLIPEGKTTCSLCSRLRRGILYRVASELGCTKIALGHHRDDILQTLLLNMFFG
TTCA_POLNA       DTYSIVTRVIPEGKTLCSLCSRLRRGILYRVAGELGCTKIALGHHRDDMLQTFFLNMFFA
TTCA_POLSJ       DTYSIVKRVIPEGKTLCSLCSRLRRGILYRVAGELGATKIALGHHRDDMLQTFFLNMFFA
TTCA_RHOFT       DTYSIVKKVIPEGKTMCSLCSRLRRGILYRVADELKITKIALGHHRDDMLQTFFLNMFFG
TTCA_BORBR       DTYSIVTRVIPEGKTMCSLCSRLRRGILYRVASELGATKIALGHHRDDILGTFFLNLFYG
TTCA_BORPE       DTYSIVTRVIPEGKTMCSLCSRLRRGILYRVASELGATKIALGHHRDDILGTFFLNLFYG
TTCA_BORPA       DTYSIVTRVIPEGKTMCSLCSRLRRGILYRVASELGATKIALGHHRDDILGTFFLNLFYG
TTCA_BORPD       DTYSIVTRVIPEGKTMCSLCSRLRRGILYRVAGELGATKIALGHHRDDILATFFLNLFYG
TTCA_BORA1       DTYSIVTRVLAEGKTMCSLCSRLRRGILYRVADELGATKIALGHHRDDILGTLFLNLFYG
TTCA_LEPCP       DTYSIVKRVIPEGKTMCSLCSRLRRGILYRVADELGATKIALGHHRDDFLGTVFLNMFFG
TTCA_METPP       DTYSIVKRVVPEGKTMCSLCSRLRRGILYRVAGELGATKIALGHHRDDMLQTLFLNMFFG
TTCA_BURCM       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNMFYG
TTCA_BURA4       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNMFYG
TTCA_BURVG       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNMFYG
TTCA_BURCA       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURCH       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURCC       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURL3       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURM1       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURMA       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURM9       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURPS       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURP0       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURP1       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURP6       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURM7       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURMS       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_BURTA       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDIVQTLLLNMFYG
TTCA_PARPJ       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNMFYG
TTCA_PARXL       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNMFYG
TTCA_PARP8       DTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGELGATKIALGHHRDDILQTLLLNLFYG
TTCA_HERAR       DTYSIVKRLIPEGKTTCSLCSRLRRGILYRVADELGATKIALGHHRDDIMETFFLNMFFG
TTCA_JANMA       DTYSIVKRLIPEGKTTCSLCSRLRRGILYRVADELGANKIALGHHRDDIMETFFLNMFFG
TTCA_POLAQ       DTYSIVKRVIPEGKTTCGLCSRLRRGILYRVADELGATKIALGHHRDDILETLMLNMFYA
TTCA_DEIGD       DTYSIVKEKTPEGKTTCALCSRLRRGILYRHAREIGATKIALGHHRDDILETLFMNMFFG
TTCA_DEIRA       DTYSVVKEKTPEGKTTCSLCSRLRRGILYQHAREIGATKIALGHHREDILETLFMNMFFG
TTCA_COXBU       DTYSIVKEKIPAGKTYCSLCSRLRRGIIYRYAEEQGFSKIALGHHRDDLIQTLLMSVFYN
TTCA_COXBR       DTYSIVKEKIPAGKTYCSLCSRLRRGIIYRYAEEQGFSKIALGHHRDDLIQTLLMSVFYN
TTCA_COXBN       DTYSIVKEKIPAGKTYCSLCSRLRRGIIYRYAEEQGFSKIALGHHRDDLIQTLLMSVFYN
TTCA_LEGPL       DTYSIVKEKIPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLVRTLMMSILYN
TTCA_LEGPH       DTYSIVKEKIPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLVRTLMMSILYN
TTCA_LEGPA       DTYSIVKEKIPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYN
TTCA_LEGPC       DTYSIVKEKIPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYN
TTCA1_FRATF      NTYGVVIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA1_FRATO      NTYGVVIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA1_FRATH      NTYGVVIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA2_FRATT      NTYGVIIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA2_FRAT1      NTYGVIIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA2_FRATW      NTYGVIIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHHDDLIQSLLMSILYQ
TTCA2_FRATN      NTYGVVIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIQSLLMSILYQ
TTCA1_FRAP2      NTYGVVIDKVPEGKTYCSLCSRLRRGNIYRYAKEHKMDKIILGHHRDDLIESLLMSILYQ
TTCA_BDEBA       DTYSIVKEKV-QGGTFCSLCSRLRRAILYDFAHANGFTKLALGHHRDDVVHTALLNMFYV
TTCA_SORC5       DTYSIVTEKIPENKTYCSLCSRLRRGILYRIARELGCSKIALGHHRDDAVTTLLLNLIFA
TTCA_GEOMG       THYDIIKEKRRPGSSYCSICARLKRGVLYTLAQQHGCNKLALGHHLDDFVETLLLNQFFV
TTCA_GEOSL       DHYDIIREKRRPGSSYCSICARLKRGVLYTLAQKLGCNKLALGHHLDDFVETLLLNQFFV
TTCA_GEOUR       DHYGIIKEKRRPDSSYCSICARLKRGVLYGLAQRYNCNKLALGHHMDDFIETLLLNQFFV
TTCA_PELPD       THYEIITEKRRPGSSYCSICARLKRGALYGLADSLGCNKLALGHHGDDFIETLLLNQFFV
TTCA_PELCD       DCATIIKEKLRPGSSFCAFCARLRRGVLYSVATELGCNKLALGHHLDDFVETLLLNQFYV
                               . *  *:*::*. :*  .       : ****  * : : ::. :. 

TTCA_ANADE       GALKSMPPKLRSRDGRNVVIRPLCYAAEEDVAAFAEAMRFPIVPCDLCGSQ-PNLRRKRV
TTCA_ANADF       GALKSMPPKLRSDDGRNVVVRPLCYAAEEDIAAFATAMRFPIVPCDLCGSQ-PNLRRKRV
TTCA_MYXXD       GSIKAMPPLLRSDDGRNVVIRPLCYAPEKDIAKFAELMAFPIIPCDLCGTQ-ENLQRKRM
TTCA_RHIEC       GRLASMPAKLLNDEGDLMVLRPLAYAAEDDLARFAAAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_RHIL3       GRLASMPAKLLNDEGDLMVLRPLAYAAEDDLAKFAAAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_AGRFC       GRLAGMPAKLLNDEGDLMVMRPLAYCAEEDMAKFAAAMEFPIIPCDLCGSQ-DGLQRNAM
TTCA_RHIME       GRLASMPAKLLNDEGDLTVLRPLAYAAEDDLAKFAAAMEFPIIPCDLCGSQ-DGLERNAM
TTCA_SINMW       GRLASMPAKLLNDEGDLMVLRPLAYAAEDDIAKFAAAMEFPIIPCDLCGSQ-DGLERNAM
TTCA_BARHE       GRLAAMPGKLINDEGDLFVLRPLVYAAEEDMEKFSQAMQFPIIPCNLCGSQ-DGLQRNAM
TTCA_BART1       GRLAAMPGKLKNDEGDLFVLRPLVYAAEEDMEKFSQAMQFPIIPCNLCGSQ-DGLQRNAM
TTCA_BARBK       GRLAAMPGKLINDEGDLFVLRPLVYAAEEDMEKFSQAMQFPIIPCNLCGSQ-DGLQRNAM
TTCA_BRUAB       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUA2       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUO2       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUSU       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUC2       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUSI       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_BRUME       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFANAMQFPIIPCDLCGSQ-DGLQRNAM
TTCA_OCHA4       GRLAAMPPKLLNDEGDLMVFRPLAYAAEDDLEKFATAMQFPIIPCDLCGSQ-EGLQRNAM
TTCA_CHESB       GRLAAMPPKLLNDEGDVLVLRPLAYCAETDLVKFAEGMKFPIIPCDLCGSQ-DGLQRNAM
TTCA_RHILO       GRLAAMPPKLLNDEGDVMVLRPLSYCAEIDLEKFAAAMRFPIIPCDLCGSQ-EGLQRNAM
TTCA_RHOS4       GRLATMPPKLVNEDGDLFVYRPLAFVAEADCEKFARDMAYPIIPCDLCGSQ-EGLQRQQV
TTCA_RHOS1       GRLATMPPKLVNEDGDLFVYRPLAFVAEADCEKFARDMAYPIIPCDLCGSQ-EGLQRQQV
TTCA_RHOS5       GRLATMPPKLVNEEGDLFVYRPLAFVAEADCERFARSMNYPIIPCDLCGSQ-DGLQRQQV
TTCA_RUEPO       GRLATMPPKLVNEEGDLFVFRPLAHVAEADCEKFARAMNYPIIPCDLCGSQ-DGLQRQQV
TTCA_RUEST       GRLATMPPKLVNEEGDLFVFRPLAHVAEADCEKFARAMNYPIIPCDLCGSQ-DGLQRQQV
TTCA_ROSDO       GRLATMPPKLVNEEGDLFVYRPLAHVSEADCDRFSTAMGYPIIPCDLCGSQ-DGLQRQQV
TTCA_DINSH       GRLATMPPKLVNEEGDLFVLRPLAHVAEADCARFAKALDYPIIPCDLCGSQ-DGLQRQQV
TTCA_PARDP       GRLASMPPKLLNEEGDLNVLRPLAFVAEADCDRFARAMNYPVIPCDLCGSQ-EGLQRMQV
TTCA_HYPNA       GRLAAMPPKLLNDDGDVQVFRPLITAAEDDLAKFAEAMEFPIIPCNLCGSQ-DGLQRVVM
TTCA_ACAM1       GKLEAMPPKLLSDNRQHMVIRPLAYCPEADIQRYADLRQFPIIPCTLCGSQ-ETLQRVQV
TTCA_ALKEH       GRLAAMPPKLRSNNGRHVVIRPLAYVPEPYLERYAERMAFPIIPCTLCGSQ-PDLKRQMI
TTCA_XYLF2       AKLSGMPPKLRSDNGKHVVIRPLAYVSETDIIAYADAREFPIIPCNLCGSQ-ENLQRKQV
TTCA_XYLFT       AKLSGMPPKLRSDNGKHVVIRPLAYVSETDIIAYADAREFPIIPCNLCGSQ-ENLQRKQV
TTCA_XYLFM       AKLSGMPPKLRSDNGKHVVIRPLAYVSETDIIAYADAREFPIIPCNLCGSQ-ENLQRKQV
TTCA_XYLFA       AKLSGMPPKLRSDNGKHVVIRPLAYVSETDIIAYADAREFPIIPCNLCGSQ-ENLQRKQV
TTCA_STRMK       AKLSGMPPKLRSDDGKHVVIRPLAYVRESDIVDYAQARQFPIIPCNLCGSQ-ENLQRRQV
TTCA_XANAC       ARLAAMAPKLRSDDGAHVVIRPLAYVREADIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANC5       ARLAAMAPKLRSDDGAHVVIRPLAYVREADIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANOR       ARLAAMAPKLRSDDGAHVVIRPLAYVREAHIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANOM       ARLAAMAPKLRSDDGAHVVIRPLAYVREAHIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANOP       ARLAAMAPKLRSDDGAHVVIRPLAYVREAHIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANCP       ARLAAMAPKLRSDDGAHVVIRPLAYVREADIAAYAQARHFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANCB       ARLAAMAPKLRSDDGAHVVIRPLAYVREADIAAYAQARHFPIIPCNLCGSQ-ENLQRQQV
TTCA_XANC8       ARLAAMAPKLRSDDGAHVVIRPLAYVREADIAAYAQARQFPIIPCNLCGSQ-ENLQRQQV
TTCA_METCA       GTLKAMPPKLLSDDRRHIVIRPLAYCKEEDIARYARIRAFPIIPCNLCGSQ-ENLQRQAM
TTCA_ACIBC       GSLKAMPPKLLSSDKKNILIRPLAYVEEKDIIKYAELRKFPIIPCNLCGSQ-ENLQRAMI
TTCA_ACIBY       GSLKAMPPKLLSSDKKNILIRPLAYVEEKDIIKYAELRKFPIIPCNLCGSQ-ENLQRAMI
TTCA_ACIBT       GSLKAMPPKLLSSDKKNILIRPLAYVEEKDIIKYAELRKFPIIPCNLCGSQ-ENLQRAMI
TTCA_ACIAD       GSLKAMPPKLLSSDKKNILIRPLAYVEEKDIIKYADLRKFPIIPCNLCGSQ-ENLQRAML
TTCA_PSYA2       GALKSMPPKLLSDDKQNMLIRPLAYVEEKDIIEYARLKEFPIIPCNLCGSQ-TNLQRAII
TTCA_PSYCK       GALKSMPPKLLSDDKQNMLIRPLAYVEEKDIIEYSNLKEFPIIPCNLCGSQ-TNLQRAII
TTCA_PSYWF       GSLKAMPPKLLSDDKQNVLIRPLAYVEEKDIIKYARYKEFPIIPCNLCGSQ-ENLQRAMI
TTCA2_FRATF      GSIKAMPTKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA2_FRATH      GSIKAMPTKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA2_FRATO      GSIKAMPTKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA_FRATM       GSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA1_FRATT      GSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA1_FRAT1      GSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA1_FRATW      GSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA1_FRATN      GSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQ-DNLQRVFI
TTCA2_FRAP2      GSIKSMPAKLLSDDKRNIVIRPLAFVSEKETLEYSKLKNFPIIPCNLCGSQ-DNLQRVFI
