CLUSTAL format seed alignment for MF_01855

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F16A2_CUPNH      ------------------MPEVQRMTLTQFLIEERRR------------YPDASGGFNGL
F16A3_CUPNH      ------------------MPEVQRMTLTQFLIEERRR------------YPDASGGFNGL
F16A2_CUPTR      ------------------MPEVQRMTLTQFLIEQRRR------------YPDASGGFNGL
F16A2_CUPMC      ------------------MPLSHRQTLTRYLIEERRR------------FPEASGELNAL
F16A2_LEPCP      ------------------MPLSNRSTLTQYLIEERRR------------FPGASGELNAL
F16A2_POLNA      ------------------MPLNKRFTLTQYLIQERRR------------FPDARGDFNAL
F16A1_RHOFT      ------------------MPLTYRSTLTQFLIEERRR------------FPNASGDFNAL
F16PA_HYDTE      ------------------MSWAHTPTLTQYLIEERRR------------YPQASGDFNAL
F16A3_METPP      ------------------MPTGGKSTLTQFLIEERRK------------HPAATGELNAL
F16PA_RHORT      ------------------MLATDRTTLAQFLVEECRG------------RAGDDSELLGL
F16A2_DECAR      -------------------MQFGRTTLSKFVIENT---------------RASHGELGAL
F16A2_PARXL      -------------------MQDGRTTLSKFLIDTLDRQPCS-------TETARNAGLSAL
F16PA_METI4      -------------------MSYHRMTLSKFLLEQRKK-------------GVIDPDLGSL
F16PA_MAGSA      -------------------MPYKRITLTHFLLQEQRR-------------LGGSGSFTAL
F16PA_METFK      -----------------------MLKLSEFLVQQERQ-------------HAVADNVLTL
F16A1_METPP      ---------------------MDPIELEQWL-------------------SAHPPALADV
F16PA_NITEC      --------------------MHTGTTLTQFIIEDQRH------------IAGASGDFTAL
F16PA_NITEU      --------------------MHTGTTLTQFIIEEQRH------------IAGASGDFTAL
F16PA_THIDA      --------------------MHTGTTLTQFIIEEQRR------------TAGATGDFTSL
F16PA_NITOC      --------------------MHSNPFLTQFILEEQRS------------IPSATGDFTGL
F16PA_ACIF5      --------------------MHIGTTLSQFIIEETRL------------YPGASGDFAGL
F16PA_HALHL      --------------------MHIGTTLTNYIIETQRN------------LPEATGEFTGL
F16PA_DELAS      --------------------MKKNVSLTRYLVEQQRV------------DGLIPGQLRLL
F16PA_ACISJ      --------------------MTERISLTRYLVEQQRV------------HGRIPPQLRLL
F16PA_POLSJ      --------------------MSQRISLTRYLVEQQRR------------EGHIPAQLRLL
F16PA_ACIAC      --------------------MAQRISLTRYLVEQQRV------------DGLIPSQLRLL
F16A1_POLNA      --------------------MSPKISLTRYLVEQQRI------------DGHIPPELRLL
F16PA_VEREI      --------------------MATSISLTRYLVEQQRA------------GGLIPAQLRLL
F16A2_RHOFT      --------------------MNKRISLTRYLVEQQRM------------EGHIPAQLRLL
F16A1_LEPCP      --------------------MSKRISLTQFLVEQQRQ------------HGRIPAQLRLL
F16A2_METPP      --------------------MTRRISLTQYLVEEQRE------------RGRIPAQLRLL
F16A1_CUPTR      ---------------------MTRISLTRYLVEEQRK------------HNTIQPELRLL
F16A1_CUPNH      ---------------------MTRISLTRYLVEEQRK------------HNTIQPELRLL
F16PA_CUPPJ      ---------------------MTRISLTRYLVEEQRK------------HNTIQPELRLL
F16A1_CUPMC      ---------------------MTRISLTRYLVEEQRK------------HNTIEPELRLL
F16PA_RALSO      ---------------------MKRINLTRYLIEEQRE------------HNTIPAELRLL
F16PA_RALPJ      ---------------------MKRINLTRYLIEEQRE------------HNTIPAELRLL
F16PA_BORBR      ---------------------MKRKTLTQYLVEQQRS------------AQALGPEVRLL
F16PA_BORPA      ---------------------MKRKTLTQYLVEQQRS------------AQALGPEVRLL
F16PA_BORPE      ---------------------MKRKTLTQYLVEQQRS------------AQALGPEVRLL
F16PA_BORPD      ---------------------MKRKTLTQYLVEQQRS------------ANALGPEVRLL
F16PA_BORA1      ---------------------MKRKTLTQYLVEQQRS------------AQALAPEVRLL
F16PA_JANMA      ---------------------MKRISLTQYLIEEQRL------------HNNIPAELRLL
F16PA_HERAR      ---------------------MKRISLTQYLIEEQRL------------HNNIPAELRLL
F16PA_HERSE      ---------------------MKRISLTQHLIEQQRL------------HNKIPSELRLL
F16PA_PARL1      ---------------------MSQRTLTQFLIEQQRK------------EAALPAQLRLL
F16A1_PARXL      ------------------MALQRRTTLTKYLIEQQRE------------TNNLPADLRLL
F16PA_PARPJ      ------------------MALQRRTTLTKYLIEQQRE------------TNNLPADLRLL
F16A1_PARP8      ------------------MSLQRRTTLTKYLIEQQRE------------NNNLPADLRLL
