CLUSTAL format seed alignment for MF_01854

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F16PC_CLOAB      MLLESNTKNEEIKDNLKYLVLLSKQYPTINEAATEIINLQAILNLPKGTEHFLSDVHGEY
F16C1_CLOB8      -MKKYDLSTNEISDNLRYLELLSKQYPTINEASTEIINLQAILNLPKGTEHFLTDIHGEY
F16PC_CLOB1      MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
F16PC_CLOBH      MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
F16PC_CLOBL      MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
F16PC_CLOBK      MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
F16PC_CLOBM      MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
F16PC_CLONN      MTFCDENNLDLIKKDLRYLKLLANQYPNISSASTEIVNLEAILNLPKSTEHFLSDIHGEY
F16PC_CLOTE      MTLYDEDNINLIKDDLRYLKLLSTKYHNIPSACSEIINLQAILNLPKGTEHFISDIHGEY
F16PC_ALKMQ      MVYSNNDVIQDFGSDLRYLKLLSKEFPTIASASTEIINLQAILNLPKGTEHFLSDIHGEY
F16PC_CLOBA      ----MNNNDVEDIKKLKYFRLLAKQYPNIALAATEIINLEAILNLPKGTEHFLSDIHGEY
F16PC_CLOBB      MEVKMNKNEQEDSKKLKYFRLLAKQYPNIALASTEIINLEAILNLPKGTEHFLSDIHGEY
F16C2_CLOB8      ---------MEKYDDIKYLSLLAKQYPTIAAASTEIINLEAILNLPKGTEHFLADLHGEY
F16PC_CLOD6      MKNLCKISDDYLNSKLKYLKLLSKQYPSISKASTEIINLEAILNLPKGTEHFITDVHGEY
F16PC_BACFR      MTAQSNITPESIVADLRYLQLLSRSFPTIAAASTEIINLEAILNLPKGTEHFLTDIHGEY
F16PC_BACFN      MTAQSNITPESIVADLRYLQLLSRSFPTIAAASTEIINLEAILNLPKGTEHFLTDIHGEY
F16PC_BACTN      MTAQSNITPESIVGDLRYLQLLSRSFPTIADASTEIINLEAILNLPKGTEHFLTDIHGEY
F16PC_BACV8      MNAYNSITPETIQEDMRYLQLLSHSFPTIADASTEIINLEAILNLPKGTEHFLADLHGEY
F16PC_PARD8      --MTKDIIAESVQNDLRYLQLLARSFPTIADASTEIINLEAILNLPKGTEHFLSDLHGED
F16PC_PORGI      ----------MLKHDLDYLELLSESFPTATEAATEIINLEAILNLPKGTEHFLADIHGEY
F16PC_PORG3      ----------MLKHDLDYLELLSESFPTATEVATEIINLEAILNLPKGTEHFLADIHGEY
F16PC_FUSNN      -----------MNTEIKYLELLSKTFKNIAETSTEIINLQAIMNLPKGTEHFMTDIHGEY
F16PC_LISMO      ----------MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEY
F16PC_LISMF      ----------MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEY
F16PC_LISIN      ----------MENIDMKYLHLLAKQYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEY
F16PC_LISW6      ----------METNDMKYLQLLATEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEY
F16PC_BACSU      -------------MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEY
F16PC_BACVZ      -------------METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEY
F16PC_OCEIH      ------------MLEEKFLDLLAQKYDSEEKVVTEIINLEAILDLPKGTEHFVSDLHGEY
F16PC_STAAT      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAA3      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAA8      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAE      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAC      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAS      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAW      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAA1      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAM      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAA2      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAA9      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAN      -----MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAB      -----MTQITERELKKKYLDLLSQRFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAAR      -----MTQITERELKKKYLDLLSQHFDTPEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAES      -----MTHITESEMKQKYLDLLSQKFDSAEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAEQ      -----MTHITESEMKQKYLDLLSQKFDSAEKLATEIINLESILELPKGTEHFVSDLHGEY
F16PC_STAHJ      -----MTQTTESELREKYLDLLSQQFDSPEKLATEIVNLESILELPKGTEHFVSDLHGEY
F16PC_STAS1      -----MQKSADKSLKDRYLDLLSQQFNTKEELATEIINLESILELPKGTEHFVSDLHGEF
F16PC_STAXY      -----MHNSTDKSVKERFLDLLSEQFNTKEALATEIINLESILELPKGTEHFVSDLHGEF
F16PC_LACP3      ---------------MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEY
F16PC_LACCB      ---------------MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEY
F16PC_LACSS      -------------MINNKMKTLSDKYPTKMAVTSEIINLKAILNLPKPTEAFMSDLHGEY
F16PC_LACS1      -------------MNAYSHNLLKEKYPTKQDVITEIMNLEAILHLPKGTEHFVSDLHGEY
F16PC_ENTFA      ------------------MATLNRDQQ-----IEEIINLEAILNLPKGTEHFVSDLHGEF
F16PC_STRGC      --------------MEQYKRILLKEFDSRQKVITELTNLEAILNLPKGTELYISDIHGEF
F16PC_STRSV      --------------MEQYKRILLKEFDSRQKVITELTNLEAILNLPKGTELYISDIHGEF
F16PC_PEDPA      ------------MYKEKYFEELKKEFNSEDEIVTEIVNLEAILNLPKGTEYFISDIHGEY
F16PC_LACLM      -------------MDKKYYQLLKKQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEY
F16PC_LACLA      -------------MDKKYYQLLKNQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEY
F16PC_STRA1      --------------MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEY
F16PC_STRA3      --------------MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEY
F16PC_STRA5      --------------MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEY
F16PC_FINM2      ------------MNNLKYLKLLAKEFPTIEQAANKIISLTSLSVLPKGTEYFLSDLHGQY
F16PC_SACD2      -------------------MTSNALKVFISDLHGELDVFDFLADRQFGILHLLIRQQFSP
F16PC_SORC5      ---------MLDTRELPLLRALAGRYPTTEAALSEIGHLRAILSLPKGTVHVVSDVHGEH
F16PC_DESPS      -------------------MAEKICITEIDKLSQKLLRIETELNANIPTTLWISDLHGEG
                                                   ::  :             :   : . 

F16PC_CLOAB      EQFIHVLKNASGVIKRKIDDIFGNRLMQSE-KKSLATLIYYPEQKLDIILKQE---KNID
F16C1_CLOB8      EPFIHVLKNASGVIKRKIEDLFGNSLMQSE-KKSLATLIYYPEQKLEIVLKQE---ENID
F16PC_CLOB1      ESFTHMLKNASGVIKRKIDDVFGTSLRECD-KKNLATLIYYPEQKLDLIKKSE---KNLE
F16PC_CLOBH      ESFTHMLKNASGVIKRKIDDVFGTSLRECD-KKNLATLIYYPEQKLDLIKKSE---KNLE
F16PC_CLOBL      ESFTHMLKNASGVIKRKIDDVFGTSLRECD-KKNLATLIYYPEQKLDLIKKSE---KNLE
F16PC_CLOBK      ESFTHMLKNASGVIKRKIDDVFGTSLRECD-KKNLATLIYYPEQKLDLIKKSE---KNLE
F16PC_CLOBM      ESFTHMLKNASGVIKRKIDDVFGTSLRECD-KRNLATLIYYPEQKLDLIKKSE---KNLE
F16PC_CLONN      ESFTHVLKNASGVIKRKIDDVFGNSLRDNE-KLTLATVIYYPEQKLELIKQSE---KDLS
F16PC_CLOTE      ESFTHMLKNASGVIKRKLDDIFGTSLMDKD-KDSLATLIYYPKEKLEILKESN---NDLE
F16PC_ALKMQ      ESFNHVLKNGSGNIKRKIIEVFGDLLSETE-IKSLATLIYYPEQKLDLIHKKE---ENIE
F16PC_CLOBA      EPFVHVLRNGSGVVKRKIEDLFCKSLLESD-IKSLATLIYYPEQKLDIVLKEE---RNID
F16PC_CLOBB      EPFVHVLRNGSGVVKRKIEDLFCKSLLESD-IKSLATLIYYPEQKLDIVLKEE---RNID
F16C2_CLOB8      EPFVHVLKNGSGAIKRKIQEVFENSLMDCE-KRSLTTLVYYPEQKLEIVLREE---KDIN
F16PC_CLOD6      EPFVHVLKNGSGVIKRKIEELFSNTIRDSE-KKMLATLVYYPEQKLDLIIKQE---ENID
F16PC_BACFR      EAFQHVLKNASGAVKRKVNEIFGHTLREIE-KKELCTLIYYPEEKLQLIKATE---TDID
F16PC_BACFN      EAFQHVLKNASGAVKRKVNEIFGHTLREIE-KKELCTLIYYPEEKLQLIKATE---TDID
F16PC_BACTN      EAFQHVLKNASGAVKRKVNEIFGNTLREAE-KKELCTLIYYPEEKIQLVKARE---KDLD
F16PC_BACV8      EAFQHVLRNASGAIKRKVNEIFGNTLRENE-KKELCTLIYYPEQKLDLVKAVE---TDLD
F16PC_PARD8      QAFSHVLRNASGAVKRKVNEIFSNTLRESE-KKELCSLIYYPEDKLELIKSQE---QDLE
F16PC_PORGI      EAFIHVLKNASGSIRRKVDEVFGGQLRQNQ-KRELCTLIYYPREKLELVKQSD---ERME
F16PC_PORG3      EAFIHVLKNASGSIRRKVDEVFGGQLRQNQ-KRELCTLIYYPREKLELVKQSD---ERME
F16PC_FUSNN      EAFNHVLRNGSGTIRNKIEEAYGNKLTENE-KKELASIIYYPKEKVELMQNKDN--FNID
F16PC_LISMO      SAFEQVLRNGSGVVKRKIRDIFGAELDDAE-INSLSTLIYYPEEKMDLIASET---EDLH
F16PC_LISMF      SAFEQVLRNGSGVVKRKIRDIFGAELDDAE-INSLSTLIYYPEEKMDLLASET---EDLQ
F16PC_LISIN      SAFEQVLRNGSGVVKRKIRDIFGDELDDAE-INSLSTLIYYPEEKMDLIAEEM---DDMH
F16PC_LISW6      SAFEQVLRNGSGVIKRKIRDIFGEELDDAE-INSLSTLIYYPEEKMDLIADEM---DDIH
F16PC_BACSU      QAFQHVLRNGSGRVKEKIRDIFSGVIYDRE-IDELAALVYYPEDKLKLIKHDFDAKEALN
F16PC_BACVZ      QAFQHVLRNGSGRVKEKIRDIFSGVIYDRE-IDELAALVYYPEDKLKLIKHDFDTKEALN