TTCA_NEIMB       GKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NEIMA       GKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NEIM0       GKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NEIMF       GKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NEIG1       GKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_HAEIN       GKIKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAKEFPIIPCNLCGSQ-PNLQRQVV
TTCA_HAEIE       GKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAKKFPIIPCNLCGSQ-PNLQRQVV
TTCA_HAEI8       GKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAKEFPIIPCNLCGSQ-PNLQRQVV
TTCA_ACTPJ       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYSQAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_ACTP2       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYSQAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_HAEDU       GKLKSMPPKLISDDAKHIVIRPLAYCKEKDIEKYAEAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_HAES1       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAVAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_HISS2       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAVAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_PASMU       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAQAKHFPIIPCNLCGSQ-PNLQRQVV
TTCA_ACTSZ       GKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAVAKQFPIIPCNLCGSQ-PNLQRQVV
TTCA_MANSM       GKLKSMPPKLVSDDGKQIVIRPLAYCKEKDIEKYAVAKQFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALPA       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIIRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALPB       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIIRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALTY       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIIRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALTI       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIVRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALCH       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIVRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SALAR       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIVRFAEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECO57       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHISS       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOLI       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECODH       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHIBS       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHIB3       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHIDS       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOUT       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOK1       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOL6       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOL5       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOLC       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECO24       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOHS       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHIFL       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_SHIF8       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_ECOSM       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_CITK8       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFSEAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_KLEP7       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFSQAKGFPIIPCNLCGSQ-PNLQRQVI
TTCA_ENT38       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAQAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_CROS8       GKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFSQAKGFPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPE       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPP       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPG       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPA       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPN       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERP3       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPY       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPS       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERPB       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAVAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_YERE8       GKLKGMPPKLMSDDGKHVVIRPLAYCREKDIERFAIAREYPIIPCNLCGSQ-PNLQRQVI
TTCA_PECAS       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAEARQYPIIPCNLCGSQ-PNLQRQVI
TTCA_SERP5       GKLKGMPPKLMSDDGKHVVIRPLAYCREKDIERFSVAKGFPIIPCNLCGSQ-PNLQRQVI
TTCA_SODGM       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIARFAQARQFPIIPCNLCGSQ-PNLQRQVI
TTCA_PHOLL       GKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERYATAKAFPIIPCNLCGSQ-PNLQRQVI
TTCA_AERHH       GKLKSMPPKLVSDDGKNVVIRPLAYCKEKDLVRYAEVKAFPIIPCNLCGSQ-ENLQRQAI
TTCA_AERS4       GKLKSMPPKLVSDDGKNVVIRPLAYCKEKDLVRYAEVKAFPIIPCNLCGSQ-ENLQRQAI
TTCA_COLP3       GKMKAMPAKLVSDNGEHVVIRPLAFCKESELIQYSELKHFPIIPCNLCGSQ-PNMQRQNI
TTCA_PSYIN       GKLKSMPAKLVSDNGEHVVIRPLAYCKEKEIEAYAKLKEYPIIPCNLCGSQ-PNLQRQVT
TTCA_IDILO       GKLKSMPPKLASDNGEHVVIRPLAYAREKDIEQYSAAMEFPIIPCNLCGSQ-ENLQRKQI
TTCA_PSEHT       GKLKSMPAKLMSDNGEHMVIRPLAYCKESDISQYAFVQGYPIIPCNLCGSQ-ENLQRKHT
TTCA_VIBCH       GKMKGMPPKLVSDNGEHVVIRPLAYCREKDIIKYSDMRGYPIIPCNLCGSQ-PNLQRQAV
TTCA_VIBC3       GKMKGMPPKLVSDNGEHVVIRPLAYCREKDIIKYSDMRGYPIIPCNLCGSQ-PNLQRQAV
TTCA_VIBVU       GKMKGMPPKLVSDNGEHVVIRPLAYCREKDIIKYSDMAGYPIIPCNLCGSQ-PNLQRQNI
TTCA_VIBVY       GKMKGMPPKLVSDNGEHVVIRPLAYCREKDIIKYSDMAGYPIIPCNLCGSQ-PNLQRQNI
TTCA_ALIF1       GKLKGMPPKLVSDNGEHVVIRPLAYCREKDIIKYADMRDYPIIPCNLCGSQ-PNMQRQNV
TTCA_VIBCB       SRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIKYAEHKEFPIIPCNLCGSQ-ENLQRQSI
TTCA_VIBPA       SRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIKYAEHKDFPIIPCNLCGSQ-ENLQRQAI
TTCA_PHOPR       SRLKSMPPKLRSDDQRNVVIRPLTYCREKDLIAYAEYREYPIIPCNLCGSQ-ENLQRQNI
TTCA_SACD2       GRLKAMPPKLLADDKRNIIIRPLAYCVEADLEEFAKQKAFPIIPCNLCGSQ-ENLQRQAI
TTCA_PSEAE       GTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEAB       GTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEA7       GTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEMY       GTLKAMPPKLLSDDGRNVVIRPLAYCAEADIEAYSQLKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEU5       GTLKAMPPKLLSDDGRNVVIRPLAYCSEADIEAYSKMKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEE4       GALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEPW       GSLKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEPG       GALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMKEFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEP1       GALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMKAFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEPK       GALKGMPPKLRADDGRNVVIRPLAYCSERDIQAYSDMKAFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEF5       GSLKAMPPKLLADDGRNVVIRPLAYCSEKDIQAYSDLKQFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEPF       GSLKAMPPKLRADDGRNVVIRPLAYCNEKDIQAYSDFKQFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSE14       GSLKAMPPKLRADDGRNVVIRPLAYCHEKDIQAYSDLKQFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSEU2       GSLKAMPPKLRADDGRNVVIRPLAYCHEKDIQAYSDLKQFPIIPCNLCGSQ-ENLQRQVV
TTCA_PSESM       GALKAMPPKLRADDGRNVVIRPLAYCHEKDIQAYSDLKQFPIIPCNLCGSQ-ENLQRQVV
TTCA_SHEB8       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLREFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHEB9       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLREFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHEB5       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLKEFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHEPC       GKMKAMPPKLLSDDGANIVIRPLAYCREKDLEEYAQLKQFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHESW       GKMKAMPPKLLSDDGANIVIRPLAYCREKDLEEYAQLKQFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHESA       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQ-ENLKRQAV
TTCA_SHESM       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQ-ENLKRQAV
TTCA_SHESR       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQ-ENLKRQAV
TTCA_SHEON       GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQ-ENLKRQAV
TTCA_SHEAM       GKMKAMPPKLLSDDGANVVIRPLAYCREKDIAEYAELKQFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHELP       GKLKAMPPKLLSDDGANVVIRPLAYSREKDIAEYAELKAFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHEHH       GKMKAMPPKLLSDDGANMVIRPLAYSREKDIAEYAGLKGFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHEPA       GKMKAMPPKLLSDDGANMVIRPLAYAREKDIAEYAALKGFPIIPCNLCGSQ-ENLKRAAV
TTCA_SHESH       GKQKAMPPKLLSDDGANMVIRPLAYSREKDIAEYAELKAFPIIPCNLCGSQ-ENLKRAEV
TTCA_SHEWM       GKQKAMPPKLLSDDGANMVIRPLAYAREKDIAEYAELKGFPIIPCNLCGSQ-ENLKRASV
TTCA_SHEDO       GKMKAMPPKLLSDDGANMVIRPLAYCREKDIAEYAKFKEFPIIPCNLCGSQ-ENLKRGAV
TTCA_SHEFN       GKQKAMPPKLLSDDGANMVIRPLAYCREKDIEEYSTLKSFPIIPCNLCGSQ-ENLKRGAV
TTCA_CHRSD       GSLKSMPPKLLSDDGKHIVIRPLAYCREADIAEYAEWREFPIIPCNLCGSQ-PNLQRQVV
TTCA_HAHCH       GKMRAMPPKLKSDDGRNIVIRPLAYCREKDIERYAGLREFPIIPCNLCGSQ-ENLQRQNI
TTCA_MARHV       GKLKSMPPVLHSDDGRNTVIRPLAYAREKDIARYASLREFPIIPCNLCGSQ-ENLQRQVI
TTCA_ALCBS       GKMKAMPPKLRSDDSRNVVIRPLAYCREKDIIEFSALKEYPIIPCNLCGSQ-KNLQRQVI
TTCA_MARMS       GKLKSMPPKLLSDDGKHIVIRPLAYCKEEDIEAFSVMKEYPIIPCNLCGSQ-ENLQRQVV
TTCA_CHRVO       GKMKAMPPKLVSDDGRHMVIRPLAYCREKDIIRYADWKAFPIIPCNLCGSQ-PNLQRQVV
TTCA_NITEU       GKLKAMPPKLVSDDGCHVVIRPLAYCKEKDLAAYAWHAQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NITEC       GKLKAMPPKLVSDDGCHVVIRPLAYCKEKDLAAYAQLVQFPIIPCNLCGSQ-PNLQRQVI
TTCA_NITMU       GKLKTMPPKLVSDDGKHIVIRPLAYCKEKDLAAYAEMENFPIIPCNLCGSQ-KNMQRQVV