F16PA_BURCA      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURCH      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURCC      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURCJ      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURL3      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURM1      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURA4      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURCM      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURVG      ------------------MSIARRTTLSKFLIEQQRE------------TNNLPADLRLL
F16PA_BURM9      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURMS      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURPS      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURMA      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURP1      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURP0      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURP6      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURM7      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_BURTA      ------------------MSITRRTTLSKYLIEQQRE------------THNLPADLRLL
F16PA_PSEP1      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEE4      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEPK      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEPG      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEPW      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSESM      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEU2      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSE14      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEPF      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEF5      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_PSEA7      ---------------------MSRVTLSRYLIEQTR-------------SHNTPADLRFL
F16PA_PSEAE      ---------------------MSRVTLSRYLIEQTR-------------SHNTPADLRFL
F16PA_PSEAB      ---------------------MSRVTLSRYLIEQTR-------------SHNTPADLRFL
F16PA_PSEMY      ---------------------MSRVTLSRYLIEQTR-------------SHNTPADLRFL
F16PA_PSEU5      ---------------------MSRVTLSRYLIEQTR-------------SNNTPADLRFL
F16PA_CHRVO      ---------------------MSRITLSRFLIEQQRK------------AGTLPPELRLL
F16PA_AROAE      ---------------------MRRVTLTQFLIEQQR-------------AGRTSPDLRLL
F16PA_AZOSB      ---------------------MRRVTLTQFLIEQQR-------------AGRVSADLRLL
F16A1_DECAR      --------------------MTQQRTLARYLTEEQRN------------KGVITGDLKLL
F16PA_XANAC      ---------------------MSRPSLTRFLIEEQH-------------AGRIDAELRQL
F16PA_XANC5      ---------------------MSRPSLTRFLIEEQH-------------AGRIDAELRQL
F16PA_XANOM      ---------------------MSRPSLTRFLIEEQH-------------AGRIDAELRQL
F16PA_XANOP      ---------------------MSRPSLTRFLIEEQH-------------AGRIDAELRQL
F16PA_XANOR      ---------------------MSRPSLTRFLIEEQH-------------AGRIDAELRQL
F16PA_XANCP      ---------------------MSRPSLTRFLIEEQH-------------AGRIDPELRQL
F16PA_XANC8      ---------------------MSRPSLTRFLIEEQH-------------AGRIDPELRQL
F16PA_XANCB      ---------------------MSRPSLTRFLIEEQH-------------AGRIDPELRQL
F16PA_STRM5      ---------------------MSRTSLTRFLIQEQH-------------AGRINADLRQL
F16PA_STRMK      ---------------------MSRTSLTRFLIQEQH-------------AGRINADLRQL
F16PA_SHEB8      -----------------------MQTLAQHLTSQ--------------AVND---SLSHL
F16PA_SHEB5      -----------------------MQTLTQHLTSQ--------------AVND---SLSHL
F16PA_SHEB9      -----------------------MQTLTQHLTSQ--------------AVND---SLSHL
F16PA_SHESR      -----------------------MQTLAQHLTSK--------------AVNE---SLSQL
F16PA_SHESM      -----------------------MQTLAQHLTSK--------------AVNE---SLSQL
F16PA_SHESA      -----------------------MQTLAQHLTSK--------------AVNE---SLSQL
F16PA_SHEPC      -----------------------MQTLAQHLTSQ--------------AVND---SLSQL
F16PA_SHESW      -----------------------MQTLAQHLTSQ--------------AVND---SLSQL
F16PA_SHEON      -----------------------MQTLAQHLTSK--------------AVNE---SLAQL
F16PA_SHEHH      -----------------------MQTLAENLTSQ--------------AISP---TLEKL
F16PA_SHEPA      -----------------------MQTLAENLTSQ--------------AISP---TLEKL
F16PA_SHESH      -----------------------MQTLAQNLTSQ--------------GVNA---SLTQL
F16PA_SHEWM      -----------------------MQTLAQNLTSQ--------------GVDA---SLTQL