F16PC_OCEIH      QAFQHVLRNGSGKVKEKIRDIFKHELSEKE-INEFATLIYYPEEKLQLIRNQFDNKQELN
F16PC_STAAT      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQNCGQLN
F16PC_STAA3      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQNCGQLN
F16PC_STAA8      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQNCGQLN
F16PC_STAAE      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQNCGQLN
F16PC_STAAC      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQNCGQLN
F16PC_STAAS      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAAW      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAA1      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAAM      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAA2      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAA9      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAAN      EAFQHVLRNGSGNVRAKINDIFKERLSTKE-LNDLTALVYYPEDKLKLIKSDFQSCGQLN
F16PC_STAAB      EAFQHVLRNGSGNVRAKINDIFKDKLSTKE-LNDLTALVYYPEDKLQLIKCDFQNYGQLN
F16PC_STAAR      EAFQHVLRNGSGNVRAKINDIFKDKLSTKE-LNDLTALVYYPEDKLQLIKCDFQNYGQLN
F16PC_STAES      ESFQHVLRNGSGNVRAKINDIFKDKLSQQE-INDLAALVYYPEEKLKLVKNNFDSIGTLN
F16PC_STAEQ      ESFQHVLRNGSGNVRAKINDIFKDKLSQQE-INDLAALVYYPEEKLKLVKNNFDSIGTLN
F16PC_STAHJ      ESFQHVLRNGSGNVRSKINDLYAKTLSQKE-IDDLAALVYYPEEKLKLVKNNFDSKGKLN
F16PC_STAS1      HAFQHVLRNGSGNVRSKINDIFQDTLTRKE-INEFSALVYYPEEKLKIIKNSFSSKSELN
F16PC_STAXY      HSFQHVLRNGSGNVRSKINDIFQDTLTRKE-INEFSALVYYPEEKLQLIKNSFSSKSELN
F16PC_LACP3      NAFQHVLRNGSGNVKSKIRSCFRDEMTEAT-LQRFAFLVYYPSERMAAIHREMA-GDDLQ
F16PC_LACCB      NAFQHVLRNGSGNVKSKIRSCFRDEMTEAT-LQRFAFLVYYPSERMAAIHREMA-GDDLQ
F16PC_LACSS      DAFQHLIRTGAGNLRQKINELFSGEMTPET-MQAFAFLVYYPTERLALKHKALS-ENELN
F16PC_LACS1      TAFDHVLRNGSGSIKQKIQDYFSDRMTEQT-MQDFALLIYYPEDELALVKKKLRTENELQ
F16PC_ENTFA      EAFDHILRNGSGRIREKVQFLFKQELNAHQ-MDELCFIIYYPEEKLTLLENESA---LSY
F16PC_STRGC      EAFDYILRSCAGILNEKIKDCFGDSLSQDD-KNRLSALVSYPELVLKEGNKSRD------
F16PC_STRSV      AAFDYILRSCAGILNEKIKDCFGDSLSEVH-KDRLSALVSYPELVLGEETKGQD------
F16PC_PEDPA      DGLNHILKTGAGIIREKINDCFPE-MNETE-KNELNFTVAYPKYALEKRQLEQDAE-ELT
F16PC_LACLM      DAFNHVLRNGSGSIKEKLRDCF--PQFSSAEISSVATLIYYPQEKLDSECQLQD-KKLFE
F16PC_LACLA      DAFNHVLRNGSGSIKEKLRDCF--PEFSATEISSLATLIYYPQEKLDSECQLKE-TEEFE
F16PC_STRA1      DAVDYLLRTGAGSIRAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLS-ASAYK
F16PC_STRA3      DAVDYLLRTGAGSIRAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLS-ASAYK
F16PC_STRA5      DAVDYLLRTGAGSIRAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLS-ASAYK
F16PC_FINM2      DSFNRIIKSASGNTRIKIDLEFKDKLSESR-KNQLANLIYDPKTIINITKEND---EYTE
F16PC_SACD2      ELNETLCAAIEASAIRLCRAANASQAQLDR-TSAVSKEILFTALFLMVVQQKAE--DESL
F16PC_SORC5      RKLKHIINNASGSLRPLVERVFGDRLTAAE-ERALLSAVYYPRERYARVASHSE--GARW
F16PC_DESPS      DRFKSILRGRFGMLYQTCKEGLPATFTPEK-IQYLAKIVRKKNYFADSQQQMDR------
                      :     .                      .   :                     

F16PC_CLOAB      DWYKITLYRLIEVCRNVSSKYTRSKVRKALPKEFSYIIEELLHEQPKGVDKQEYYDEIIK
F16C1_CLOB8      DWYKINLYRLIEICRYVSSKYTRSKVRKALPKDFTYIIEELLHEQPKGIDKYEYYEQIIR
F16PC_CLOB1      DWYKITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIE
F16PC_CLOBH      DWYKITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIE
F16PC_CLOBL      DWYKITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIE
F16PC_CLOBK      DWYKITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIE
F16PC_CLOBM      DWYKITLYRLIRLCQIVSSKYTRSKVRKALPSDFAYIIEELLNEQGDRVDKQEYYNSIIE
F16PC_CLONN      DWYKITLYRLIELCRVVSSKYTRSKVRKALPHDFAYIIEELLHEHDGTINKHEYYNGIVS
F16PC_CLOTE      EWYKVTLYRLIQVCKSVSSKYTRSKVRKALPKNFSYIIEELLNEQADRVNKQEYYSGIIN
F16PC_ALKMQ      EWYKVTISRLVEVCRKAAFKYTRMKVRKALPKDFAYIIEELMHRGPKELDKEEYYNEIIE
F16PC_CLOBA      DWYKITLNRLIEICRFCSSKYTRSKVRKALPADFAYIIEELLHEQFNGIDKEEYYDRIIT
F16PC_CLOBB      DWYKITLNRLIEICRFCSSKYTRSKVRKALPADFAYIIEELLHEQFNGIDKEEYYDRIIT
F16C2_CLOB8      DWYKINLYRLIELCRHVSSKYTRSKVRKALPPDFSYIIEELLHEESDNNDKQGYYDGIIN
F16PC_CLOD6      DFYRINIYRLIELCKYASSKYTRSKVRKLLPENFKYIIEELLHEHVKSEHKEEYYKSIVE
F16PC_BACFR      DWYLITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHESTIEPNKHAYINVIIS
F16PC_BACFN      DWYLITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHESTIEPNKHAYINVIIS
F16PC_BACTN      DWYLITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHETSVEPNKHAYINVIIS
F16PC_BACV8      DWYVITLNQLVRVCQNVSSKYTRSKVRKSLPKEFSYIIQELLHENSMVPNKQAYINVIIS
F16PC_PARD8      DWYQVTLNQLVRVCRNVSSKYTRSKVRKALPKEFSYIIQELLHESSVEPNKSAYVDQIIC
F16PC_PORGI      DWYMVTLNQLIKVCQKAAEKYTRSKVRKTLPPKYSYIIQELLHEDGVNPNKSAYISSIFS
F16PC_PORG3      DWYMVTLNQLIKVCQKAAEKYTRSKVRKTLPPKYSYIIQELLHEDGVNPNKSAYISSIFS
F16PC_FUSNN      RWMITIIYRLIEVCKVVCSKYTRSKVRKAMTKDFEYILQELLYEKKELANKKEYFDSIVD
F16PC_LISMO      AWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQ
F16PC_LISMF      AWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQ
F16PC_LISIN      DWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEEDKKMYYEEILQ
F16PC_LISW6      AWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLQENYNEDDKKMYYEEILQ
F16PC_BACSU      EWYKETIHRMIKLVSYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIID
F16PC_BACVZ      EWYKETIHRMIKLVSYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIE
F16PC_OCEIH      AWYTKTIDQMIRLIPYASSKYTRTKLRKALPKQFVYIIEELLYKTDEYTNKKHYYSKIVQ
F16PC_STAAT      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAA3      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAA8      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAE      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAC      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAS      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAW      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAA1      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAM      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAA2      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAA9      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAN      VWYITTIEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVN
F16PC_STAAB      VWYITTIEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVN
F16PC_STAAR      VWYITTIEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVN
F16PC_STAES      IWYITTIQRLIDLITYCSSKYTRSKLRKALPEQYVYIIEELLYKSNEFHNKKPYYETLVN
F16PC_STAEQ      IWYITTIQRLIDLITYCSSKYTRSKLRKALPEQYVYIIEELLYKSNEFHNKKPYYETLVN
F16PC_STAHJ      VWYITTIEQLIDLITYCSSKYTRSKLRKALPKEYTYIVEELLYKNNEFNNKKSYYETLVN
F16PC_STAS1      EWYITTINRLIKLITYASSKYTRTKLRKSLPKNYVFIIEELLYKSNKYNNKHSYYETLIN
F16PC_STAXY      EWYITTINRLIKLITYASSKYTRTKLRKSLPENYVFIVEELLYKSNKYNNKHSYYETLIK
F16PC_LACP3      QWYLTTFRRLIRLLAFTATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIR
F16PC_LACCB      QWYLTTFRRLIRLLAFTATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIR
F16PC_LACSS      QWYLTTFKRMIDLLKFVSTKYTRSKVRKAMAPDFVYITEELMYGDVANVDKKRYFQEITA
F16PC_LACS1      QWYLDNISHLLEFLELSGSKYTRSKVRKALNPNFVYITEELLYNDPQEFNKRSYINQLLK
F16PC_ENTFA      EWWLLTIRRLVEIVRSSSMKYTRSKVRKALPETYGYILEELIYQYDETTTKNGYYQQIIE
F16PC_STRGC      -WYKDTIPQLLSLLAFAAAKYSRSKLRKALPPQYAYIIEELVYSDTALADKKSYFENILS
F16PC_STRSV      -WYQETIPQLLNLLAFAGAKYSRSKVRKALPPQYAYIIEELLYSDTALADKKSYFENILT
F16PC_PEDPA      QWYFGMITRMIGLTQFCASKYSRSKVRKSLPPKYAYIIEELLYVEGSPKNKQKYYEQIIS
F16PC_LACLM      HYCRLNLVYLLKTVKFVGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKQDYFDSILS
F16PC_LACLA      NYCRINLVYLLKTVKFVGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKRDYFDSILS
F16PC_STRA1      TKLWEMIPLQIQVLKYFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIE
F16PC_STRA3      TKLWEMIPLQIQVLKYFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIE
F16PC_STRA5      TKLWEMIPLQIQVLKYFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIE
F16PC_FINM2      TWIRDTIFYLIRIAKRVASKYSRQKVRNQTPFYYRDLIDEMLNIQYESLNKKEYFNQLLD
F16PC_SACD2      TIAIRRWGWLSTVHRALSGDAQLSCTPFSQLVEMLAQNIRTLSAQDFFA-----------
F16PC_SORC5      AFLIWTLAREVEVIRALSLRYTLRQVEAAFPEDMRGLLRELVSARATLGE-GGYLDALLD
F16PC_DESPS      ---QDVILCFVQILKYKLTNSTN-RNREIFLPEFRETIGRLLAG----------LPVPDP
                                                        . :                  

F16PC_CLOAB      TIISIDRAKEFITAISKLIQRLVVDRLHIIGDIFDRGPRADIIMDKLEEYH---AVDIQW
F16C1_CLOB8      TIIDTDRSKEFIVALSKLIQRLVIDRLHILGDIFDRGPGADIIMDTLVEYH---SVDIQW
F16PC_CLOB1      TIIDIDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHH---SIDIQW
F16PC_CLOBH      TIIDIDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHH---SIDIQW
F16PC_CLOBL      TIIDIDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHH---SIDIQW
F16PC_CLOBK      TIIDIDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHH---SIDIQW
F16PC_CLOBM      TIIDIDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHH---SIDIQW
F16PC_CLONN      TIIDIDRAPEFITAISKVIQRLVVDRLHIIGDIYDRGPGAEIIMEELMKHH---SVDIQW
F16PC_CLOTE      TIVDIGCADSLIIEISKVIQKLVVDRLHIIGDIYDRGPGAEIIMDALMDHH---SMDIQW
F16PC_ALKMQ      TIIRIGRADEFIIEMSKLIQRLVIDRLHIVGDIFDRGPGPDIVMDTLLNYH---SVDIQW
F16PC_CLOBA      TIIDIGRAKEFIIALSKLIQRMIIDRLHIIGDIYDRGPRPDIIIDTLMEYH---SVDIQW
F16PC_CLOBB      TIIDIGRAKEFIIALSKLIQRMIIDRLHIIGDIYDRGPRPDIIIDTLMEYH---SVDIQW
F16C2_CLOB8      TIIEIERAQEFIVALSKLIQRLVIDRLHIIGDIFDRGPRPDIILDTLINYH---SVDIQW
F16PC_CLOD6      TIVDIGIAKEFIIAISTVIQKLVVDRLHVIGDIYDRGPRPDIIVDKLIEHH---CVDIQW
F16PC_BACFR      TIISTRRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYH---NFDIQW
F16PC_BACFN      TIISTRRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYH---NFDIQW
F16PC_BACTN      TIISTKRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCNYH---NFDIQW
F16PC_BACV8      TIISTRRADDFIIALCNLIQRLTIDTLHVLGDIFDRGPAPHRIMDILCDYH---NFDVQW
F16PC_PARD8      TIISTGRADDFIIAMCNLIQRLTIDLLHIIGDIYDRGPGAHLIMDILCDYH---NFDVQW
F16PC_PORGI      SIISTGCADDFIIAISETIQRLVIDHLHVVGDVFDRGPGAHIIMDTLMKYH---HFDIQW
F16PC_PORG3      SIISTGCADDFIIAISETIQRLVIDHLHVVGDVFDRGPGAHIIMDTLMKYH---HFDIQW
F16PC_FUSNN      TIISIDRGKEFIIAICNLIQRLNIDHLHIVGDIYDRGPFPHLIMDTLAEYS---NLDIQW
F16PC_LISMO      HIISLGRAEEFISALSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYH---SLDFQW
F16PC_LISMF      HIISLGRAEEFISALSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYH---SLDFQW
F16PC_LISIN      HIISLDRAAEFISALSRLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYH---SLDFQW
F16PC_LISW6      HIISLDRAEEFISALARLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMHYH---SVDFQW
F16PC_BACSU      QIIELGQADKLITGLAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYH---SVDIQW
F16PC_BACVZ      QIIALGQADKLITGLAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYH---SVDIQW
F16PC_OCEIH      KVISLGQADKLIIGLAYTTQQLVVDHLHVVGDIYDRGPEPDKIMEALINYH---SLDIQW
F16PC_STAAT      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAA3      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAA8      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAE      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAC      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAS      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAW      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAA1      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAM      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAA2      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAA9      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAN      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAB      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAAR      QVIELKQADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SLDIQW
F16PC_STAES      QIIELEQSDDLIIGLSYTVQRLVVDHLHVVGDIYDRGPKPDKIMDTLINYH---SVDIQW
F16PC_STAEQ      QIIELEQSDDLIIGLSYTVQRLVVDHLHVVGDIYDRGPKPDKIMDTLINYH---SVDIQW
F16PC_STAHJ      QIIELEQSDDLIIGLSYSIQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYH---SVDIQW
F16PC_STAS1      QIIELEQSDDLIIGLSFTVQHLVVDHLHVVGDIYDRGPEPDKIMETLIDYP---SVDIQW
F16PC_STAXY      QIIELEQSDDLIIGLSFTVQHLVVNHLHVVGDIYDRGPEPDKIMETLIDYP---SVDIQW
F16PC_LACP3      NLIVLEQADQWIAATCQTIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQW
F16PC_LACCB      NLIVLEQADQWIAATCQTIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQW
F16PC_LACSS      TIIELGQADALIIATSHTIQRLVVDQWHIIGDIYDRGPHPDLIVDQLTQLP---AVDVQW
F16PC_LACS1      NILKLDQADKFIIATCYTIQRLVVDHLHVLGDVYDRGEEPDKIMDRLMNYH---SVDMQW
F16PC_ENTFA      KIILLGEAKRFVTELAYLIQRLIIDHLHVIGDIYDRGPAPDKIMDRLMSYH---SLDIQL
F16PC_STRGC      YVIELREAVPFILGISGSIRRLLIDHLHVVGDIFDRGAGSPQVMDELLHFH---SLDIQW
F16PC_STRSV      YVIELREAVPFILGLSRSIRQLLIDHLHVVGDIFDRGVGSAQVIDELQHFH---SLDIQW
F16PC_PEDPA      KIIELDRAQDLIQSLAGTIQKMVIDHIHIVGDVFDRGRKSNQVLELLEHAH---SLDFQW
F16PC_LACLM      QLQNLGELTRLIVALADTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLINMP---SVDVQW
F16PC_LACLA      QLQNLGEFTRLIVALADTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLIKMP---SVDVQW
F16PC_STRA1      KLFELDQVEDLIIVLSQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFP---NLDIQW
F16PC_STRA3      KLFELDQVEDLIIVLSQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFP---NLDIQW
F16PC_STRA5      KLFELDQVEDLIIVLSQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFP---NLDIQW
F16PC_FINM2      SIIKIEVSENFIITLCELIQDLNIDWLHIVGDIFDRGKRPDIIMDTLIAKK---DVDIQY
F16PC_SACD2      ----------LVQAFAKALFKKLSPELNIVGDIYDRGQDAFAIMERLRGLP---NVAIQW
F16PC_SORC5      PFVQHGREIEILRATARAIRNLTVFELVVAGDLGDRGPRLDKVIEYLMRQP---RVRVVW
F16PC_DESPS      IFEESIISDRLIFHLSYAIRQVLLDRIQVLGDVFDRGSQPDKIIRILSSPAYKEMVDYVF
                            :   .            : **: ***     ::  *        .    

F16PC_CLOAB      GNHDILWMGAASGSSVCMANVIRISARYANLSTIEDGYGINLLPLATFAMDFYGNDKCKN
F16C1_CLOB8      GNHDILWMGAACGSDVCIANVIKNSLKYANLDTLENGYGINLLPLATFSMDFYKDHPCNI
F16PC_CLOB1      GNHDIVWMGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCEN
F16PC_CLOBH      GNHDIVWMGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCEN
F16PC_CLOBL      GNHDIVWMGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCEN
F16PC_CLOBK      GNHDIVWMGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCEN
F16PC_CLOBM      GNHDIVWMGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCEN
F16PC_CLONN      GNHDILWMGAAAGSEACICNVLRISLRYANLNTIEDGYGINLLPLATFAMDVYENDPCNS
F16PC_CLOTE      GNHDILWMGAASGSKACTANVLRISLRYANLSTVEDGYGINLLPLATFAMKYYGNDPCES
F16PC_ALKMQ      GNHDVLWMGSAAGSEACIATLIRICATYSNLNTIEDGYGINLLPLATFALDFYKDDDCTA
F16PC_CLOBA      GNHDMLWMGAAAGVRTCVANVLRISTRYANLDLVEEIYGINLLPLATFALKYYRDDPCES
F16PC_CLOBB      GNHDMLWMGAAAGVRTCVANVLRISTRYANLDLVEEIYGINLLPLATFALKYYRDDPCES
F16C2_CLOB8      GNHDILWMGAASGNTTCIANVLRIAARYSNLDVIEDIYGINLLPLATFALKHYKNDNCIA
F16PC_CLOD6      GNHDILWMGAASGEKTCIANALRISARYANLDIVEDIYGINLLPLATFAIEMYKDDPCKE
F16PC_BACFR      GNHDILWMGAASGNEACMANVIRLSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTI
F16PC_BACFN      GNHDILWMGAASGNEACMANVIRLSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTI
F16PC_BACTN      GNHDILWMGAASGNDSCIANVIRMSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTI
F16PC_BACV8      GNHDILWMGAAAGNDCCMANVLRLAMRYGNLAALEDGYGINLLPLATFAMETYADDPCTL
F16PC_PARD8      GNHDILWMGAASGNLVSIANVIRMCLRFGNMATLEDGYGINLLPLATFAMEAYGDDPCAL
F16PC_PORGI      GNHDMLWMGAAVGNASCMANVVRIALRYANLDTLESGYGINLLPLARFAMDTYADDPCTV
F16PC_PORG3      GNHDMLWMGAAVGNASCMANVVRIALRYANLDTLESGYGINLLPLARFAMDTYADDPCTV
F16PC_FUSNN      GNHDILWIGAALGNKACIANVIRICCRYNNNDILEEAYGINLLPFATFAMKYYGDDPCKR
F16PC_LISMO      GNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTY
F16PC_LISMF      GNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTY
F16PC_LISIN      GNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEIYKNDPCTY
F16PC_LISW6      GNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEMYKNDPCTY
F16PC_BACSU      GNHDVLWIGAYSGSKVCLANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYD-DNPAF
F16PC_BACVZ      GNHDVLWIGAYSGSKVCLANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYD-DNPSF
F16PC_OCEIH      GNHDVLWIGAFSGSKVCLANILRICARYDNLDIIEDVYGINLRPLLNLAEKYYK-DNPAF
F16PC_STAAT      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAA3      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAA8      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAE      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAC      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAS      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAW      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAA1      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAM      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAA2      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAA9      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAN      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAB      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAAR      GNHDVLWVGAYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAF
F16PC_STAES      GNHDVLWIGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDAENPAF
F16PC_STAEQ      GNHDVLWIGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDAENPAF
F16PC_STAHJ      GNHDVLWIGAYAGSKACLANLLRICARYDNLDIIEDAYGINLRPLLTLAEEHYNGENPAF
F16PC_STAS1      GNHDVLWIGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKHYDGKNKAF
F16PC_STAXY      GNHDVLWIGAYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLADKYYDGSNPAF
F16PC_LACP3      GNHDILWIGGAAGSALCIANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQ-DNPAF
F16PC_LACCB      GNHDILWIGAAAGSALCIANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQ-DNPAF
F16PC_LACSS      GNHDILWFGAASGSELCLLNLLRICARYNNLAIIEETYGIALTDLVRFAAQHYQ-ANSAF
F16PC_LACS1      GNHDLLWLGAMAGSKLCMLNLLRICARYNNLNIIEDAYGINLRHLSRFAEEQYE-DNPQF
F16PC_ENTFA      GNHDMIWLAAYSGSLACLANVVRICARYGNLDLLEERYAIDLTALKKFSLETYK-ENPAF
F16PC_STRGC      GNHDIIWMGGFFGSKACMLNALRIAARYGYLWDIEKAYGLNLRALTLFADRTYK-TNPKF
F16PC_STRSV      GNHDIIWMGAFFGSKACLLNVLRIAARYGYLWDIEKDYGLNLRSLTLFADKTYQ-SNPKF
F16PC_PEDPA      GNHDVLWLGGYAGSQACIATLFRIATRYGYIYDLEREYGINLRALFTFATQHYQ-ANPAF
F16PC_LACLM      GNHDIVWMAAFSGSPLAMMNVIRICARYGNLDILEESYGINLRAILEYAERYYE-PSEAF
F16PC_LACLA      GNHDIVWMAAFSGSPLAMMNVIRICARYGNLDILEESYGINLRMILEYAERYYE-PSEAF
F16PC_STRA1      GNHDVTWMGAASGSYLCMVNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYE-PLPSF
F16PC_STRA3      GNHDVTWMGAASGSYLCMVNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYE-PLPSF
F16PC_STRA5      GNHDVTWMGAASGSYLCMVNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYE-PLPSF
F16PC_FINM2      GNHDVTWIGAYLGSYVNACNVVRNAISYNNFQSLEDGYGINLRLLSTLADESYYDDPCER
F16PC_SACD2      GNHDVVWMGAASGNLACITVAVRICLRYGTLDMLHRDYGINLSRLERFAAKAYGDDDCAQ
F16PC_SORC5      GNHDVSWMGASLGQEALIATVVRLSLRYGRLSQLEEGFGISVAPLDRLARTAYADDPAER
F16PC_DESPS      GNHDILWMGAAAGTPSLVAETLRITCRYDHF-RLLNRLRFDTSRLAEFAERTYEIKKATG
                 ****: *...  *        .:    :     :     :    :   :   *       

F16PC_CLOAB      FEPKIE-SDKSYTVKEIELIGKMHKAIAIIQFKLEGEAIKRHPEFKMEHRMLLNKINFED
F16C1_CLOB8      FLPKMD-CDKKYSINEINLIAQMHKAIAIILFKLEGQVILRHPEFNMNHRLLLNKINYAE
F16PC_CLOB1      FKPRT--IDKNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMGERLLLDKINIKE
F16PC_CLOBH      FKPRT--IDKNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMGERLLLDKINIKE
F16PC_CLOBL      FKPRT--IDKNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMEERLLLDKINIKE
F16PC_CLOBK      FKPRT--IDKNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMEERLLLDKINIKE
F16PC_CLOBM      FKPRT--IDKNLNKTDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMEERLLLDKINIKE
F16PC_CLONN      FIPKT--INKELTQNELNLISKMHKAIAIIQFKLQGQIIKNHPEFKMDDQLLLDKINYEK
F16PC_CLOTE      FIPKA--LDKMLDESDKNLYAKMHKAISIIQFKLEGQKIKRHPEFKLENMLLLDKINFDD
F16PC_ALKMQ      FKPKIK-SDIIYTENDLKLIAKMHKAISIIQFKLEGEIINRRPHFSMEDRLLLNKINYED
F16PC_CLOBA      FIPKVK-EDDPAANQEVDLVSKMHKAITILQFKLEKEIIDRRPEFELEERLLLDKIDYEK
F16PC_CLOBB      FIPKVK-EDDPAASQEVDLVSKMHKAITILQFKLEKEIIDRRPEFELEGRLLLDKIDYEK
F16C2_CLOB8      FVPKNT-DETLYGASEIELISKMHKAITIIQFKLEYEIIKRRPEFNMDHRLLLDKINYSD
F16PC_CLOD6      FIPKVN-DQS-VTTTEKSLMAKMHKAISIIQFKLEGEVIRRRPEFEMEHRLLLNMINYDE
F16PC_BACFR      FAPKTNFADSTYNEKTLRLITQMHKAITIIQFKLEANIINRRPEFGMGGRKLLEKIDFER
F16PC_BACFN      FAPKTNFADSTYNEKTLRLITQMHKAITIIQFKLEANIINRRPEFGMGGRKLLEKIDFER
F16PC_BACTN      FMPKMNFADTNYNEKTLRLITQMHKAITIIQFKLEAEIIDRRPEFGMSNRKLLEKIDFER
F16PC_BACV8      FGPKVEKEDCTYNAKTLRMIGQMHKAISVIQFKLEAEIIRRRPDFEMDDRMLLHRIDFER
F16PC_PARD8      FMPKTKFADNAMDEKTTRLIAQMHKAITIIQFKLEGEIIRRRPEFEMDDRMLLHHIDLKR
F16PC_PORGI      FKPKLAQADQTYDDKSVYLISQMHKAISIIQFKLEHQIIARHPEYKMDNRDLFHLVNFTD
F16PC_PORG3      FKPKLAQADQTYDDKSVYLISQMHKAISIIQFKLEHQIIARHPEYKMDNRDLFHLVNFTD
F16PC_FUSNN      FRAKEG--------VDSDLIAQMHKAMSIIQFKVEGLYSERNPELEMSSRESLKHINYEK
F16PC_LISMO      FQPKNE-ENINYSNAEITQIARMHKAISIIQFKLEGEIIKRRKEFDMNHRLLLQFIDYKK
F16PC_LISMF      FQPKNE-ENINYSNAEITQIARMHKAISIIQFKLEGEIINRRKEFDMDHRLLLQFIDYKK
F16PC_LISIN      FQPKNE-DNLNYSKAEITQIARMHKAISIIQFKLEGEIINRRKEFDMNHRLLLQMIDYKK
F16PC_LISW6      FQPKNE-DNIDYSKAEITQIARMHKAIAIIQFKLEGEIINRRQEFDMNHRLLLDFIDYTN
F16PC_BACSU      RPKA--DENR--PEDEIKQITKIHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDK
F16PC_BACVZ      RPKA--DENR--PEDEIKQITKIHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDR
F16PC_OCEIH      RPKR--HSNKKLSDQEQSQITKIHQAIAMIQFKLEMPIIKRRPYFNMSKRLLLEKVDYEN
F16PC_STAAT      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAA3      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAA8      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAE      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAC      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAS      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAW      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAA1      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAM      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAA2      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAA9      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAN      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDT
F16PC_STAAB      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDT
F16PC_STAAR      KPKKRPDKHERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDT
F16PC_STAES      KPKKRPDKDVSLTKREESQITKIHQAIAMIQFKLEMPIIKRRPSFEMEERLVLEKIDYDN
F16PC_STAEQ      KPKKRPDKDVSLTKREESQITKIHQAIAMIQFKLEMPIIKRRPSFEMEERLVLEKIDYDN
F16PC_STAHJ      KPKKRPDKPVGLSKLEESQITKIHQAIAMIQFKLEMPIIKRRPTFEMEDRLVLEKVNYDT