TTCA_NITOC       GTLKGMPPKLLSDNGRHIVIRPLAYCREKDLETYAHLKAFPIIPCNLCGSQ-ANLQRQAI
TTCA_CYTH3       GKMEAMPAKYRTDDGKHVVIRPLVYCKENEIAEYSIYKKFPIIPCNLCGSQ-ENMQRKIT
TTCA_PSEA6       GRLKSMPPKLTSDDGRNVVIRPLAYCAEQDIADYSILSGFPIIPCNLCGSQ-ENLQRKQV
TTCA_DICNV       GRLKAMPAKLLSDNKKQIVIRPLVYCDEKDIVKYAKLKAFPIIPSNLCGVQ-KNMQRTII
TTCA_AZOSB       GKIKAMPPKLVSDDGQHVVIRPLAYCTENDIERFARGMDFPIIPCNLCGSQ-ENAQRKQI
TTCA_AROAE       GKIKAMPPKLVSDNGEHVVIRPLAYCTEADIAKFARTMEFPIIPCNLCGSQ-ENAQRKQI
TTCA_DECAR       GKLKAMPPKLVTDDKSHVVIRPLAYCAEADIAKFARGMEFPIIPCNLCGSQ-DNLQRQKI
TTCA_CUPTR       GKMKAMPPKLATDDGAHIVIRPLAYCSEKDIASYARAMEFPIIPCNLCGSQ-ENLQRKKV
TTCA_CUPNH       GKMKAMPPKLSTDDGQHIVIRPLAYCSEKDIASYARAMEFPIIPCNLCGSQ-ENLQRKKV
TTCA_CUPPJ       GKMKAMPPKLATDDGAHIVIRPLAYCSEKDIAAYARAMEFPIIPCNLCGSQ-ENLQRKKV
TTCA_CUPMC       GKMKAMPPKLATDDGQHIVIRPLAYCAEKDIASYARAMAFPIIPCNLCGSQ-ENLQRKKV
TTCA_RALSO       GKMKAMPPKLATDNGDHIVIRPLAYCAEKEIAAYARAMEFPIIPCNLCGSQ-ENLQRKKV
TTCA_METFK       AKMKAMPPKLATNKGEFHVIRPLAYCAEKDIASYARGMDFPIIPCDLCGSQ-ENLQRQKV
TTCA_ACISJ       GRMKGMPPKLVSDDGKHVVIRPLCYVPEKDTARWAQYQQFPIIPCNLCGSQ-DGLQRVAV
TTCA_DELAS       GRMKGMPPKLVSDDGKHVVIRPLCYVPEKDTVRWAQYQNFPIIPCNLCGSQ-DGLQRVAV
TTCA_ACIAC       GKMKAMPPKLVSDDGRHVVIRPLAYVPEKDTTRWAQQRQFPIIPCNLCGSQ-ENLQRKQV
TTCA_VEREI       GKMKSMPPKLVSDDGQHVVIRPLAYVAEKDTARWAAQRNFPIIACNLCGSQ-QNLQRQQV
TTCA_POLNA       AKLKGMPPKLVSDDGKNIVIRPMAYVTEKDLTRWAQVQDFPIIPCTLCGSQ-ENLQRKQV
TTCA_POLSJ       AKLKGMPPKLVSDDGKNIVIRPMAYVPEKDLTRWAQVRDFPIIPCTLCGSQ-ENLQRKQV
TTCA_RHOFT       GKLKGMPPKLVSDDGGHIVIRPLANVAEKDLTRWAAHRQFPIIPCSLCGSQ-ENLQRQLI
TTCA_BORBR       GKAKGMPPKLVSDDGRHTVIRPLAYVPESDLIAYAQFKQFPIIPCNLCGSQ-ENLKRKEV
TTCA_BORPE       GKAKGMPPKLVSDDGRHTVIRPLVYVPESDLIAYAQFKQFPIIPCNLCGSQ-ENLKRKEV
TTCA_BORPA       GKAKGMPPKLVSDDGRHTVIRPLAYVPESDLIAYAQFKQFPIIPCNLCGSQ-ENLKRKEV
TTCA_BORPD       GKAKAMPPKLVSDDGRHTVIRPLAYVPEHDLVAYAKFKQFPIIPCNLCGSQ-ENLKRQEV
TTCA_BORA1       GKLKGMPPKLVSDDGRHTVIRPLAYIAETDLIAYAELKQFPIIPCNLCGSQ-ENLKRKEV
TTCA_LEPCP       SKLKGMPPKLVSDDGRHTVIRPLAYVAETDLERWAEHRAFPIIPCTLCGTQ-DNLQRVQI
TTCA_METPP       AKLKGMPPKLVSDDGRHVVIRPLAYVPEHDLEAWAAHRQFPIIPCTLCGSQ-ENLQRKQI
TTCA_BURCM       GKLKGMPPKLQSDDGRNVVIRPLAYVKETDLEKFAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURA4       GKLKGMPPKLQSDDGKNVVIRPLAYVKETDLEKFAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURVG       GKLKGMPPKLQSDDGRNVVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURCA       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURCH       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURCC       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURL3       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURM1       GKLKGMPPKLQSDDGKNVVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURMA       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURM9       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURPS       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURP0       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURP1       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURP6       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURM7       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURMS       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_BURTA       GKLKGMPPKLQSDDGKNIVIRPLAYAKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_PARPJ       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_PARXL       GKLKGMPPKLQSDDGKNIVIRPLAYVKETDLEKYAELREFPIIPCNLCGSQ-PNLKRAEM
TTCA_PARP8       GKLKGMPPKLQSDDGKNVVIRPLAYVKETDLEKYAELRQFPIIPCNLCGSQ-PNLKRAEM
TTCA_HERAR       AKIKGMPPKLQSDDGKHIVIRPLAYVKEADTERYAQIKNFPIIPCDLCGSQ-ENLQRKQI
TTCA_JANMA       AKIKGMPPKLQSDDGKHIVIRPLAYVKEADTERYAEVKNFPIIPCDLCGSQ-ENLQRKQI
TTCA_POLAQ       GKLKGMPPKLRSDDGKHIVIRPLAYVPEKLLERYAIDMNFPIIPCDLCGSQ-PNLQRQVM
TTCA_DEIGD       ARLKAMPPKLQSDDGTNVVIRPLAYLAERDIERYAQAKGFPIIPCNLCGSQ-PNLQRRVV
TTCA_DEIRA       ARLKAMPPKLQSDDGTNVVIRPLAYVAEADIIRYAQAREFPVIPCNLCGAQ-PNLQRKVV
TTCA_COXBU       GQIRSMPPKLLSDNKRHVLIRPLAYCQERDIIKYAMEQQFPLIPCNLCDSQ-KNLMRQRV
TTCA_COXBR       GQIRSMPPKLLSDNRRHVLIRPLAYCQERDIIKYAMEQQFPLIPCNLCGSQ-KNLMRQRV
TTCA_COXBN       GQIRSMPPKLLSDNKRHVLIRPLAYCQERDIIKYAMEQQFPLIPCNLCGSQ-KNLMRQRV
TTCA_LEGPL       GDIRSMPPKLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQ-ENLMRKKV
TTCA_LEGPH       GDIRSMPPKLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQ-ENLMRKKV
TTCA_LEGPA       GDIRSMPPKLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQ-ENLMRKKV
TTCA_LEGPC       GDIRSMPPKLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQ-ENLMRKKV
TTCA1_FRATF      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA1_FRATO      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA1_FRATH      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA2_FRATT      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA2_FRAT1      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA2_FRATW      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA2_FRATN      GQIKSMPPKFVTQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA1_FRAP2      GQIKSMPPKFITQDGENTVIRPMVLVQERDLIEFAKEENFPIIPCNLCGSQ-ENLKRKKV
TTCA_BDEBA       GTTAAMPPKLKSDDERNILVRPLCYVSERDIEELAAEWAFPVIPCNLCGSQ-DGLKRQRI
TTCA_SORC5       GQLKSMPPKLISDDGDNIVIRPLIYCAEAELAAFAAEERFPIIPCDLCGSQ-ENLQRKAV
TTCA_GEOMG       GTLKAMAPRMLADNGATTVIRPLVYVEEREIIPFARENSFPVVCCCCPVCGKADIQRKRM
TTCA_GEOSL       GTLKAMAPRMLADNGETTVIRPLVYVEEREIIPFARENRFPVVCCSCPVCGTADLQRRRM
TTCA_GEOUR       GSLKAMAPSMLADNGLTTVIRPLVYVPEEDIIPFSRNNRFPVLCCCCPVCGSADQQRKRM
TTCA_PELPD       GSLKAMSANMLADNGRTTVIRPLVYASEEEIVDFMGQVGLPVVSCNCPVSDSTDLKRRRM
TTCA_PELCD       GTLAAMSPKLLADNGQHTVIRPMVYVEESDVAAFAEANGLPAIPCGCPEETRSDQNRQRM
                 .    *.      .    : **:    *            * : .           *   

TTCA_ANADE       KRLLAELSAEHPAVKGNLLHALGHVVPSHLLDRDLHRQLADATGRDPWLDAE--------
TTCA_ANADF       KALLAELSDEHPAVKGNLLNALGHVVPSHLLDRDLHR-LVASTGRDPWLDGD--------
TTCA_MYXXD       QRLMEELGKEIPNVRQSVLNAMANVRPSHLLDKTLNP--------DPLHASE--------
TTCA_RHIEC       KDMLADIERRMPGRKDTMLRALSHVNPSHLLDPKLFDFSSLGVTDPS-------------
TTCA_RHIL3       KDMLADIERRMPGRKDTMLRALSHVNPSHLLDPKLFDFSTLGVTDPS-------------
TTCA_AGRFC       KDMLADIERRMPGRKDVMLRALAHVNPSHLLDPKLFDFSALAVTGASPEERREASPP---
TTCA_RHIME       KAMLADIERRMPGRKDTMLRALGHVNASHLLDPKLFDFQSLSPEPKE-------------
TTCA_SINMW       KAMLSDIERRMPGRKDTMLRALGHVNASHLLDPKLFDFQSLSPEP---------------
TTCA_BARHE       KEMLKDIERKMPGRKDTMIRALTNVRPSHLLDKKFFDFKNLF------------------
TTCA_BART1       KEMLKNIERQMPGRKDTMIRALANVRPSHLLDKKFFDFKTY-------------------
TTCA_BARBK       KVMLNDIEKRMPGRKDTMIRALTNVRPSHLLDKKLFSF----------------------
TTCA_BRUAB       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUA2       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUO2       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUSU       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUC2       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUSI       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_BRUME       KAMLIDIEKRMPGRKDTMIRALTNVRPSHLLDRKLFDFAGLMANGEKGSDDALW------
TTCA_OCHA4       KAMLTDIEKRMPGRKDTMIRAMTNVRPSHLLDRKLFDFAGLMLNGEGEGDHAV-------
TTCA_CHESB       KAMLEDIERRMPGRKDTMIRALANVRPSHLLDRQLFDFAGLGIL----------------
TTCA_RHILO       KAMLEDIEKRMPGRKDTMIRALSNTRPSHLLDRKLFDFAALNQTLITGQDASDDI-----
TTCA_RHOS4       KQILDGWEARSPGRRQVMFRALMNARPSHLLDPGLFDFLGLATAPRASEERQDEPPHLRG
TTCA_RHOS1       KQILDGWEARSPGRRQVMFRALMNARPSHLLDPGLFDFLGLATAPRAAEERQDEPPHLRG
TTCA_RHOS5       KQILDGWEARSPGRRQVMFRALMNARPSHLLDPGLFDFAGLATGTASGRNG-AEPPQLRG
TTCA_RUEPO       KQILDGWEKNRPGRRQVMFRALMNARPSHLLDPKLFDFQGLELGSREKGENFGEIPLLR-
TTCA_RUEST       KQILDTWESNSPGRRQVMFRALMNARPSHLLDPKLFDFTGLALKNIDNSTETEEIPELR-
TTCA_ROSDO       KAILEGWEKNSPGRRQVMFKALMNTRPSHLLDTALFDFAGLARK----------------
TTCA_DINSH       KALLDGWEANSPGRRQVMFKALTNIRPSHMLDPNLFDFAGLGLADAFSENPK--------
TTCA_PARDP       KRLLDEWESRSPGRRRVMFRALMNVRPSHLPDPKLFDFTALMPDMSDFREK--DVPILRE
TTCA_HYPNA       NRMLDEWERKKPGTRQVMAKALTNVRPSHLHDPRVFDFAGLMLGGKGEDDPNVPF-----
TTCA_ACAM1       KQMLQAWEQETPGRLETIFRSLQNIELSQLADPQLFDFAHLAIAATPYAD----------
TTCA_ALKEH       KAMLREWGEIEPRRLANIFSALQNVQPSHLADKELYDFINLVGSVQPGEDPVSA------
TTCA_XYLF2       GVMLKAWEKEYPGRIEQIARALGNIRPSQLADQSLFDFLALGRHSNTPL-----------
TTCA_XYLFT       GVMLKAWEKEYPGRIEQIARALGNIRPSQLADQSLFDFLALGRHSNTPL-----------
TTCA_XYLFM       GVMLKAWEKEYPSRIEQIARALGNIRPSQLADQSLFDFLALGRHSNTPL-----------
TTCA_XYLFA       GVILKAWEKEYPGRIEQIARALGNIRPSQLADQSLFDFQALGRHSNTPL-----------
TTCA_STRMK       GLMLKQWEKDHPGRIEQIARAMGEVRPSQLADTTLFDFMALGRRDDAPL-----------
TTCA_XANAC       GKLLQQWDRESPGRVEQIARALGDVRPEQLADRTLFDFLALGRSGDAPSGL---------
TTCA_XANC5       GKLLQQWDREFPGRVEQIARALGDVRPEQLADRTLFDFLALGRSGDAPSDV---------
TTCA_XANOR       GKMLQHWDHEQPGRVEQIARALGDVRPEQLADRTLFDFLALGRSGDAPPDL---------
TTCA_XANOM       GKMLQHWDHEQPGRVEQIARALGDVRPEQLADRTLFDFLALGRSGDAPPDL---------
TTCA_XANOP       GKMLQQWDHEQPGRVEQIARALGDVRPEQLADRTLFDFLALGRSGDAPPDL---------
TTCA_XANCP       GRMLQQWDREQPGRVDQIARALGDVRPEQLADRTLFDFPGLGGGADAPL-----------
TTCA_XANCB       GRMLQQWDREQPGRVDQIARALGDVRPEQLADRTLFDFPGLGGGADAPL-----------
TTCA_XANC8       GRMLQQWDREQPGRVDQIARALGDVRPEQLADRTLFDFPGLGGGADAPL-----------
TTCA_METCA       KAMLKDWEKRHPGRVETVFTALQNVAPSQLADSRLFDFAALDSLRNTAETT---------
TTCA_ACIBC       NEMLREWDKQYPKRLHSIFGALQNVSPSQLADRDLFDFEVLDSQRELDFKD---------
TTCA_ACIBY       NEMLREWDKQYPKRLHSIFGALQNVSPSQLADRDLFDFEVLDSQRELDFKD---------
TTCA_ACIBT       NEMLREWDRQYPKRLHSIFGALQNVSPSQLADRDLFDFEVLDSQRELDFKD---------
TTCA_ACIAD       NEMLREWDKQYPKRLHSIFGALQNVSPSQLADRDLFDFEILDSQRELDFKD---------
TTCA_PSYA2       NDMLREWDDAHPQRLASIFKAMQNVAPSQLADRELFDFETLSLERDDNERL---------
TTCA_PSYCK       NDMLREWDDAHPQRLASIFKAMQNVAPSQLADRELFDFETLSLDRDDNERL---------
TTCA_PSYWF       NDMLRQWDDAHPQRLASIFKAMQNVAPSQLADRELFDFESLTLQRDDSKRD---------
TTCA2_FRATF      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA2_FRATH      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA2_FRATO      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA_FRATM       KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA1_FRATT      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA1_FRAT1      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA1_FRATW      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA1_FRATN      KDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINIS--KDDIQR----------
TTCA2_FRAP2      KDMLNRWENNNPERKNVIFKALSNISPSQMLDKELFDFFNIT--KDDIRR----------
TTCA_NEIMB       GDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFVGLERGQSLKH-----------
TTCA_NEIMA       GDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFVGLERGQSLKH-----------
TTCA_NEIM0       GDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFAGLERGQTLKH-----------
TTCA_NEIMF       GDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFAGLERGQTLKH-----------
TTCA_NEIG1       GDMLRDWDKRFPGRIESMFSALQNVVPSHLADTELFDFAGLERGQNLKH-----------
TTCA_HAEIN       KEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFKGIKHGQLIDGI----------
TTCA_HAEIE       KEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFKGIKHGQLIDGI----------
TTCA_HAEI8       KEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFKGIKHGQLIDGI----------
TTCA_ACTPJ       KEMLQTWDRQYPGRIETMFSAMQNITLSHLCDPSLFDFKGLKLGQVLDGV----------
TTCA_ACTP2       KEMLQTWDRQYPGRIETMFSAMQNITLSHLCDPSLFDFKGLKRGQVLDGV----------
TTCA_HAEDU       KEMLQNWDRQYPGRIETMFSALQNVTPSHLCDTQLFNFKAVKHGEMINGI----------
TTCA_HAES1       KEMLQKWDRQYPGRIETMFSAIQNIVPSHLCDSNLFDFKRIRHGKIPEGI----------
TTCA_HISS2       KEMLQKWDRQYPGRIETMFSAIQNIVPSHLCDSNLFDFKRIRHGKIPEGI----------
TTCA_PASMU       KEMLQKWDRQYPGRIETMFSAIQNIVPSHLCDTHLFNFKDLQRGQILENI----------
TTCA_ACTSZ       KEMLNTWDRQYPGRLETMFSAMQNVVPSHLCDPNLFDFKNIRRGQILEGV----------
TTCA_MANSM       KEMLQTWDRRYPGRIETMFSAIQNITPSHLCDPNLFDFKNIKRGQLPKGV----------
TTCA_SALPA       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVD-----------
TTCA_SALPB       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVD-----------
TTCA_SALTY       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVD-----------
TTCA_SALTI       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVID-----------
TTCA_SALCH       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVD-----------
TTCA_SALAR       ADMLRDWDKRYPGRIETMFSAMQDIVPSHLCDTNLFDFKGIAHGSEVVD-----------
TTCA_ECO57       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHISS       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOLI       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECODH       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHIBS       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHIB3       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHIDS       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDSNLFDFKGITHGSEVVN-----------
TTCA_ECOUT       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOK1       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOL6       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOL5       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOLC       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECO24       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOHS       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHIFL       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_SHIF8       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_ECOSM       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVN-----------
TTCA_CITK8       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLSDINLFDFKGINHDSDVVD-----------
TTCA_KLEP7       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLSDVNLFDFKGITHGSEVVD-----------
TTCA_ENT38       GDMLRDWDKRYPGRIETMFSAMQNVVPSHLSDVELFDFKGIQHGSEVVA-----------
TTCA_CROS8       ADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTELFDFKGIHHGSEVVN-----------
TTCA_YERPE       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPP       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPG       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPA       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPN       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERP3       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPY       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPS       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERPB       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKSITHDSDIID-----------
TTCA_YERE8       KDMLRDWDKQYPGRIETMFSAMQNVVPSHLNDHKLFDFKNITHNSEIVD-----------
TTCA_PECAS       KDMLRDWDKRHPGRIETMFSAMQNVVPSHLADHALFDFKNIRHGSDVVD-----------
TTCA_SERP5       GDMLRDWDKRYPGRLETMFSAMQNVVPSHLSDYNLFDFKGIHHGSEVVD-----------
TTCA_SODGM       GDMLRDWDKRYPGRSETLFRAMQNVVPSHLSDTHLFDFKGLMQGSAVVD-----------
TTCA_PHOLL       KDMLREWDKRYPGRIETMFRAVQNVVPSHLSDFNLFDFKSITHGSEVID-----------
TTCA_AERHH       KQMMQEWDRRFPGRLETMFTAIQDVIPSHLLDHKLFDFKSINRDSGIID-----------
TTCA_AERS4       KQMMQDWDRRFPGRIETMFTAIQDVIPSHLLDHKLFDFKSINRDSGIID-----------
TTCA_COLP3       KRMLNDWHDQFPGRIESMFTAMQNVVPSHLCDSNLFDFKSINSTSGIIN-----------
TTCA_PSYIN       KNMLNEWDVKFPGRLETMFTAMQNVVPSHLSDTALFNFKEIDKSSGVID-----------
TTCA_IDILO       KQMLNGWDKQFPGRIESLFTAMQNVVPSHLADSALFDFKAVTADGVADE-----------
TTCA_PSEHT       KAMLAKWDAEHPGRIESIFTAMQNVVPSHLADNQLFDFTNLQTGEVID------------
TTCA_VIBCH       KQMLNDWDKRFPGRIETMFRAMQNVVPSHLADFSLFDFKSIDKNSGVIN-----------
TTCA_VIBC3       KQMLNDWDKRFPGRIETMFRAMQNVVPSHLADFSLFDFKSIDKNSGVIN-----------
TTCA_VIBVU       KQMLNDWDKRFPGRIETMFRAMQNVVPSHLADFELFDFKSINKDSGVIN-----------
TTCA_VIBVY       KQMLNDWDKRFPGRIETMFRAMQNVVPSHLADFELFDFKSINKDSGVIN-----------
TTCA_ALIF1       KQMLNTWDKQFPGRIETMFTAMQNVVPSHLADFNTFDFKSINRDSGVIN-----------
TTCA_VIBCB       KAMLIDWDKKTPGRVEAIFKSIQNVSPSQLADRELFDFENLPLDREGNREEY--------
TTCA_VIBPA       KAMLIDWDKKTPGRVEAIFKSIQNVSPSQLADRELFDFVNLPLDRDGSREEY--------
TTCA_PHOPR       KAMLIDWDTQTPGRVESIFKSTQNISPSQLADRNIFDFENLPLDRTGKRAEY--------
TTCA_SACD2       KQMLQGWEKQFPGRIETIFSSLQRVSASQLADTELYDFVGLTIDRSAEPKDYGEQSAINV
TTCA_PSEAE       KEMLLEWERKSPGRTEIMFRALQNVVPSQLADRNLFDFANLRIDENA-------------
TTCA_PSEAB       KEMLLEWERKSPGRTEIMFRALQNVVPSQLADRNLFDFANLRIDENA-------------
TTCA_PSEA7       KEMLLEWERKSPGRTEIMFRALQNVVPSQLADRNLFDFASLRIDESA-------------
TTCA_PSEMY       KEMLQEWERKSPGRVEIMFRALQNVHPSQLADRNLFDFKSLKIDDSA-------------
TTCA_PSEU5       KEMLQEWERKSPGRTEIMFRALQNVVPSQLADRNLFDFKSLRIDDSA-------------
TTCA_PSEE4       KDMLVEWERKHPGRTESIFRALQNVAPSQLADRNLFDFTSLKIDESA-------------
TTCA_PSEPW       KDMLVEWERKHPGRTESIFRALQNVAPSQLADRNLFDFTSLKIDESA-------------
TTCA_PSEPG       KDMLVEWERKHPGRTESIFRALQNVAPSQLADRNLFDFTSLKIDENA-------------
TTCA_PSEP1       KDMLVEWERKHPGRTESIFRALQNVAPSQLADRNLFDFTSLKIDENA-------------
TTCA_PSEPK       KDMLVEWERKHPGRTESIFRALQNVAPSQLADRNLFDFTSLKIDENA-------------
TTCA_PSEF5       KEMLQEWERKTPGRTESIFRGLQNVIPSQLADRNLFDFTSLRIDDSA-------------
TTCA_PSEPF       KEMLQDWERKTPGRTESIFRSLQNVIPSQLADRNLFDFTSLKIDETA-------------
TTCA_PSE14       KDMLIDWERKTPGRTESIFRALQNVQPSQLADRNLFDFSNLRIDETA-------------
TTCA_PSEU2       KEMLQDWERKTPGRTESIFRALQNVQPSQLADRNLFDFTNLRIDETA-------------
TTCA_PSESM       KDMLLDWERKTPGRTESIFRALQNVQPSQLADRKLFDFSQLRIDETA-------------
TTCA_SHEB8       KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFVSLTRDPNAPMRGD--------
TTCA_SHEB9       KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFVSLTRDPNAPMRGD--------
TTCA_SHEB5       KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFVSLTRDPDAPMRGD--------
TTCA_SHEPC       KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFISLKRDPDVPMTGD--------
TTCA_SHESW       KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFISLKRDPDVPMTGD--------
TTCA_SHESA       KDMLNQWDRLYPGRIETIFTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGD--------
TTCA_SHESM       KDMLNQWDRLYPGRIETIFTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGD--------
TTCA_SHESR       KDMLNQWDRLYPGRIETIFTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGD--------
TTCA_SHEON       KDMLNQWNRQFPGRIETIFTAMQNTAPSQGVDREQFDFVSLKRDPDAPMKGD--------
TTCA_SHEAM       KDMLKQWDRQHPGRIETIFTAMQNTAPSQGVDREQFDFVSLKQDPNAEFRGD--------
TTCA_SHELP       KEMLKSWDKQFPGRIETIFTAMQNTSPSQGVDRDQFDFVSLKQDPDAPMKGD--------
TTCA_SHEHH       KEMLVQWDRDYPGRIETIFTAMQNTAPSQGVDREQFDFLSLTRDPDAPMRGD--------
TTCA_SHEPA       KEMLVQWDKQHPGRIETIFTAMQNTAPSQGVDREQFDFLSLQRDPDAPMSGQ--------
TTCA_SHESH       KDMLNLWDEHHPGRIESIFTAMQNTSPSQGVDREQFDFNSLQRDADAPLRGD--------
TTCA_SHEWM       KEMLNQWDVEHPGRIESIFTAMQNTSPSQGVDREQFDFISLTRDANAPLKGE--------
TTCA_SHEDO       KDMLKQWDKHHPGRIESIFTAMQNTSPSQGVDREQFDFAGLTRDPDAPMRGD--------
TTCA_SHEFN       KDMLQMWDKQHPGRIETIFTAMQNTSPSQGVDRENFDFISLKRNPDAVNTGD--------
TTCA_CHRSD       KEMLTEWEEKHPGRLETMFKAITNVAPSQLADRAMFDFEGLE-DKQRDFLAR--------
TTCA_HAHCH       KMMLQDWDKRFPGRLENMFRAVQNVLPSHLCDTRLYDFDKLERY----------------
TTCA_MARHV       KEMFQTWDKQHPGRLETMFRALCNVEPSHLADPELYDFREGRRLGGKRQAVQ--------
TTCA_ALCBS       KEMLQQWDKQQPGRIENIFAAVQNIAPSQLADTRLFDFENLEQGQQQGG-----------
TTCA_MARMS       KDMLQKWEKEFPGRTESMFSAIQNVVPSHLADTKLFDFKGLKQSPAA-------------
TTCA_CHRVO       KEMVNDWDKRFPGRVESMFRALQNVVPSHLADPKLFDFVGLQTGDAPFA-----------
TTCA_NITEU       KEMMQQWDKKYPGRLETMFTALQNIQLSHLADTSRYDFVGLKPHGIAIE-----------