F16PC_STAS1      RPKN----AEGLTELELEQITKIHQAIAIIQFKLEAPIIKRRPTFEMEERLVLESINYEK
F16PC_STAXY      RPKN----AEGLSELELEQITKLHQAIAIIQFKLEAPIIKRRPAFEMEERLVLEKIDYDK
F16PC_LACP3      SPKME-RSDRPITEAERLQITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDF
F16PC_LACCB      SPKME-RSDRPITEAERLQITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDF
F16PC_LACSS      MPVED-PNQGPLTHAEKLKISQVQQALAIMQFKLELTVIKRHPEFNMDHRLLLSQVDFKR
F16PC_LACS1      RPKLT-NGDGYRFNGEKLQITQIHQAVAMMQFKLEGQVIARRPELKMDDRDLLNKIDYKK
F16PC_ENTFA      APKK--NPYRALTEAEKQVAMRVQQAIAIIQEKLEGQIIGRRPDFNLAHRLRLDKIQGE-
F16PC_STRGC      RPILGHR-EVDFTAEEILQLEKVHQALTIIQFKLESQLIKRRPEFQMEDQVTLDKIDYWE
F16PC_STRSV      RPILGGR-EQEFSEEEILQLEKVHQALSIIQFKLENQLIKRRPEFQMQDHVMLDKIDYWE
F16PC_PEDPA      YPKAG-----DFDQNNLDLLSQVHQALTIIQFKLEGQVIKRQPEFQMDDRLFLDEVQ--Q
F16PC_LACLM      RPRLV--DGVRLSADEKALLNKLQQTTAILQFKLESQLIERRPDFQLEHRDLLHFIDFSQ
F16PC_LACLA      QPRLV--EGVRLSDDEKALLNKLQEATAILQFKLESQLIKRRPDFQLEHRDVLHFIDFSE
F16PC_STRA1      VPILD--GEEMTHPDELDLLNMIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKD
F16PC_STRA3      VPILD--GEEMTHPDELDLLNMIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKD
F16PC_STRA5      VPILD--GEEMTHPDELDLLNMIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKD
F16PC_FINM2      FKVRIL-DDNKHSETDLLHAARMHKAISIIQFKLENQLFKRNPEFEQLDRLYLERIDFKN
F16PC_SACD2      FTPKGD-----LNAEEKLRIARMHKAISIIQFKLEGKLIARRPEYTMADRLLLDKINIAN
F16PC_SORC5      FAVRG------EGLRDALLMARMQKAAAVLQFKLEGQLCRRRPEYALEHRCLLHRIDARA
F16PC_DESPS      -----------KFKAKTDRGRAMEKALTVIQFKLEEKLINDFPHYGMEKRLWLERLAEML
                                       :.:: :::  *::                 :  :    

F16PC_CLOAB      STIELD-GKKYKLNDTSFPTIDKNDPYKLIDEEREVVEKLRSSFVNSEKLNRHVRFLFSH
F16C1_CLOB8      GTINLN-GKTHKLKDSFFPTIDPKNPYELTYDEKELIDKLKTSFINSDKYNKHVRFLYSN
F16PC_CLOB1      GTLNLN-EKIYKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSN
F16PC_CLOBH      GTLNLN-EKIYKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSN
F16PC_CLOBL      GTLSLN-EKIYKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSN
F16PC_CLOBK      GTLNLS-EKIYKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSN
F16PC_CLOBM      GTLNLN-EKIYKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSN
F16PC_CLONN      GTIDLD-GHIYKLNDTFFPTVDPKDPYKLTENEDDLIKKLTRSFVNSEKLQRHIRFMYSK
F16PC_CLOTE      GTITFE-GSTYKLNDTNLPTIDPKNPYKLTKEESELIEKLQGSFLNSEKLQKHIRFMYSI
F16PC_ALKMQ      GTVDID-GKIYKLKDSNFPTINPKNPYKLTIEEKELMEKLKSSFLNSEKLQRHVRFLFSN
F16PC_CLOBA      GTIILN-GTEYKLNDNNFPTIDPKDPYKLTEEESVLIDKLVYSFVNSDKLQKHVRFLFSK
F16PC_CLOBB      GTIILN-GIEYKLNDNNFPTIDPKDPYKLTDEESVLIDKLVYSFVNSDKLQKHVRFLFSK
F16C2_CLOB8      GTITLN-NITYELCDKSFPTININNPFELTSDEKKLVSKLQISFINSDKLQKHVLFLFNK
F16PC_CLOD6      GTINLK-GKTYKLKDTYLPTIDKKDPYKLTMEERNVIDKLVSSFRGSEKLQKHVSFLFSK
F16PC_BACFR      GVFVYE-GKEYPLRDTNFPTVDPADPYRLTDEEQELIEKIHYSFMNSEKLKKHMRCLFTY
F16PC_BACFN      GVFVYE-GKEYPLRDTNFPTVDPADPYRLTDEEQELIEKIHYSFMNSEKLKKHMRCLFTY
F16PC_BACTN      GVFVYE-GKEYALRDTNFPTVDPADPYRLTDEERELVEKIHYSFMNSEKLKKHMRCLFTY
F16PC_BACV8      KTITMPNGKEYELKDSFLPTVNPADPYKLTDEEREIMNKLHRSFVSSEKLKKHIRCLFRY
F16PC_PARD8      GVVHID-GKDYTLKDTNWPTLDPKDPYRLSIEEEDLIRKILHSFESSEKMKKHMRCFFRH
F16PC_PORGI      GTIKLS-SGVYPMLDMNFPTVDPADPYALTEQEQNIVDRLMGCFMRSEKLQNHLKCLYRH
F16PC_PORG3      GTIKLS-SGVYPMLDMNFPTVDPADPYALTEQEQNIVDRLMGCFMRSEKLQNHLKCLYRH
F16PC_FUSNN      GTINLN-GVEYPLNDTNFPTVNPENPLELLEEEAELLDKLQASFLGSEKLQKHMQLLFAK
F16PC_LISMO      GTIQLK-GKEYQLLDNHFPTINPENPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSK
F16PC_LISMF      GTIHLK-GKEYLLLDSHFPTINPEKPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSK
F16PC_LISIN      GTIHLK-GKDYQLLDTHFPTIDPNDPYKLTKEEKELIEKITASFKNCRRLQKHVQFLYSK
F16PC_LISW6      GTIHIK-GKDYDLLDSHFPTIDPENPYKLTTAEQELIEKIMASFKNCRRLQKHVQFLYAK
F16PC_BACSU      NEITLN-GKTYQLENTCFATINPEQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKK
F16PC_BACVZ      NEITLN-GKTYQLENTCFATVNPKQPDELLEEEAEVMDKLLFSVQNSEKLGRHMNFMMKK
F16PC_OCEIH      NKITID-GKTYPLENTCFATVNPDQPDELLEEEKQVMDKLLFSVQHSEKLARHMEFLMKK
F16PC_STAAT      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAA3      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAA8      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAE      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAC      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAS      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAW      NEITVY-GNTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAA1      NEITVY-GNTYPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAM      NEITVY-GNTYPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAA2      NEITVY-GNTYPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAA9      NEITVY-GNTYPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAN      NEITVY-GNTYPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAB      NEITVY-RKTYPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAAR      NEITVY-GKTYPLKDTCFQTVNRDNPAKLLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAES      NEITIY-NKTYPLKDTCFQTVNPNNPAELLAEEKEVMDKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAEQ      NEITIY-NKTYPLKDTCFQTVNPNNPAELLAEEKEVMDKLLLSFQQSEKLRRHMSFLMRK
F16PC_STAHJ      NEITIY-GKTYPLKDTCFSTVDPQDPGKLLPEEEEVMNKLLLSFQQSEKLKRHMSFLMKK
F16PC_STAS1      NEATLY-GKTYPLENTCFQTIDPNGPNKLTDEESEVMDKLLLSVQQSEKLKRHMTFLMQK
F16PC_STAXY      NEATLY-GKTYPLEHTCFQTVDPNDPNKLTDEEADVIDKLLLSVQQSEKLKRHMTFLMQK
F16PC_LACP3      STIKLN-GDTYTIENGCFATVDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDH
F16PC_LACCB      STIKLN-GDTYTIENGCFATVDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDH
F16PC_LACSS      RILHLN-GQEYPLKNTCFQLVDPENPEALTAEESQIIADLLAAFTRCQKLRKHLTFLIDH
F16PC_LACS1      NVINLN-GKEYSLQNTCFNTVDPKNPNELTDEENAIVDELLISIQHSTKLKRHLDFMMNK
F16PC_ENTFA      -TITFD-ECRYTLINSCFQTVSEEQPYQLTREEKQIIDDLLTQFQSSPRLTKHMRFLMEK
F16PC_STRGC      ECLTID-DKKHPLINTCFQTIDPTNPSELSPEEAQAVDSMLASFQGSLKLAEHINLLMKK
F16PC_STRSV      ESITID-DTKHALVNTCFQTINPENPSALTPEENQAVDSMLASFQSSLKMAEHMSLLMNK
F16PC_PEDPA      GKIQLG-DQEYPLENGCFQMVDADHPYELTKEEQEVIDSLSYSFRHSPKIKVHVNFILEK
F16PC_LACLM      NKIELA-GETYDLIDFQAPTINPEQPASLTEEEEKIIAHLLNNFKTSDKLKRHVGFLQEK
F16PC_LACLA      KTIKLG-TEVYELTDFQAPTVNPEQPESLTAEEEKIISHLLNNFRSSDKLKRHVEFLQEK
F16PC_STRA1      LSISIK-EVVHQLKDFNSRCIDSKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEK
F16PC_STRA3      LSISIK-EVVHQLKDFNSRCIDSKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEK
F16PC_STRA5      LSISIK-EVVHQLKDFNSRCIDSKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEK
F16PC_FINM2      GIYKDANGKAHALLDIKFPTVDPDNPLELTPSEQEVVECISKSFRTSHRLKEHMDFLFSY
F16PC_SACD2      STVTVG-DAVHPLLDSNFPTLDVEQPYRLSEDERKVAEDLKQQFLASAKLTQHMDILFHR
F16PC_SORC5      GTVAID-GEVFPLLDARFPTLDPGDPYALTPDEAACVALLKESFLRSPALSRQMRWMVQQ
F16PC_DESPS      KTGATE-----ELNDSDFPTIDLENPSKLSKEESEIINDLIEQFRSNKYLKRLLKFFFEE
                             : .     :.   *  *   *      :   .         :  :   

F16PC_CLOAB      GNLYLKFNSNLLYHGCIPLNEDGTFKEVLIGSH--KYKGKALLDKLDVLARK-SFFYEEN
F16C1_CLOB8      GSLYLKFNSNLLYHGFIPLNEDGSFKKVKIADK--EYKGKELLDKLDMLARE-AYFSKDK
F16PC_CLOB1      GNLYLKYNSNLLYHGCIPLNEDGSLKEVTLCKE--TLKGKSLLDKLDRLARE-AYFFKKD
F16PC_CLOBH      GNLYLKYNSNLLYHGCIPLNEDGSLKEVTLCKE--TLKGKSLLDKLDRLARE-AYFFKKD
F16PC_CLOBL      GSLYLKYNSNLLYHGCIPLNEDGSLKEVTLCKE--TLKGKSLLDKLDRLARE-AYFFKKD
F16PC_CLOBK      GSLYLKYNSNLLYHGCIPLNEDGSLKEVTLCKE--TLKGKSLLDKLDRLARE-AYFFKKD
F16PC_CLOBM      GSLYLKYNSNLLYHGCIPLNEDGSLKEVTLCKE--TLKGKSLLDKLDRLARE-AYFFKKD