TTCA_NITEC       KEMMQQWNKKYPGRLETMFTALQNIQLSHLADTSRYDFVGIKPHGIATE-----------
TTCA_NITMU       KEMLQQWDKKFPGRLENMFSSLQNIQPSHLLDSSLYDFHGLKTGNGPVV-----------
TTCA_NITOC       KAMMKAWDKQFPGRLETMFRALQNVKPSHLADSTLYNFQGLQKQESPFP-----------
TTCA_CYTH3       KKMLADWELQYPNRKEVIYNALKNISPSHLFDRDLYDFKELKHRVEELN-----------
TTCA_PSEA6       KLMLAQWNTQFPGRIETMFKALQNVVPSHLADPGAFNFNDLDHSNSTSI-----------
TTCA_DICNV       KEMLLAWEKDYPQRIEHIFAALTKTVPSHLLDTELFNFAEIEQKAIRFC-----------
TTCA_AZOSB       KTMLQGWARDYPGRIESLATSLRNVVPSHLSDSALFDFVGLTRDTRVG------------
TTCA_AROAE       KTMLQGWAREHPGRIESIATALGQVVPSHLADASLFDFRNLTRDTLVA------------
TTCA_DECAR       REMMQEWDKRYPGRTESVFTAMQNVVPSHLADADLFDFRGLTLDTPVD------------
TTCA_CUPTR       SEMLQEWERQNPGRIDNIFSALRNVVPSHLADTELFPFTGLATGLAKV------------
TTCA_CUPNH       SEMLQDWERQNPGRIDNIFSALRNVVPSHLADTDLFPFTGLATGLAKV------------
TTCA_CUPPJ       SEMLQAWERENPGRIDNIFASLRNVVPSHLADTDLFPFTGLATGLAKV------------
TTCA_CUPMC       SEMLQAWERENPGRIDNIFAALRNVVPSHLADTDLFPFTGLATGLAKI------------
TTCA_RALSO       KEMLLEWERQAPGRIDNIFSALQNVVPSHLADTDLFDFNGLTTGLAKI------------
TTCA_METFK       KDMLQAWEREQPGRVNNIFRAICNVEPSHLADTDLYDFKHMSQSKAE-------------
TTCA_ACISJ       NEMLREWDKKFPGRIESMLRAMGHVVTTHLMDPHLHDFKNAKATGIADP-----------
TTCA_DELAS       GELLREWDKKFPGRVESMFRAMGHIVTTHMMDPELHDFKNAKATGIADP-----------
TTCA_ACIAC       GEMLRDWDKRFPGRVDNMFNALQNIVPSHLMDGTLHDFQHLKATGIASD-----------
TTCA_VEREI       GQMLREWEKKLPGRVENMFNALQNIVPSHLLDARLYDFKNARATGLASA-----------
TTCA_POLNA       GNMLRDWQKQYPGRIENMFSALQNIVPSHLMDSKRHDFKGIRTTGVADP-----------
TTCA_POLSJ       GNMLREWEKKHSGRLENMFSALQNIVPSHLMDSKRHDFKNIRTTGVADA-----------
TTCA_RHOFT       GQMLRDWEKQYPGRTETMFTALQNVVPSHLMDATRYDFKGLKITGVPDA-----------
TTCA_BORBR       GRMIQEWDRKHPGRSWNVFNALSRVVPSHLMDRDLFDFVGLKPTGVADA-----------
TTCA_BORPE       GRMIQEWDRKHPGRSWNVFNALSRVVPSHLMDRDLFDFVGLKPTGVADA-----------
TTCA_BORPA       GRMIQEWDRKHPGRSWNVFNALSRVVPSHLMDRDLFDFVGLKPTGVADA-----------
TTCA_BORPD       SRMIQEWDRRHPGRSWNVFNALSRIVPSHLMDRDLFDFAGLKPTGRPDA-----------
TTCA_BORA1       SRMVQEWDRKFPGRSWNVFNALSRVVPSHLMDRDLFDFVGLKPTGLPDA-----------
TTCA_LEPCP       KHMLRDWDQRFPGRIDNMHRAFSQVVPSHLMDRALFPFETLVPTGVADP-----------
TTCA_METPP       AQMLRDWERQHPGRLDNMASALANVVPSHLQDRNLYPFTTLQATGRADE-----------
TTCA_BURCM       KALIRDWDKRFPGRVDNMFSALANVVPSHLMDTTQFPFASLRATGQADP-----------
TTCA_BURA4       KALIRDWDKRFPGRVDNMFSALANVVPSHLMDTTQFPFASLRATGQADP-----------
TTCA_BURVG       KALIREWDKRFPGRVDNMFSALANVVPSHLMDTGLFPFASLRATGVADP-----------
TTCA_BURCA       KALIREWDKRFPGRVDNMFNALAKVVPSHLMDTTLYPFQSLRATGEADP-----------
TTCA_BURCH       KALIREWDKRFPGRVDNMFNALAKVVPSHLMDTTLYPFQSLRATGEADP-----------
TTCA_BURCC       KALIRDWDKRFPGRVDNMFNALAKVVPSHLMDTTLYPFQSLRATGEADP-----------
TTCA_BURL3       KALIREWDKRFPGRVENMFNALAKVVPSHLMDTTLYPFQSLRASGVADP-----------
TTCA_BURM1       KALIREWDKRFPGRVDNMFNALANVVPSHLMDTTLFPFASLRATGQADP-----------
TTCA_BURMA       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURM9       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURPS       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURP0       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURP1       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURP6       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURM7       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURMS       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDARLFPFAGLRATGEADP-----------
TTCA_BURTA       KALIRDWDKRFPGRVDNMFNALANVVPSHLMDTQLFPFAGLRATGEADP-----------
TTCA_PARPJ       KALVRDWEKRFPGRIENMFNALSNVVPSHLMDHKLFPFAGLRATGEADP-----------
TTCA_PARXL       KALVRDWEKRFPGRIENMFNALANVVPSHLMDHKLFPFAGLRATGEADP-----------
TTCA_PARP8       KALIREWDKRFPGRVDNMFNALSNVVPSHLMDHKLFPFASLRATGEADP-----------
TTCA_HERAR       KNMLREWEKKHPGRVDNIFSSLSTVVPSHLMDSNLFGFADLQATGVAMP-----------
TTCA_JANMA       KGMLREWEKKFPGRVDNIFSSLSTVVPSHLMDKELFGFADLKATGEAMA-----------
TTCA_POLAQ       KEMLRDWEKKHPGRVENLFRSMHHIVPSHLMDGEAFDFKNLEISTELSG-----------
TTCA_DEIGD       GEMLEGWEREHPGRLQNILRSLTRVTPSHLLDRDLYDFAGLSVTPAE-------------
TTCA_DEIRA       GDMLEGWEREHPGRLNNILRSLTRVTPSHLLDRELYDFASLSVTPAQ-------------
TTCA_COXBU       KRLISDLAKENPKVPSNMLRALSNIKPSQLMDHELWNFRELNVD----------------
TTCA_COXBR       KRLISDLAKENPKVPSNMLRALSNIKPSQLMDHELWNFRELNVD----------------
TTCA_COXBN       KRLISDLAKENPKVPSNMLRALSNIKPSQLMDHELWNFRELNVD----------------
TTCA_LEGPL       ASLIDQLAIENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETTQSIQ--------
TTCA_LEGPH       ASLIDQLAIENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETTQSIQ--------
TTCA_LEGPA       ASLIDQLAIENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSIQ--------
TTCA_LEGPC       ASLIDQLAIENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSVQ--------
TTCA1_FRATF      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA1_FRATO      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA1_FRATH      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA2_FRATT      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA2_FRAT1      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA2_FRATW      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDKNLLNSLEN-------------------
TTCA2_FRATN      KKLIQDLALENPKVPSNILNSLSNVLPSHLMDRNLFDIDATIK-----------------
TTCA1_FRAP2      KKLIQDLAHENPKVPSNILNSLSNVLPSHLMDRDLLNIIQN-------------------
TTCA_BDEBA       KKLVRDLEKEIPNIYASIQTSMTNIKPSQLMDQDLWDFKNLKT-----------------
TTCA_SORC5       SQLLADLDARHPGTRQNMLAALGNVRPSHLFDTGLWKRLGLEVAREEGS-----------
TTCA_GEOMG       KELLKELERENPAVKRSLLRALANVQPRHLLDRELQRVCEVP------------------
TTCA_GEOSL       KKLLTELEKENPAVKRSLLRALGNVQPRYLLDLELQRLCDVP------------------
TTCA_GEOUR       KELLKTLEKENPFVKKSLLKALANVQPRYLLDRRVKY-----------------------
TTCA_PELPD       KELLKELEQEIPHIRSSMLKALSNVHPRHLLDQQLQGL----------------------
TTCA_PELCD       KRLVSQLAEDIPHLRSSLIGALGNVQPRHLLDASLKDFGTAAAD----------------
                   :.       .     :  .          *                            

TTCA_ANADE       --------------DEEAEDCGE-PAGDGVVSLGGARGGR--------------------
TTCA_ANADF       --------------EDEDGGCLQGEVADALVKLAGAREDA--------------------
TTCA_MYXXD       --------------EGATTTEPKDTQGSASPWLESRQ-----------------------
TTCA_RHIEC       ------------------------------------------------------------
TTCA_RHIL3       ------------------------------------------------------------
TTCA_AGRFC       ------------------------------------------------------------
TTCA_RHIME       ------------------------------------------------------------
TTCA_SINMW       ------------------------------------------------------------
TTCA_BARHE       ------------------------------------------------------------
TTCA_BART1       ------------------------------------------------------------
TTCA_BARBK       ------------------------------------------------------------
TTCA_BRUAB       ------------------------------------------------------------
TTCA_BRUA2       ------------------------------------------------------------
TTCA_BRUO2       ------------------------------------------------------------
TTCA_BRUSU       ------------------------------------------------------------
TTCA_BRUC2       ------------------------------------------------------------
TTCA_BRUSI       ------------------------------------------------------------
TTCA_BRUME       ------------------------------------------------------------
TTCA_OCHA4       ------------------------------------------------------------
TTCA_CHESB       ------------------------------------------------------------
TTCA_RHILO       ------------------------------------------------------------
TTCA_RHOS4       EA----------------------------------------------------------
TTCA_RHOS1       EA----------------------------------------------------------
TTCA_RHOS5       GD----------------------------------------------------------
TTCA_RUEPO       ------------------------------------------------------------
TTCA_RUEST       ------------------------------------------------------------
TTCA_ROSDO       ------------------------------------------------------------
TTCA_DINSH       ------------------------------------------------------------
TTCA_PARDP       H-----------------------------------------------------------
TTCA_HYPNA       ------------------------------------------------------------
TTCA_ACAM1       -------------SPDRSGL----------------------------------------
TTCA_ALKEH       -----------LETPHGDGFPAAEVLSGVQRHDPQSA-----------------------
TTCA_XYLF2       --------------PNAHAWLAGDLANDTAP-----------------------------
TTCA_XYLFT       --------------PNAHAWLAGDLANDTAP-----------------------------
TTCA_XYLFM       --------------PNAHAWLAGDLANDTAP-----------------------------
TTCA_XYLFA       --------------PNAHAWLAGDLANDTAP-----------------------------
TTCA_STRMK       --------------PDAHAWLAGSPADADADPETPTV-----------------------
TTCA_XANAC       -------------DPDPRAWLSAGHATHDSD-----------------------------
TTCA_XANC5       -------------DPDPSAWLSASHAPHDSD-----------------------------
TTCA_XANOR       -------------APDPGAWLTASDATHDSD-----------------------------
TTCA_XANOM       -------------APDPGAWLTASDATHDSD-----------------------------
TTCA_XANOP       -------------APDPGAWLTASDATHDSD-----------------------------
TTCA_XANCP       --------------PDAAGWLAGSAAEHARD-----------------------------
TTCA_XANCB       --------------PDAAGWLAGSAAEHARD-----------------------------
TTCA_XANC8       --------------PDAAGWLAGSAAEHARD-----------------------------
TTCA_METCA       --------------PEHGAGLDILSR----------------------------------
TTCA_ACIBC       --------------PEE------LKKRLDVVNLSFAAE----------------------
TTCA_ACIBY       --------------PEE------LKKRLDVVNLSFAAE----------------------
TTCA_ACIBT       --------------PEE------LKKRLDVVNLSFAAE----------------------
TTCA_ACIAD       --------------PEE------MKKRLDIVNLSFAAD----------------------
TTCA_PSYA2       --------------FEGDNIQAGQIESLAEIGLPVAPATQIFNPNFVDTEKGSHTPKKIP
TTCA_PSYCK       --------------FEGDNIQAGQIESLAEIGLPVSPETQIFNPDFANAEKGSRAPKKIP
TTCA_PSYWF       --------------FEGHNIQVGVANELAEIGLPTQPDIKPF--------ESATAAKKIP
TTCA2_FRATF      ------------------------------------------------------------
TTCA2_FRATH      ------------------------------------------------------------
TTCA2_FRATO      ------------------------------------------------------------
TTCA_FRATM       ------------------------------------------------------------
TTCA1_FRATT      ------------------------------------------------------------
TTCA1_FRAT1      ------------------------------------------------------------
TTCA1_FRATW      ------------------------------------------------------------
TTCA1_FRATN      ------------------------------------------------------------
TTCA2_FRAP2      ------------------------------------------------------------
TTCA_NEIMB       --------------GGDLAFDSEKMPERFSDGSEEDESEIKIEPQK--------------
TTCA_NEIMA       --------------GGDLAFDSEKMPERFSDGSEEDESEIKIEPQK--------------
TTCA_NEIM0       --------------GGDLAFDSEKMPERFSDGSEEDESEIKIAPQK--------------
TTCA_NEIMF       --------------GGDLAFDSEKMPERFSDGSEEDESEIKIAPQK--------------
TTCA_NEIG1       --------------GGDLAFDSEKMPERFSDGSEEDESEIKIEPQK--------------
TTCA_HAEIN       --------------EGDTAFDEERIT---PMQFEDEDQTDFSN-----------------
TTCA_HAEIE       --------------EGDTAFDEERIT---PMQFEDEDQTDFSN-----------------
TTCA_HAEI8       --------------EGDTAFDEEKIT---PMQFEDEDQTDFSN-----------------
TTCA_ACTPJ       --------------EGDIAFDKAEIPNQPLIQDEDEQTTDYGE-----------------
TTCA_ACTP2       --------------EGDIAFDKAEIPNQPLIQDEDEQTTDYGE-----------------
TTCA_HAEDU       --------------EGDIAFDKMDIPMTLNIQEEDE-KQAYTQ-----------------
TTCA_HAES1       --------------EGDIAFDKEAFSPTPLVQENDEKIDFIQ------------------
TTCA_HISS2       --------------EGDIAFDKEAFSPTPLVQENDEKIDFIQ------------------
TTCA_PASMU       --------------EGDIAFDKPEFIATSPIDDDDEQQDFHQ------------------
TTCA_ACTSZ       --------------SGDIAFDKEELPPMPQFADEGESADFSG------------------
TTCA_MANSM       --------------EGDIAFDKEELPQTPIIDEDTE--DFVNN-----------------
TTCA_SALPA       --------------GGDLAFDREEIPLQPAGWQPEEDDTS--------------------
TTCA_SALPB       --------------GGDLAFDREEIPLQPAGWQPEEDDTS--------------------
TTCA_SALTY       --------------GGDLAFDREEIPLQPAGWQPEEDDTA--------------------
TTCA_SALTI       --------------GGDLAFDREEIPLQPAGWQPEEDDTA--------------------
TTCA_SALCH       --------------GGDLAFDREEIPLQPAGWQPEEDDTS--------------------
TTCA_SALAR       --------------GGDLAFDREEIPLQPAGWQPEEDDTP--------------------
TTCA_ECO57       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_SHISS       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOLI       --------------GGDLAFDREEIPLQPACWQPEEDENQ--------------------
TTCA_ECODH       --------------GGDLAFDREEIPLQPACWQPEEDENQ--------------------
TTCA_SHIBS       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_SHIB3       --------------GGDLAFDREEIPLQPAGWQPEEEENQ--------------------
TTCA_SHIDS       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOUT       --------------GGDLAFDREEIPLQPSGWQPEEDENQ--------------------
TTCA_ECOK1       --------------GGDLAFDREEIPLQPSGWQPEEDENQ--------------------
TTCA_ECOL6       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOL5       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOLC       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECO24       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOHS       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_SHIFL       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_SHIF8       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_ECOSM       --------------GGDLAFDREEIPLQPAGWQPEEDENQ--------------------
TTCA_CITK8       --------------GGDLAFDREEIPLQPAGWQPEEDDNQ--------------------
TTCA_KLEP7       --------------GGDLAFDREDIPLQPAGWQPEEEDAR--------------------
TTCA_ENT38       --------------GGDLAFDREDIPMQPAGWQPEEDDSQ--------------------
TTCA_CROS8       --------------GGDLAFDREEIPMMPAGWTPE-DDAA--------------------
TTCA_YERPE       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPP       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPG       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPA       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPN       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERP3       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPY       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPS       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERPB       --------------GGDLAFDREALPLNPVGWQPEDDEDTEK------------------
TTCA_YERE8       --------------GGDLAFDREELPLQPVSWQPEDAEDGDT------------------
TTCA_PECAS       --------------GGDLAFDREELPLQPAGWQPEEDDD--A------------------
TTCA_SERP5       --------------GGDLAFDREDIPMQPIGWQPEDADD---------------------
TTCA_SODGM       --------------GGDIAFDRESFPAQPAGWQDLMDDDLPVSSRNDNWTCSNCAEYAQS
TTCA_PHOLL       --------------GGDLAFDREELPMQPVVDIEDQPNYQ--------------------
TTCA_AERHH       --------------GGDKAFDPPELPKAPLLDID--------------------------
TTCA_AERS4       --------------GGDKAFDPPELPTAPLLNID--------------------------
TTCA_COLP3       --------------GGDTAFDEVAIEAPQDLSMKNQP-----------------------
TTCA_PSYIN       --------------GGDLAFDKEPIKHHTEDITPIET-----------------------
TTCA_IDILO       --------------NGDKAFDT-DSFTTNFETED-SP-----------------------
TTCA_PSEHT       --------------GGDIALDKPDIPKVPINSLQ-DE-----------------------
TTCA_VIBCH       --------------GGDIGFDKEEIAPQVVEDEDLVM-----------------------
TTCA_VIBC3       --------------GGDIGFDKEEIAPQVVEDEDLVM-----------------------
TTCA_VIBVU       --------------GGDIGFDKEEMPVATVEDEDMVQ-----------------------
TTCA_VIBVY       --------------GGDIGFDKEEMPVATVEDEDMVQ-----------------------
TTCA_ALIF1       --------------GGDIGFDKEEMPTLPVDADDAVA-----------------------
TTCA_VIBCB       --EFSEAVVSST---NIDESMFIDVTNI--------------------------------
TTCA_VIBPA       --EFSEAVVSST---NIDESLFIDVTNI--------------------------------
TTCA_PHOPR       --EFTEAEVSSSNI-NIDESMFIDVTNI--------------------------------
TTCA_SACD2       FPPLDDSFAGNSLKGEQDPVKLIEAVNLG-------------------------------
TTCA_PSEAE       ------------------TPRFLDVMNL--------------------------------
TTCA_PSEAB       ------------------TPRFLDVMNL--------------------------------
TTCA_PSEA7       ------------------TPRFLDVMNL--------------------------------
TTCA_PSEMY       ------------------TPRFLDVMSL--------------------------------
TTCA_PSEU5       ------------------TPRFVDVMSL--------------------------------
TTCA_PSEE4       ------------------TPRFLDVLNI--------------------------------
TTCA_PSEPW       ------------------TPRFLDVLNI--------------------------------
TTCA_PSEPG       ------------------TPRFLDVLNI--------------------------------
TTCA_PSEP1       ------------------TPRFLDVLNI--------------------------------
TTCA_PSEPK       ------------------TPRFLDVLNI--------------------------------
TTCA_PSEF5       ------------------TPRFVNVVNL--------------------------------
TTCA_PSEPF       ------------------ASRFVNVVNL--------------------------------
TTCA_PSE14       ------------------ASRFVNVVNI--------------------------------
TTCA_PSEU2       ------------------ASRFVNVVNI--------------------------------
TTCA_PSESM       ------------------ASRFVNVVNI--------------------------------
TTCA_SHEB8       -----------VAEANLPAFDFLDIANSGRIDLDAA------------------------
TTCA_SHEB9       -----------VAEANLPAFDFLDIANSGRIDLDAA------------------------
TTCA_SHEB5       -----------VAEANLPAFDFLDIANSGRIDLDAA------------------------
TTCA_SHEPC       -----------VAEADLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHESW       -----------VAEADLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHESA       -----------VAEADLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHESM       -----------VAEADLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHESR       -----------VAEADLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHEON       -----------VAEANLPAFDFLDIANSGHIDLDAA------------------------
TTCA_SHEAM       -----------VAEADLPAFDFMDTANSGHINLDDASKR---------------------
TTCA_SHELP       -----------VAESDLPAFDFLDLANSGHIDLDAAKRSS--------------------
TTCA_SHEHH       -----------VAESDLPAFDFVDVANNGHINLDKA------------------------
TTCA_SHEPA       -----------VAESDLPAFDFVDVSNNGHINLDAA------------------------
TTCA_SHESH       -----------VAESDLPAFDFVDVANNGHIDLDAAAKSR--------------------
TTCA_SHEWM       -----------VAESDLPAFDFVDVSNNGHIDLDAASKAKRVN-----------------
TTCA_SHEDO       -----------VAESDLPAFDFLDTSNSGHIDLDAAKARSDLL-----------------
TTCA_SHEFN       -----------VADADLPAFDFVDISNNGHINLDIS------------------------
TTCA_CHRSD       ------------------RIETFDVLAREA------------------------------
TTCA_HAHCH       ------------SMEPE-EFNQISVLNL--------------------------------
TTCA_MARHV       ------------TAEPQQDFGRLDVLNL--------------------------------
TTCA_ALCBS       -----------------DQAHRLDVVNLFG------------------------------
TTCA_MARMS       -------------------FDRLNIISL--------------------------------
TTCA_CHRVO       --------------DGDTAFDKEEFRDPAPDADDVEDAPK--------------------