F16PC_CLONN      GSMYLVYNSNLLYHGCVPLNEDGTFKEITIDGV--RYSGKSLLDKFDSLARE-AFFFKNG
F16PC_CLOTE      GSLYLVYNSNLLFHGCIPLNEDSSFRTLNICNK--EYSGKSLLDLFDKYARE-AYYYKDD
F16PC_ALKMQ      GSMYLKFNSNLMYHGGIPMNEDGSFKKVTIDSSGISYSGKAYFDRLEILVRE-AYFRKNN
F16PC_CLOBA      GNMYLKFNSNLLFHGCIPLDDDGNLKSMWIQGE--EYESKRLLEKFDSLSRE-GYFEKVG
F16PC_CLOBB      GNMYLKFNSNLLFHGCIPLDDEGNLKSMCIQGE--EYESKRLLEKFDSLSRE-GYFEKVG
F16C2_CLOB8      GRLYLTYNSNLLFHGCIPLNKDKTFKSMTIHGE--EYKGKKLLDKFDSLARE-GYFSTRG
F16PC_CLOD6      GSIYLKANSNLLIHGCVPLNEDGSFMSMNIMGK--EYKGKALMDKMESLARE-GFFFKDK
F16PC_BACFR      GGMYLVCNSNLLYHASVPLNEDGSFKHVNICGK--EYWGKNLLDKIDQLIRT-AYFDEDD
F16PC_BACFN      GGMYLVCNSNLLYHASVPLNEDGSFKHVNICGK--EYWGKNLLDKIDQLIRT-AYFDEDD
F16PC_BACTN      GGMYLVSNSNLLYHASVPLNEDGSFKHVKIRGK--EYWGRKLLDKADQLIRT-AYFDEEG
F16PC_BACV8      GCMYTVSNSNLLFHASIPLNADGTLKDVSIAGK--MYKGKALLEKVGHLIRT-AFFAEED
F16PC_PARD8      GGMYQVCNSNLLFHASIPMNPDGTFKSVRILGQ--DYKGRALLDRVDQLIRT-AYFKTGE
F16PC_PORGI      GSMYLTYNMNLLYHASIPLNKDKSLKKVRVGDK--TYAGRELLDKVEEMIRT-AYVAPEK
F16PC_PORG3      GSMYLTYNMNLLYHASIPLNKDKSLKKVRVGDK--TYAGRELLDKVEEMIRT-AYVAPEK
F16PC_FUSNN      GGMYLKYNSNLLFHACIPMEPNGEFSELFVEDG--YYKGKALMDKIDNIVRQ-AYYDRKN
F16PC_LISMO      GSMFLTYNGNLLYHGCIPLHKDGTFMEMKLRGE--KYAGRALLEQFEILTRE-AYVRPTG
F16PC_LISMF      GSMFLTYNGNLLYHGCIPLHEDGTFMEMKLRGE--KYAGRSLLEQFEILTRE-AYVRPTG
F16PC_LISIN      GSMFLTYNGNLLYHGCIPLYEDGTFMEMKLRGE--NFSGRELLEQFEILTRE-AYVRKPG
F16PC_LISW6      GSMFLTYNGNLLYHGCIPLHEDGTFMEMKLRGK--KFAGKELLEQFEILTRE-AYVRPPG
F16PC_BACSU      GSLYLKYNGNLLIHGCIPVDENGNMETMMIEDK--PYAGRELLDVFERFLRE-AFA--HP
F16PC_BACVZ      GSLYLKYNGNLLIHGCIPVDENGSMETMMIEDK--AYAGRELLDVFERFLRE-AFA--HP
F16PC_OCEIH      GTLYLRYNGNLLIHGCIPIDENGNMEKMFIENK--TYAGRELLDIFENYLLH-AFS--NR
F16PC_STAAT      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAA3      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAA8      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAE      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAC      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAS      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAW      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAA1      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAM      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAA2      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAA9      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAN      GSLYLPYNGNLLIHGCIPVDENGEMESFEIDGH--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAB      GSLYLPCNGNLLIHGCIPVDENGEMESFEIDGQ--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAAR      GSLYLPCNGNLLIHGCIPVDENGEMESFEIDGQ--TYSGQELLDVFEYHVRK-SFD--EK
F16PC_STAES      GKLYLPYNGNLLIHGCIPVDENGEMESFEIEGE--RLSGRELLDVFEYHVRR-AFD--HK
F16PC_STAEQ      GKLYLPYNGNLLIHGCIPVDENGEMESFEIEGE--RLSGRELLDVFEYHVRR-AFD--HK
F16PC_STAHJ      GKLYLPYNGNLLIHGCIPVDENGEMESFEIEGE--QHKGRDLLDVFERHVRY-AYD--YK
F16PC_STAS1      GTLYLPYNGNLLIHGCIPVDENGEMESMVINDV--KCYGRDLLDHFEDYVRE-AFD--HK
F16PC_STAXY      GKLYLPYNGNLLIHGCIPVDEQGEMESMVIDGV--KCYGRDLLDHFEEYVRI-AFD--HK
F16PC_LACP3      GSMYLRYNRNLLLHGCVPVDEDGNFIGLTIKGT--TYTGRQLFDMLEANLRL-AYS--QP
F16PC_LACCB      GSMYLRYNRNLLLHGCVPVDEDGNFIGLTIKGT--TYTGRQLFDMLEANLRL-AYS--QP
F16PC_LACSS      GSMYRIYNQNLLFHGCLPVDAQGHFLTLTLANQ--NYAGKQLLDFFDQQIRS-SFN--HP
F16PC_LACS1      GSMYRTYNGNLLFHGCIPADEEGNFCSLKIGSK--EYSGKKLFDFSEKMIRK-AYS--KP
F16PC_ENTFA      ASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGH--SYSGKALVDFFQEMLEE-AYA--QP
F16PC_STRGC      GSMYKIYNQHLLFHGCIPLEPSGEFQPLMIHQA--HYVGRKLLDFFEYHIRQ-AAK--NK
F16PC_STRSV      GSMYKIYNKHLLFHGCIPLEPSGEFQPFILNQA--HYAGKELLDFFEYHIRQ-AAK--DK
F16PC_PEDPA      GSMYLIYNNNLLYHGCIPLTEDGDFDQFEYHGQ--KYAGKDLLTFFERHIRA-GAA--KK
F16PC_LACLM      GAMYLSYNGNLLIHGCLPLHENGDFKSFTIDKK--AYAGRDLLDFFDSEVRK-CLA--HP
F16PC_LACLA      GAMYLSYNGNLLIHGCLPLHENGDFKSFTVNKE--AHAGRDLLDFFDQEVRK-CLA--HP
F16PC_STRA1      GSMYLTYNDNLLFHGCIPMHSNGDFKSFKIAGK--TYGGRDLLDLFESQIRL-AYA--RP
F16PC_STRA3      GSMYLTYNDNLLFHGCIPMHSNGDFKSFKIAGK--TYGGRDLLDLFESQIRL-AYA--RP
F16PC_STRA5      GSMYLTYNDNLLFHGCIPMHSNGDFKSFKIAGK--TYGGRDLLDLFESQIRL-AYA--RP
F16PC_FINM2      GSVYKIANSNLLFHGCIPMNKDGSFEEFTYQSN--TYSGKSLLDFFEGIINS-ARNMDDN
F16PC_SACD2      GGMQKKTGDWLLYHACVPVDEQGEFQPFALAPE--TTRGQSLFNFCELEMRR-GYLNRMV
F16PC_SORC5      GTTWLRRDRALIFHGCVPVDGEGELLPFVVDGE--VRRGRALFDALERTVRR-AFRA---
F16PC_DESPS      GSTYHISNNFLNIHALVPSTKEGEFEEFMGHKG------KDLLDYIQKVIRRTGQNYLYN
                 .      .  *  *. :*   .  :              :  .                 

F16PC_CLOAB      SKNSKYENDMIWYLWSGPFSPLFGKEKMTTFERYFIDDKKTHYEKKDPYYHYRDDEDICI
F16C1_CLOB8      D-DSDNKKDIMWYLWCGASSPLFGKDRMTIFEQYFIEEKETHYEKKDPYFSLRDNEDICK
F16PC_CLOB1      PESKLYGMDMMWYLWCGSNSPLFGKKKMTTFERYFLDDKNTHKEQKNPYYKYRNDEKMCT
F16PC_CLOBH      PESKLYGMDMMWYLWCGSNSPLFGKKKMTTFERYFLDDKNTHKEQKNPYYKYRNDEKMCT
F16PC_CLOBL      PESKLYGMDMMWYLWCGSNSPLFGKKKMTTFERYFLDDKNTHKEEKNPYYKYRNDEKMCT
F16PC_CLOBK      PESKLYGMDMMWYLWCGSNSPLFGKKKMTTFERYFLDDKNTHKEEKNPYYKYRNDEKMCT
F16PC_CLOBM      PESKLYGMDMMWYLWCGPNSPLFGKKKMTTFERYFLDDKDTHKEEKNPYYKYRNDEKMCT
F16PC_CLONN      SSAKRFALDMMWYLWCGPNSPEFGKLRMTTLERYFIDDKGTHIEYRNPYYKYRSNEKVVT
F16PC_CLOTE      DNVKNYAMDMMWYLWCGPISPLFGKHKMTTFERYFIDDKKTHKEIKDPYYTYRDSEELCN
F16PC_ALKMQ      PIAKQHGMDITWYLWTGPDSPLFGKDKMTTFERYFINDKETHVEKKDPYFKLEDNEKMCR
F16PC_CLOBA      SEEKTYGMDIMWYLWTGPVSPLFGKKKMATFERYFIDDEIAHIEQKTGYYKLRDREEMCD
F16PC_CLOBB      SEEKTYGMDIMWYLWTGPVSPLFGKKQMATFERYFIDDEIAHIEQKTGYYKLRDREEMCD
F16C2_CLOB8      SAEKLYGIDIMWYLWTGACSSLFGKEDMTTFERYFIKDKSTHKEKKNPYYNFRDSEEMCN
F16PC_CLOD6      AEEKLYGMDIMWYLWTGKCSSLFGKDDMTTFERYFIAEKETHKENKNPYFKLRENEMACK
F16PC_BACFR      EEEKRFAMDYIWYLWCGPDAPSFDKDKMATFERYFIADKSLHKETKGYYYALRNKEEICD
F16PC_BACFN      EEEKRFAMDYIWYLWCGPDAPSFDKDKMATFERYFIADKSLHKETKGYYYALRNKEEICD
F16PC_BACTN      EDDKEFAMDYIWYMWCGPEAPLFDKDKMATFERYFLEDKEIQKEKKGYYYTLRNREDICD
F16PC_BACV8      NEDRPFAVDYVWYLWCGKDSPAFDKDKMATFERYFLKEKELHKEVKGHYYSLRNEEKVCD
F16PC_PARD8      QEEVEYAHDYIWYLWGGKDSPLFDKSKMATFERAFIEEAETHKEEKGAYYTLREQEEICD
F16PC_PORGI      SDQRLAAVDYMWYLWCGPDSPLFDKAMMTTFERYFIEDKATHHEEKGYYYVYRQEKAVCE
F16PC_PORG3      SDQRLAAVDYMWYLWCGPDSPLFDKAMMTTFERYFIEDKATHHEEKGYYYVYRQEKAVCE
F16PC_FUSNN      VEVNKKHRDFIWYLWAGRLSPLFGKDVMKTFERYFIDDKTTHKEIKNPYHKLINDEKVCD
F16PC_LISMO      TKEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICK
F16PC_LISMF      TKEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICK
F16PC_LISIN      TKEKKYACDIVWYLWTGAVSSLFGKSEMTTFERYFIAEKETHKEEKNPYYKLRNEETICK
F16PC_LISW6      TKEKKYACDIVWYLWTGAVSSLFGKSEMTTFERYFVADKETHVEEKNPYYNLRNDEKVCK
F16PC_BACSU      EETDDLATDMAWYLWTGEYSSLFGKRAMTTFERYFIKEKETHKEKKNPYYYLREDEATCR
F16PC_BACVZ      EETDDLATDMTWYLWTGEYSSLFGKRAMTTFERYFIKEKETHKEKKNPYYYLREDEAACR
F16PC_OCEIH      EATDDLATDMVWYLWTGEYSSLFGKREMTTFERYFIKDKALHKERKNPYYYLREKEGICR
F16PC_STAAT      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAA3      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAA8      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAE      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAC      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAS      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAW      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAA1      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAM      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAA2      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAA9      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAN      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAB      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAAR      ENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVR
F16PC_STAES      ESTEDISTDLVWYLWTGKYSSLFGKRAMTTFERYFIEDKASHKEEKNPYYYLREDVDMIR
F16PC_STAEQ      ESTEDISTDLVWYLWTGKYSSLFGKRAMTTFERYFIEDKASHKEEKNPYYYLREDVDMIR
F16PC_STAHJ      EITDDLSTDLVWYLWTGKYSSLFGKRAMTTFERYFIEDKASHKEPKNPYYYLREDVDMIR
F16PC_STAS1      DIQDDLATDLVWYLWTGKYSSLFGKRAMTTFERYFIKDKTAHKETKNPYYHLREDVNMCK
F16PC_STAXY      DIQDDLATDLVWYLWTGKYSSLFGKRAMTTFERYFIKDKTAHKETKNPYYYLREDVDMCK
F16PC_LACP3      TENADLATDLMWYLWTGPNSPLFGKHDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIK
F16PC_LACCB      TENADLATDLMWYLWTGPNSPLFGKHDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIK
F16PC_LACSS      LHQANLSTDLLWYLWTGPLSPLFGKNAMTTFERYFCPDPETHVETKNAYYSLRHDADFIQ
F16PC_LACS1      NVKDDFATDFMWYLWQGALSPLFGKKSMTTFERYFIADKACHEEVKNPYYKLRENKDFCI
F16PC_ENTFA      ASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKETHYEEKNPYYSLRDTVEVCE
F16PC_STRGC      EIGDDFSTDLIWYCWRGKLSPLFGKDKMTTLERYFIEDKETHKEVENSYFSYRNSEKICQ
F16PC_STRSV      EVGDDLSTDLIWYCWKGKLSPLFGKEKMTTLERYFIEDKETHKEVENSYFSYRNSEKVCQ
F16PC_PEDPA      TSDEDDDTDLMWYCWIGKKSPLFGRTAMTTFERYFIADSATHKEGDNPYFKLRDRLSTAH
F16PC_LACLM      EESEDLATDLMWYLWVGECSSLFGKTAMTTFERYYIKDKSTHVEKKNPYYQLREQPKIIT
F16PC_LACLA      ENSTDLATDLMWYLWVGECSSLFGKTAMTTFERYYIKDKKTHVEKKNPYYQLREEAEIIR
F16PC_STRA1      EKHDDLATDIIWYLWCGENSSLFGKNAMTTFERYYVSDKVTHQERKNPYFKLRDKDDICT
F16PC_STRA3      EKHDDLATDIIWYLWCGENSSLFGKNAMTTFERYYVSDKVTHQERKNPYFKLRDKDDICT
F16PC_STRA5      EKHDDLATDIIWYLWCGENSSLFGKNAMTTFERYYVSDKVTHQERKNPYFKLRDKDDICT
F16PC_FINM2      DPDRQTALDFFWYMWCGPKSPMFGKSKISTFENFFITDKDVRKEVSNPYFSLSKIEKYAD
F16PC_SACD2      INDRNE-SDIAWFLWCGPHSPLFGKARMTTFERYFVADKQTHKEGKNEYYNLRSNPEFLA
F16PC_SORC5      -GAQED-VDMLWYLWTGPLSPMFGKDRMTTFESYFVADERTHRETKNPYFHLIHDAAFCG
F16PC_DESPS      REQSADDLALFFYLWCGPKSPFFGKHAMKTFERYFLLDKERHAEHSLYWQKNMQSDAFKE
                            :: * *  :. *.:  :  :*  :  :   : *    :           

F16PC_CLOAB      NILREFGLD-SEQAHIINGHVPVESKNGENPIKANGKLIVIDGGFSKAYQSKTGIAGYTL
F16C1_CLOB8      KILKEFGLS-SPESHIINGHMPVEEKNGESPIKANGTLLVIDGGFSKAYQPKTGLAGYTL
F16PC_CLOB1      MIFEEFELD-ADNSHIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_CLOBH      MIFEEFELD-ADNSHIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_CLOBL      MIFEEFELD-ADNSHIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_CLOBK      MIFEEFELD-ADNSHIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_CLOBM      IIFEEFELD-VDNSHIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_CLONN      NILKEFGLD-PDCSHVINGHIPVKTKAGENPIKANGKLLVIDGGFCRAYQPETGIAGYTL
F16PC_CLOTE      RIFEEFQLD-LEKSHIINGHIPVKTKNGESPVMANGKLLVIDGGFCKAYQPQTGIAGYTL
F16PC_ALKMQ      IIFEEFGLN-PDVSHIINGHVPVKLKEGESPIRANGKLLVIDGGFSRTYQGTTGIAGYTL
F16PC_CLOBA      MILREFGLD-PSESRIINGHVPVKKKNGESPIKANGKMIVIDGGFSKAYQKQTGIAGYTL
F16PC_CLOBB      MILREFGLD-PSESRIINGHVPVKKKNGESPIKANGKMIVIDGGFSKAYQKQTGIAGYTL
F16C2_CLOB8      MIFEEFGLD-PAESRIINGHVPVKNKFGENPIKCNGKLIVIDGGFAKAYRSQTGLAGYTL
F16PC_CLOD6      RLFEEFDLE-LDESHIINGHVPVESKNGESPIKANGKILVIDGGFSRAYQKTTGIAGYTL
F16PC_BACFR      RILEEFGVT-GQHTHIINGHVPVKTIKGEQPMKAGGKLLVIDGGFSKAYQPETGIAGYTL
F16PC_BACFN      RILEEFGVT-GQHTHIINGHVPVKTIKGEQPMKAGGKLLVIDGGFSKAYQPETGIAGYTL
F16PC_BACTN      QILDEFGAL-GPHSHIINGHVPVKTIQGEQPMKANGKLFVIDGGFSKAYQPETGIAGYTL
F16PC_BACV8      MLLDEFGVI-GTHRHIINGHVPVKTIQGENPIKANGKMMVIDGGFSKAYHSETGIAGYTL
F16PC_PARD8      KILDEFGVT-GMHRHIINGHVPVRSNQGENPIKANGKMLVIDGGFSRPYHLETGIAGYTL
F16PC_PORGI      MILKEFGLE-GPDTHIINGHVPVKAKKGELPIGAEGKLMLIDGGFSKAYQSSTGIAGYTL
F16PC_PORG3      MILKEFGLE-GPDTHIINGHVPVKAKKGELPIGAEGKLMLIDGGFSKAYQSSTGIAGYTL
F16PC_FUSNN      KIFEEFGLN-PRTSHIINGHIPVKVKEGESPVKANGKLLIIDGGFSRAYQSTTGIAGYTL
F16PC_LISMO      QILEEFELD-GECGHIINGHTPVKEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTL
F16PC_LISMF      QILEEFGLD-GECGHIINGHTPVKEGKGESPIKANGKMLVIDGGFAKAYHKETNLAGYTL
F16PC_LISIN      QILEEFGLD-GECGHIINGHTPVKEGKGESPIKANTKMLVIDGGFAKAYHKETTLAGYTL
F16PC_LISW6      QILEEFGLD-GDCGHIINGHTPVKEGKGESPIKASGKMLVIDGGFAKAYHKKTNLAGYTL
F16PC_BACSU      NILAEFGLN-PDHGHIINGHTPVKEIEGEDPIKANGKMIVIDGGFSKAYQSTTGIAGYTL
F16PC_BACVZ      NILMEFGLN-PDHGHIINGHTPVKEIEGEDPIKANGKMIVIDGGFSKAYQSTTGIAGYTL
F16PC_OCEIH      MILEEFDLD-PDQGHIINGHTPVKEIEGENPIKANGKMIVIDGGFSKAYQPTTGIAGYTL
F16PC_STAAT      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAA3      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAA8      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAE      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAC      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAS      KMLSDFGLN-ADEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAW      KMLSDFGLN-ADEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAA1      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAM      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAA2      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAA9      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAN      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAB      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAAR      KMLSDFGLN-PDEGRIINGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAES      KMLKDFGLN-PDEGRIINGHTPVKEIDGEDPIKANGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAEQ      KMLKDFGLN-PDEGRIINGHTPVKEIDGEDPIKANGKMLVIDGGFSKAYQSTTGIAGYTL
F16PC_STAHJ      KMLKDFGLN-PDEGRIINGHTPVKEIDGEDPIKADGKMLVIDGGFSKAYQKTTGIAGYTL
F16PC_STAS1      KMLKDFGLD-PEQGHIINGHTPVKEIDGEDPIKAEGKMIVIDGGFSKAYQSTTGIAGYTL
F16PC_STAXY      KMLKDFGLD-PEQGHIINGHTPVKEIDGEDPIKADGKMIVIDGGFSKAYQSTTGIAGYTL
F16PC_LACP3      KILAEFVLD-PEVGHVINGHTPVKK--GTDPIMANNKMIVIDGGFSKPYQKTTGIGGYTL
F16PC_LACCB      KILAEFVLD-PEVGHVINGHTPVKK--GTDPIMANNKMIVIDGGFSKPYQKTTGIGGYTL
F16PC_LACSS      QLLSEFNLS-PETGHILNGHTPVKK--GHDPIMANRQMIVIDGGFSKAYHHTTGIGGFTL
F16PC_LACS1      KILQEFGFAGDDTNHIINGHTPVKR--GHNAICAEGYMLVIDGGYSKAYQPTTGIAGYTL
F16PC_ENTFA      RILDEFEVT-GENRHIINGHTPVKRTKGESPIKANGTLLVIDGGFSKSYQTITGIAGYTL
F16PC_STRGC      LILEEFGLF-SQESRMVNGHTPVKTGKGESPIRGGGLLFVIDGGLCEAYQEKTGTAGYSL
F16PC_STRSV      LILEEFGLF-SQESRMVNGHTPVKTGKGESPIRGGGLLFVIDGGLCKAYQKKTGTAGYSL
F16PC_PEDPA      YILRKFGLD-ERNSYIINGHTPVKVSEGESPIKGGGQIIVIDGGLSKAYQKSTGIAGYTL
F16PC_LACLM      KILENFGLD--ENGHLVNGHTPIKEKNGENPIKADGKLIVIDGGFAKAYQKETGIAGYTL
F16PC_LACLA      KILENFGLD--EGGHLVNGHTPIKEKNGENPIKADGKLIVIDGGFAKAYQKETGIAGYTI
F16PC_STRA1      ALLQEFDLP--KFGHIVNGHTPVKEKNGEQPIKANGKMLVIDGGFAKGYQKNTGLAGYTL
F16PC_STRA3      ALLQEFDLP--KFGHIVNGHTPVKEKNGEQPIKANGKMLVIDGGFAKGYQKNTGLAGYTL
F16PC_STRA5      ALLQEFDLP--KFGHIVNGHTPVKEKNGEQPIKANGKMLVIDGGFAKGYQKNTGLAGYTL
F16PC_FINM2      KIFEEFNMN-PETSHIINGHVPVKSINGEKPVSANGKTYVIDGGISEAYQKKTGIAGYTL
F16PC_SACD2      RVATELKCS-SDQVRIVNGHVPVKYQSGERPVQANGKLFSIDGGFSMPYRS---------
F16PC_SORC5      RVCREFGVD-EERGLIVNGHVPVRVERGESPIKASRRAVTIDGAFSEAYGDK----GYTL
F16PC_DESPS      KMQEEFGIQ-----RVIFGHTPVNYMQGNKMASEDGVAINVDGGFAAAYYNR----GHAL
                  :  .:         :: ** *:.   *            :**. .  *           

F16PC_CLOAB      IYNSFGLQLVSHELFETTEKAIKEETDIISSTVIFEKSVRRKRVGDTDIGKDLKKQLYEL
F16C1_CLOB8      IYNSFGLQLVSHQPFESTEAAIKEETDILSTTLLLEQVVNRKRVEDTDVGVTLKQQIDDL
F16PC_CLOB1      IYNSYGLLLTSHEPFSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDL
F16PC_CLOBH      IYNSYGLLLTSHEPFSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDL
F16PC_CLOBL      IYNSYGLLLTSHEPFSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDL
F16PC_CLOBK      IYNSYGLLLTSHEPFSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDL
F16PC_CLOBM      IYNSYGLLLTSHEPFSSIHKAIVEGNDILSSTIILEHVSSRKRVLDTDSGEEIKKQIHDL
F16PC_CLONN      IYNSYGLLLSSHEPFSSIRKAIEEEKDILSSTIILEQVVSRKRVADTDIGKELKKQIAEL
F16PC_CLOTE      IYNSYGFLLSSHEPFESTKKAIEEEQDILSSTVILENSVTRKRVMDTDIGKELKEQIKNL
F16PC_ALKMQ      IYNSYGLLLVSHDPFESTQKAIEEEKDIHSTTMVLEKEVERKRVRDTDDGEKLKFQVKDL
F16PC_CLOBA      IYNSYGLQLVSHEHFSSTEESIMKEKDILSTTLVVEQKLKRKTVEDTDIGKELQVQIKDL
F16PC_CLOBB      IYNSYGLQLVSHEHFSSTEESIMKEKDILSTTLVVEQKLKRKTVEDTDIGKDLQVQIKDL
F16C2_CLOB8      TYNSYGLQLISHQPFKSIEDAFSKETDILSSTQIVE-KLDRKKVGDTDIGKELKNQIKDL
F16PC_CLOD6      IYNSRTLQLVSHEPFNSAEEAIANESDILSTTVVVEHKAKRKMVRDTDEGIKIQEEIEDL
F16PC_BACFR      VYHSHGLQLVQHDPFQSTQKAIEEGQDIKSTTFVIEFNSQRMMVKDTDKGKELVTQILDL
F16PC_BACFN      VYHSHGLQLVQHDPFQSTQKAIEEGQDIKSTTFVIEFNSQRMMVKDTDKGKELVTQILDL
F16PC_BACTN      VYHSHGMQLVQHEPFQSRQKAIEEGLDIKSTNFVLEFNSQRMMVKDTDKGKELVTQIQDL
F16PC_BACV8      VYHSRGFQLVQHEPFTSMQKAIEEGQDIKSSTQIVEMSTQRMMVKDTDKGRELVTQINDL
F16PC_PARD8      VYHSRGFQLVQHEPFESRAKAIEEGLDIKSTTIVVELSSHRQMVKDTDKGADLQSQIKDL
F16PC_PORGI      IFNSQGLHLVQHEPFSSTRKAIEEMEDIKSITVVREVTSHRMLVKDTDNGHLLSKQVENL
F16PC_PORG3      IFNSQGLHLVQHEPFSSTRKAIEEMEDIKSITVVREVTSHRMLVKDTDNGHLLSKQVENL
F16PC_FUSNN      TYNSYGMKLASHLKFISKEAAIKDGTDMISSHIIVETKSKRMKVKDTDIGKSIQTQINDL
F16PC_LISMO      LFNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDL
F16PC_LISMF      LFNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDL
F16PC_LISIN      LYNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGKNLNEQATDL
F16PC_LISW6      LFNSYGLQLVSHQPFTSKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGKKLNEQAEDL
F16PC_BACSU      LYNSYGMQLVAHKHFNSKAEVLSTGTDVLTVKRLVDKELERKKVKETNVGEELLQEVAIL
F16PC_BACVZ      LYNSYGMQLVAHKHFNSKAEVLSTGTDVLTVKRLVDKELERKKVKETNVGEELMKEVAIL
F16PC_OCEIH      LYNSFGMQLVAHQHFNSKEDVLQNGNDVLSVKRLVDEELERKKISETNIGEKLIEDINML
F16PC_STAAT      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAA3      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAA8      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAAE      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAAC      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAAS      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAAW      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDIL
F16PC_STAA1      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDIL
F16PC_STAAM      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDIL
F16PC_STAA2      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDIL
F16PC_STAA9      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDIL
F16PC_STAAN      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDIL
F16PC_STAAB      LYNSFGMQLVAHQQFNAKEKILSEGIEELSIKRIVDKELQRKKIRNTNKGKELQAQIDIL
F16PC_STAAR      LYNSFGMQLVAHQQFNAKEKILSEGIDELSIKRIVDKELQRKKIRNTNKGKELQAQIDIL
F16PC_STAES      LYNSFGMQLVAHKEFNRKEKVLSMGADELSVKRVVDEELQRKKIRDTNIGKQLQDQIDIL
F16PC_STAEQ      LYNSFGMQLVAHKEFNRKEKVLSMGADELSVKRVVDEELQRKKIRDTNIGKQLQDQIDIL
F16PC_STAHJ      LYNSFGMQLVAHQHFDSRDKVLSDGADELSVRRVVDEELQRKKIRDTNDGKVLQEQIRIL
F16PC_STAS1      LYNSFGMQLVAHQHFNSKKHVLLNGADELSIRRVVDKELQRQKIRHTNTGQDIQEKIDIL
F16PC_STAXY      LYNSFGMQLVAHQHFNSKKHVLLNGADELSIRRVVDKELQRKKIRDTNTGHEIQAQIDIL
F16PC_LACP3      LDNSYGMQLVTHQPFTTKADAITNLTDIISTRRVVETEARRRTVAETDIGTELQDEVEVL
F16PC_LACCB      LDNSYGMQLVTHQPFTTKADAIANLTDIISTRRVVETEARRRTVAETDIGTELQDEVEVL
F16PC_LACSS      LYNSYGMQLVTHQPFTTKADAIANMKDIISTRRVIDQVSQRQRVSQTNIGAAIKTEIEQL
F16PC_LACS1      LYNSYGLQLVSHQPFTSKQDAIRSGKDIVSTVRVVKHELQRKSVADTDIGENIKEKIRVL
F16PC_ENTFA      LYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRLLVKDTTIGKELLKQSQAL
F16PC_STRGC      LNNSYGFQLVTHQPFQNAQKVVEAPFAQTSLKKVIENVEQRTLIKSTSIGQILMAQQQEL
F16PC_STRSV      LNNSYGFQLVTHQPFQNAQKVVESPFAQTSLKKVIENVEERTLIKSTTIGQSLLAQQQEL
F16PC_PEDPA      INNSYGFQIVTHMPFQGIDDLYESQTQSTSLKRIIDRDLPRRNIADTTIGTELKRQVDDL
F16PC_LACLM      LYNSFGIQLVAHQPFSTVKAAVEKGTDIISLKRLVAEVDERKRVKDTNVGQTLLSEIADL
F16PC_LACLA      LYNSFGIQLVAHQPFSTVKEAVEKGTDIISLKCLVAEVDQRKRVKDTNVGQTLLSEIADL
F16PC_STRA1      IYNSYGIQLISHLPFTSIEEVLSGTNYIIDTKRLVEEAKDRILVKDTTIGQKLTKEIKDL
F16PC_STRA3      IYNSYGIQLISHLPFTSIEEVLSGTNYIIDTKRLVEEAKDRILVKDTTIGQKLTKEIKDL
F16PC_STRA5      IYNSYGIQLISHLPFTSIEEVLSGTNYIIDTKRLVEEAKDRILVKDTTIGQKLTKEIKDL
F16PC_FINM2      TFNSHHLAIAKHKNFQVMESVHGAYT---PEVTITEEFPKRMLIKDTDEGEEILELIEDL
F16PC_SACD2      -------------------ATGLAGFVLLEALGQIVLY----RVIPNDKRYALEVEYQQI
F16PC_SORC5      VLEASGARLAQHHHFTSVEQAVEAGEDIIPVISDVEVYEAERRVGDTEKGEEIEREIELL
F16PC_DESPS      VHTPHQLYGIILPTPDELIKAAVRLEPAPLDIEFIDEFPQPLKIKNTIAGKLLQQERDLI
                                                            :  .     :      :

F16PC_CLOAB      NLLLLAYKKGLIKEFVKS----
F16C1_CLOB8      KMLLNAYRKGLIKQQNKI----
F16PC_CLOB1      EMLLVAYRKGLIKEENEANIRF
F16PC_CLOBH      EMLLVAYRKGLIKEENEANIRF
F16PC_CLOBL      EMLLVAYRKGLIKEENEANIRF
F16PC_CLOBK      EMLLVAYRKGLIKEENEANIRF
F16PC_CLOBM      EMLLVAYRKGLIKEENEANIRF
F16PC_CLONN      KMLLIAYRKGLIKEQDSKS---
F16PC_CLOTE      KKLLVAYRKGLIQENI------
F16PC_ALKMQ      EMLLDAYRSGLIKEQR------
F16PC_CLOBA      KELLLIYRKGIIKEIR------
F16PC_CLOBB      KELLLIYRKGIIKEIR------
F16C2_CLOB8      KLLLKAYRKGLINEVR------
F16PC_CLOD6      KLLLMAYKKGLIKEM-------
F16PC_BACFR      KKLLVAYRIGLIKEKV------
F16PC_BACFN      KKLLVAYRIGLIKEKV------
F16PC_BACTN      KKLLVAYRIGLIKEKV------
F16PC_BACV8      KKLLMAYRTGLIKEKSI-----
F16PC_PARD8      EKLLYAYRNGLIKEKERMER--
F16PC_PORGI      KKLLQAYSYGLIKERKK-----
F16PC_PORG3      KKLLQAYSYGLIKERKK-----
F16PC_FUSNN      KKLLKAYRIGLIKSN-------
F16PC_LISMO      KLLLDAYRNGLLHENR------
F16PC_LISMF      KLLLDAYRNGLLHENR------
F16PC_LISIN      KMLLEAYRNGSLHENS------
F16PC_LISW6      KKLLSAYRNGLLHEGR------
F16PC_BACSU      ESLREYRYMK------------
F16PC_BACVZ      EKLREYRYMK------------
F16PC_OCEIH      NSLLKYRYLK------------
F16PC_STAAT      KMLMHDRYLD------------
F16PC_STAA3      KMLMHDRYLD------------
F16PC_STAA8      KMLMHDRYLD------------
F16PC_STAAE      KMLMHDRYLD------------
F16PC_STAAC      KMLMHDRYLD------------
F16PC_STAAS      KMLMHDRYLD------------
F16PC_STAAW      KMLMHDRYLD------------
F16PC_STAA1      KMLMHDRYLD------------
F16PC_STAAM      KMLMHDRYLD------------
F16PC_STAA2      KMLMHDRYLD------------
F16PC_STAA9      KMLMHDRYLD------------
F16PC_STAAN      KMLMHDRYLD------------
F16PC_STAAB      KMLMHDRYLD------------
F16PC_STAAR      KMLMHDRYLD------------
F16PC_STAES      KILMHDRYLT------------
F16PC_STAEQ      KILMHDRYLT------------
F16PC_STAHJ      KLLMHDRYLN------------
F16PC_STAS1      KELMHDRYVN------------
F16PC_STAXY      KELMHDRFVN------------
F16PC_LACP3      KRRLGELREED-----------
F16PC_LACCB      KRRLGELREEE-----------
F16PC_LACSS      QTLLTIQPDH------------
F16PC_LACS1      YNLLRNYD--------------
F16PC_ENTFA      QKQMKQNQ--------------
F16PC_STRGC      FALLHEFYDF------------
F16PC_STRSV      FGLLHEFYDR------------
F16PC_PEDPA      KYLLETDEISH-----------
F16PC_LACLM      EVLFEHYEDY------------
F16PC_LACLA      EVLFEHYEEF------------
F16PC_STRA1      DHLYRHFQEYDD----------
F16PC_STRA3      DHLYRHFQEYDD----------
F16PC_STRA5      DHLYRHFQEYDD----------
F16PC_FINM2      ESLIDAYRSGTIQQNSN-----
F16PC_SACD2      LKPKAASVPAA-----------
F16PC_SORC5      ERLIEAYRDGALLEQPR-----
F16PC_DESPS      MGKIQSYNSQNRDSDIN-----