TTCA_NITEU       --------------EGDKAFDEEPLSVIPVDMDHDDDSTFEP------------------
TTCA_NITEC       --------------EGDKAFDEELLPDSPVGMNHDD-AASEL------------------
TTCA_NITMU       --------------DGDRAFDPE-----PFEPGVEELLSLNK------------------
TTCA_NITOC       --------------EGDKAFDEE-----VFLESQEKSPPFHG------------------
TTCA_CYTH3       --------------EKDTP----------KVEEYIP------------------------
TTCA_PSEA6       --------------EGDTAFDPLELTPVTKVDTLAVPITRID------------------
TTCA_DICNV       --------------EESD------------------------------------------
TTCA_AZOSB       --------------EGDTVFDPPELPAAAAPITLRRADDDGDR-----------------
TTCA_AROAE       --------------EGDIAFDRAELPPASAAVMPTVMQLTDHR-----------------
TTCA_DECAR       --------------EGDIAFDAPEMPISGMIPISQTA-----------------------
TTCA_CUPTR       --------------DEASLFGETTFQQQPLTFAGSLDENRMEF-----------------
TTCA_CUPNH       --------------DEASLFGETTFQQQPLMFAGNVEENRMEF-----------------
TTCA_CUPPJ       --------------DEASLFGETTFTQQPLVFAGSSDENRLEF-----------------
TTCA_CUPMC       --------------DEASLFGETTFTQQALTFTGNVEANRMEF-----------------
TTCA_RALSO       --------------GEEALFGQTAYDQAPLVFAGSHD-DRIEF-----------------
TTCA_METFK       --------------DEDPLFGDIDKESNPALSLVSSEGFRIEF-----------------
TTCA_ACISJ       --------------NGDMAFD-------------HEEFPVAPA-----------------
TTCA_DELAS       --------------NGDMAFD-------------HEEMPVSAS-----------------
TTCA_ACIAC       --------------DGDKAFD-------------AEEFPPAPA-----------------
TTCA_VEREI       --------------DGDKAFD-------------PQE-LATPA-----------------
TTCA_POLNA       --------------EGDKAFD-------------AEEFMQAA------------------
TTCA_POLSJ       --------------EGDKAFD-------------AEEFSEPQ------------------
TTCA_RHOFT       --------------DGDRVFD-------------EETFPMAK------------------
TTCA_BORBR       --------------GGDTAFDQIDPEP--DTAGPGCASDAPAG-----------------
TTCA_BORPE       --------------GGDTAFDQIDPEP--DTAGPGCASDAPAG-----------------
TTCA_BORPA       --------------GGDTAFDQIDPEP--DTAGPGCASDAPAG-----------------
TTCA_BORPD       --------------NGDTAFDPIDPEDPREDAGDACASSPADG-----------------
TTCA_BORA1       --------------NGDIAFD----EP---QTDDACDASAP-------------------
TTCA_LEPCP       --------------AGDRAFD--------EDDSELCAPSGSAD-----------------
TTCA_METPP       --------------LGDKAFD--------DD--ETCAPPGAAS-----------------
TTCA_BURCM       --------------QGDIAFD-----------EEPCASGDDTA-TRDG------------
TTCA_BURA4       --------------QGDIAFD-----------EEPCASGDDTAATRDG------------
TTCA_BURVG       --------------LGDIAFD-----------EEPCASGDATGDAAGN------------
TTCA_BURCA       --------------QGDIAFD-----------EEPCASGDDAA-----------------
TTCA_BURCH       --------------QGDIAFD-----------EEPCASGDDAA-----------------
TTCA_BURCC       --------------QGDIAFD-----------EEPCASGDDAA-----------------
TTCA_BURL3       --------------QGDIAFD-----------EEPCASGDDTA-----------------
TTCA_BURM1       --------------QGDIAFD-----------EEPCASGDETA-----------------
TTCA_BURMA       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURM9       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURPS       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURP0       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURP1       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURP6       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURM7       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURMS       --------------NGDIAFD-----------EDPCGT-DASA-----------------
TTCA_BURTA       --------------NGDIAFD-----------EDPCGT-GASA-----------------
TTCA_PARPJ       --------------QGDIAFD-----------EEPCSTDAAEG-----------------
TTCA_PARXL       --------------QGDIAFD-----------EEPCSTDSGNS-----------------
TTCA_PARP8       --------------HGDIAFD-----------EEPCSADSASN-----------------
TTCA_HERAR       --------------NGDIAFD-----------EEPCST-GST------------------
TTCA_JANMA       --------------NGDIAFD-----------EEPCST-GSTS-----------------
TTCA_POLAQ       --------------IAARSSG-----------DRAIDEADLDE-----------------
TTCA_DEIGD       ---------------GDRGFDGEEYPEREFLAGLSNLTLLG-------------------
TTCA_DEIRA       ---------------GDTGFDAESFPEREFMAGLSELSLLQ-------------------
TTCA_COXBU       ------------------------------------------------------------
TTCA_COXBR       ------------------------------------------------------------
TTCA_COXBN       ------------------------------------------------------------
TTCA_LEGPL       ---------------CEEVFNAQEFELEDEKI----------------------------
TTCA_LEGPH       ---------------CEEVFNAQEFELEDEKI----------------------------
TTCA_LEGPA       ---------------CEEVFNAQEFEIEDEKI----------------------------
TTCA_LEGPC       ---------------CEEVFNAQEFEFEDEKI----------------------------
TTCA1_FRATF      ------------------------------------------------------------
TTCA1_FRATO      ------------------------------------------------------------
TTCA1_FRATH      ------------------------------------------------------------
TTCA2_FRATT      ------------------------------------------------------------
TTCA2_FRAT1      ------------------------------------------------------------
TTCA2_FRATW      ------------------------------------------------------------
TTCA2_FRATN      ------------------------------------------------------------
TTCA1_FRAP2      ------------------------------------------------------------
TTCA_BDEBA       ------------------------------------------------------------
TTCA_SORC5       -------------ARDEAGVGAPAPDVLPVGNLLRNLA----------------------
TTCA_GEOMG       ------------------------------------------------------------
TTCA_GEOSL       ------------------------------------------------------------
TTCA_GEOUR       ------------------------------------------------------------
TTCA_PELPD       ------------------------------------------------------------
TTCA_PELCD       ------------------------------------------------------------
                                                                             

TTCA_ANADE       -----------------------------------
TTCA_ANADF       -----------------------------------
TTCA_MYXXD       -----------------------------------
TTCA_RHIEC       -----------------------------------
TTCA_RHIL3       -----------------------------------
TTCA_AGRFC       -----------------------------------
TTCA_RHIME       -----------------------------------
TTCA_SINMW       -----------------------------------
TTCA_BARHE       -----------------------------------
TTCA_BART1       -----------------------------------
TTCA_BARBK       -----------------------------------
TTCA_BRUAB       -----------------------------------
TTCA_BRUA2       -----------------------------------
TTCA_BRUO2       -----------------------------------
TTCA_BRUSU       -----------------------------------
TTCA_BRUC2       -----------------------------------
TTCA_BRUSI       -----------------------------------
TTCA_BRUME       -----------------------------------
TTCA_OCHA4       -----------------------------------
TTCA_CHESB       -----------------------------------
TTCA_RHILO       -----------------------------------
TTCA_RHOS4       -----------------------------------
TTCA_RHOS1       -----------------------------------
TTCA_RHOS5       -----------------------------------
TTCA_RUEPO       -----------------------------------
TTCA_RUEST       -----------------------------------
TTCA_ROSDO       -----------------------------------
TTCA_DINSH       -----------------------------------
TTCA_PARDP       -----------------------------------
TTCA_HYPNA       -----------------------------------
TTCA_ACAM1       -----------------------------------
TTCA_ALKEH       -----------------------------------
TTCA_XYLF2       -----------------------------------
TTCA_XYLFT       -----------------------------------
TTCA_XYLFM       -----------------------------------
TTCA_XYLFA       -----------------------------------
TTCA_STRMK       -----------------------------------
TTCA_XANAC       -----------------------------------
TTCA_XANC5       -----------------------------------
TTCA_XANOR       -----------------------------------
TTCA_XANOM       -----------------------------------
TTCA_XANOP       -----------------------------------
TTCA_XANCP       -----------------------------------
TTCA_XANCB       -----------------------------------
TTCA_XANC8       -----------------------------------
TTCA_METCA       -----------------------------------
TTCA_ACIBC       -----------------------------------
TTCA_ACIBY       -----------------------------------
TTCA_ACIBT       -----------------------------------
TTCA_ACIAD       -----------------------------------
TTCA_PSYA2       TINPVI-----------------------------
TTCA_PSYCK       TINPVI-----------------------------
TTCA_PSYWF       TINPIID----------------------------
TTCA2_FRATF      -----------------------------------
TTCA2_FRATH      -----------------------------------
TTCA2_FRATO      -----------------------------------
TTCA_FRATM       -----------------------------------
TTCA1_FRATT      -----------------------------------
TTCA1_FRAT1      -----------------------------------
TTCA1_FRATW      -----------------------------------
TTCA1_FRATN      -----------------------------------
TTCA2_FRAP2      -----------------------------------
TTCA_NEIMB       -----------AERKVINILANKPKTCGS------
TTCA_NEIMA       -----------AERKVINILANKPKACGA------
TTCA_NEIM0       -----------AERKVINILANKPKTCGA------
TTCA_NEIMF       -----------AERKVINILANKPKTCGA------
TTCA_NEIG1       -----------AERKVINILANKPKTCGP------
TTCA_HAEIN       -------------KEMINFKEVN------------
TTCA_HAEIE       -------------NEMINFKEVN------------
TTCA_HAEI8       -------------NEMINFKEVN------------
TTCA_ACTPJ       -------------NGMIQFKQVQ------------
TTCA_ACTP2       -------------NGMIQFKQVQ------------
TTCA_HAEDU       -------------NGTIQFKAV-------------
TTCA_HAES1       -------------GEMISFKEVN------------
TTCA_HISS2       -------------GEMISFKEVN------------
TTCA_PASMU       -------------VELINVKEIH------------
TTCA_ACTSZ       -------------ENLIQFKEVN------------
TTCA_MANSM       -------------GQLIRFKEVN------------
TTCA_SALPA       -----------LEALRLDVIEVK------------
TTCA_SALPB       -----------VEALRLDVIEVK------------
TTCA_SALTY       -----------LEALRLDVIEVK------------
TTCA_SALTI       -----------LEALRLDVIEVK------------
TTCA_SALCH       -----------LEALRLDVIEVK------------
TTCA_SALAR       -----------LETLRLDVIEVK------------
TTCA_ECO57       -----------LDELRLNVVEVK------------
TTCA_SHISS       -----------LDELRLNVVEVK------------
TTCA_ECOLI       -----------LDELRLNVVEVK------------
TTCA_ECODH       -----------LDELRLNVVEVK------------
TTCA_SHIBS       -----------LDELRLNVVEVK------------
TTCA_SHIB3       -----------LDELRLNVVEVK------------
TTCA_SHIDS       -----------LDELRLNVVEVK------------
TTCA_ECOUT       -----------LDELRLNVVEVK------------
TTCA_ECOK1       -----------LDELRLNVVEVK------------
TTCA_ECOL6       -----------LDELRLNVVEVK------------
TTCA_ECOL5       -----------LDELRLNVVEVK------------
TTCA_ECOLC       -----------LDELRLNVVEVK------------
TTCA_ECO24       -----------LDELRLNVVEVK------------
TTCA_ECOHS       -----------LDELRLNVVEVK------------
TTCA_SHIFL       -----------LDELRLNVVEVK------------
TTCA_SHIF8       -----------LDELRLNVVEVK------------
TTCA_ECOSM       -----------LDELRLNVVEVK------------
TTCA_CITK8       -----------LDELRLNVVEVK------------
TTCA_KLEP7       -----------LDELRLNVVEVK------------
TTCA_ENT38       -----------LDEMRLNIVEVK------------
TTCA_CROS8       -----------PPMQRLDVLEIK------------
TTCA_YERPE       -----------RPPVRLDVLEIK------------
TTCA_YERPP       -----------RPPVRLDVLEIK------------
TTCA_YERPG       -----------RPPVRLDVLEIK------------
TTCA_YERPA       -----------RPPVRLDVLEIK------------
TTCA_YERPN       -----------RPPVRLDVLEIK------------
TTCA_YERP3       -----------RPPVRLDVLEIK------------
TTCA_YERPY       -----------RPPVRLDVLEIK------------
TTCA_YERPS       -----------RPSVRLDVLEIK------------
TTCA_YERPB       -----------RPSVRLDVLEIK------------
TTCA_YERE8       -----------QPLVRLDVLEIK------------
TTCA_PECAS       -----------SPITRLDVLEIK------------
TTCA_SERP5       -----------AAPVRLDVLEIK------------
TTCA_SODGM       APPTQQRKALTGPQARIAGAPVIPLATRHPPW---
TTCA_PHOLL       -------------SERLDIIEVK------------
TTCA_AERHH       ------------EMDMLDVIEVR------------
TTCA_AERS4       ------------EMDVLDVIEVR------------
TTCA_COLP3       -----------NADQLLNVVEVK------------
TTCA_PSYIN       -----------QYYQQHQAVKIKQLT---------
TTCA_IDILO       -----------VFASNIPIKHLA------------
TTCA_PSEHT       -----------DASAEVVTINLS------------
TTCA_VIBCH       -----------EFDPSLQLNVTNI-----------
TTCA_VIBC3       -----------EFDPSLQLNVTNI-----------
TTCA_VIBVU       -----------EFDPSLKLDVTNI-----------
TTCA_VIBVY       -----------EFDPSLKLDVTNI-----------
TTCA_ALIF1       -----------EFDPSLKLDVVNVD----------
TTCA_VIBCB       -----------------------------------
TTCA_VIBPA       -----------------------------------
TTCA_PHOPR       -----------------------------------
TTCA_SACD2       -----------------------------------
TTCA_PSEAE       -----------------------------------
TTCA_PSEAB       -----------------------------------
TTCA_PSEA7       -----------------------------------
TTCA_PSEMY       -----------------------------------
TTCA_PSEU5       -----------------------------------
TTCA_PSEE4       -----------------------------------
TTCA_PSEPW       -----------------------------------
TTCA_PSEPG       -----------------------------------
TTCA_PSEP1       -----------------------------------
TTCA_PSEPK       -----------------------------------
TTCA_PSEF5       -----------------------------------
TTCA_PSEPF       -----------------------------------
TTCA_PSE14       -----------------------------------
TTCA_PSEU2       -----------------------------------
TTCA_PSESM       -----------------------------------
TTCA_SHEB8       --------------KRIDIVNTYEV----------
TTCA_SHEB9       --------------KRIDIVNTYEV----------
TTCA_SHEB5       --------------KRIDIVNTYEV----------
TTCA_SHEPC       --------------QRIDVVSFYEA----------
TTCA_SHESW       --------------QRIDVVSFYEA----------
TTCA_SHESA       --------------KRINIVNVYEA----------
TTCA_SHESM       --------------KRINIVNVYEA----------
TTCA_SHESR       --------------KRINIVNVYEA----------
TTCA_SHEON       --------------KRIDIVNVYEV----------
TTCA_SHEAM       ------------QGTRIDVVSTFTP----------
TTCA_SHELP       ------------DLLKIDVVSTYTP----------
TTCA_SHEHH       --------------VRIDVVNTYTPD---------
TTCA_SHEPA       --------------ARIDVVSTYTPE---------
TTCA_SHESH       ------------SENKIDIVSTYTP----------
TTCA_SHEWM       ------------PEHKINIVSTYTP----------
TTCA_SHEDO       ------------SQQRIDIVSSYKP----------
TTCA_SHEFN       --------------NRIDVVATFKP----------
TTCA_CHRSD       -----------------------------------
TTCA_HAHCH       -----------------------------------
TTCA_MARHV       -----------------------------------
TTCA_ALCBS       -----------------------------------
TTCA_MARMS       -----------------------------------
TTCA_CHRVO       -------------KRTISILDSRGKESGCGA----
TTCA_NITEU       --------------ENEHDGGAVQGGVI-------
TTCA_NITEC       --------------DEACSTEAVQGGTI-------
TTCA_NITMU       --------------D--------------------
TTCA_NITOC       --------------SKIRVLQFK------------
TTCA_CYTH3       -----------------------------------
TTCA_PSEA6       -----------------------------------
TTCA_DICNV       -----------------------------------
TTCA_AZOSB       --------------SAT------------------
TTCA_AROAE       --------------TDGK-----------------
TTCA_DECAR       -----------------------------------
TTCA_CUPTR       --------------VRFER------APAAEPAGTP
TTCA_CUPNH       --------------VRFERPPAAAAAPAAEQAGTQ
TTCA_CUPPJ       --------------VRFERPPQ--TSATVQQASIE
TTCA_CUPMC       --------------VRFDKIQKVQEAPERASEPSA
TTCA_RALSO       --------------VRFERNPAGKAPEGAEQPAA-
TTCA_METFK       --------------KRNIA----------------
TTCA_ACISJ       -------------LPGLQVVQLG------------
TTCA_DELAS       -------------LPGLQVVQLSS-----------
TTCA_ACIAC       -------------LPGLQVVQIS------------
TTCA_VEREI       -------------EQVVQIVPTRRSS---------
TTCA_POLNA       -------------PAGRAVIGINPLAPG-------
TTCA_POLSJ       -------------RPGLSVIDIASR----------
TTCA_RHOFT       -------------LAGVQVLGSSC-----------
TTCA_BORBR       ----------QADGMAEQRVVFR------------
TTCA_BORPE       ----------QADGMAEQRVVFR------------
TTCA_BORPA       ----------QADGMAEQRVVFR------------
TTCA_BORPD       ----------DA-AMAEQKVVFARL----------
TTCA_BORA1       -----------TDGLNEQQIVFSRFS---------
TTCA_LEPCP       ----------AAGDEVSVPVALIRRV---------
TTCA_METPP       ----------VI--EAAMPIRWHGQG---------
TTCA_BURCM       --------ARPI-----SIVQFDDL----------
TTCA_BURA4       --------ARPIAARPISIVQFDDL----------
TTCA_BURVG       --------TTSGAARPISIVQFDDL----------
TTCA_BURCA       ---------APGAAQPISIVQFDDL----------
TTCA_BURCH       ---------APGAAQPISIVQFDDL----------
TTCA_BURCC       ---------APGAAQPISIVQFDDL----------
TTCA_BURL3       ---------APGGAQPISIVQFDDL----------
TTCA_BURM1       ---------APGGAKPISIVQFDDL----------
TTCA_BURMA       ----------PGGAKSVSIVQFDDL----------
TTCA_BURM9       ----------PGGAKSVSIVQFDDL----------
TTCA_BURPS       ----------PGGAKSVSIVQFDDL----------
TTCA_BURP0       ----------PGGAKSVSIVQFDDL----------
TTCA_BURP1       ----------PGGAKSVSIVQFDDL----------
TTCA_BURP6       ----------PGGAKSVSIVQFDDL----------
TTCA_BURM7       ----------PGGAKSVSIVQFDDL----------
TTCA_BURMS       ----------PGGAKSVSIVQFDDL----------
TTCA_BURTA       ----------PGGAKSVSIVQFDDL----------
TTCA_PARPJ       --------AMPGATKSISIVQFDDL----------
TTCA_PARXL       --------TTLDGAKSIAIVQFDDL----------
TTCA_PARP8       --------QTQRPSQTVSFVQFDDI----------
TTCA_HERAR       -------------ISSVIPLRTED-----------
TTCA_JANMA       -------------IPGIIPLRADD-----------
TTCA_POLAQ       ----------LACGTMIQGTYNPSL----------
TTCA_DEIGD       -----------------------------------
TTCA_DEIRA       -----------------------------------
TTCA_COXBU       -----------------------------------
TTCA_COXBR       -----------------------------------
TTCA_COXBN       -----------------------------------
TTCA_LEGPL       -----------------------------------
TTCA_LEGPH       -----------------------------------
TTCA_LEGPA       -----------------------------------
TTCA_LEGPC       -----------------------------------
TTCA1_FRATF      -----------------------------------
TTCA1_FRATO      -----------------------------------
TTCA1_FRATH      -----------------------------------
TTCA2_FRATT      -----------------------------------
TTCA2_FRAT1      -----------------------------------
TTCA2_FRATW      -----------------------------------
TTCA2_FRATN      -----------------------------------
TTCA1_FRAP2      -----------------------------------
TTCA_BDEBA       -----------------------------------
TTCA_SORC5       -----------------------------------
TTCA_GEOMG       -----------------------------------
TTCA_GEOSL       -----------------------------------
TTCA_GEOUR       -----------------------------------
TTCA_PELPD       -----------------------------------
TTCA_PELCD       -----------------------------------