F16PA_SHELP      -----------------------MQTLAQHLSSQ--------------GIQA---PLAQL
F16PA_SHEDO      -----------------------MQTLAQTLASS--------------KIND---SLAQL
F16PA_SHEFN      -----------------------MQTLAQTLSVQ--------------AVNA---SLTQL
F16PA_SHEAM      -----------------------MQTLSQSLKQS--------------AISE---ELASL
F16PA_MARMS      -----------------------MQNLPDVLASS--------------ATPK---TLQDV
F16PA_ALTMD      -----------------------MKRLNSQLQQD--------------GAPL---ELILL
F16PA_PSEA6      -----------------------MKRLNSQLQED--------------GAPM---ELILL
F16A1_PSET1      -----------------------MRRLPPVLLED--------------GCPR---ELISL
F16PA_COLP3      -----------------------MQRLAPALRQD--------------NVPL---DLISL
F16PA_IDILO      -----------------------MKRLLPTLRAD--------------QTSE---SLISV
F16PA_CELJU      -----------------------MQRLVPTLRRD--------------GVNP---ELIPV
F16A2_PSET1      -----------------------MKRLNTVLKED--------------GVQT---DLILL
F16PA_SACD2      -----------------------MQNLQGMLRDQ--------------RVAQ---DLQEV
F16PA_HYDCU      -----------------------MKRLDQVLAAD--------------GVNA---ELELV
F16PA_ACIBC      ---------------------MSNLTLSQFLQQE--------------KGNL-TPELAQV
F16PA_ACIBS      ---------------------MSNLTLSQFLQQE--------------KGNL-TPELAQV
F16PA_ACIBT      ---------------------MSNLTLSQFLQQE--------------KGNL-TPELAQV
F16PA_ACIBY      ---------------------MSNLTLSQFLQQE--------------KGNL-TPELAQV
F16PA_ACIAD      ---------------------MSNLTLAQYLQQK--------------NGNL-TPELAQV
F16PA_PSYA2      -----------------------MTTLAQYLNTN--------------AASP---ALNDV
F16PA_PSYCK      -----------------------MTTLAQYLNTK--------------ATTP---ALNDV
F16PA_PSYWF      -----------------------MTSLTQYFEQH--------------PKLPQTQAVIDV
F16PA_NEIM0      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_NEIMB      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_NEIMF      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_NEIMA      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_NEIG1      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_NEIG2      -----------------------MDTLTRFLPEHLQ------------QN-QLPEALGGV
F16PA_POLAQ      ------------------MSSSTHTNFKQYLAAVKP------------QGEAAPAGLQEL
F16PA_POLNS      -----------MKTGEIPLSSSTYINFKQYLASVKP------------AGAALPTGLQDL
F16PA_CAUVC      -------------MGRSAFGSRTRMTAFVDLAARLA------------AE-PADAALKDV
F16PA_CAUSK      ------------------------MTTLTDLAGWLA------------ME-PAGDDVKAV
F16PA_ALKEH      -------------------MDQSRMTLGRFLAQQCPQ-------------DEKGKALALL
F16PA_NITVU      --------------------MSQELTLQQRMD-------------GEAGSDPLRQAVKEA
F16PA_NITWN      --------------------MSQEMTLQERMD-------------GEGGSDPLRQAVKGA
F16A2_NITHX      --------------------MSHELTLQQRLE-------------VQAGPDPLHRAVKEA
F16A1_NITHX      --------------------MSRELTLQERLD-------------GEAGPDPLRQAVKKA
F16PA_BRADU      --------------------MTGQLRLDDHLQ-------------RYSETAPHALAVATA
F16PA_RHOPB      --------------------MHQGLTLSRHTN-------------EYAGTDKLRLAVAAA
F16PA_RHOP5      --------------------MEHALTLSQHTR-------------EYAGTDPLRLAVAAA
F16PA_RHOPA      --------------------MDQGQTLSVLLD-------------SYA-VDPQKKAVAAA
F16PA_RHOPT      --------------------MDQGQTLSVLLD-------------SYA-VDPQKKAVAAA
F16PA_RHOP2      --------------------MDQGQTLSRLLD-------------SYG-TDARTRAVAAA
F16PA_RHOPS      --------------------MDQGQTLARLLD-------------SYA-TDPRKRAVAAA
F16PA_BRASO      --------------------MAREWPMTHPSNHPMD--HHHQTLQAHLASQGADADCAAV
F16A2_BRASB      --------------------MAREWPMEQSP-----------TLQAHLALQNADADCAAV
F16PA_RHIME      ---------------MSGATLEAYLASCTARG------------------DDLSRDVAAV
F16PA_SINMW      ---------------MSGATLEAYLASCTTHG------------------DELSRDVAAV
F16PA_XANFL      ---------------MLEPNADHRAAVAQAAGVAASRITLTVMLDEWAGADARRRAVADT
F16A1_XANP2      --------MTTRRTGRAEKTLRETTAMPTADHRAAPGITLACALEEWAGEDARRRDVAAT
F16A2_CERSP      -------------------------MAIELED------------------LGLSPDVADV
F16A2_CERS4      -------------------------MAIELED------------------LGLSPDVADV
F16A2_RHOS1      -------------------------MAIELED------------------LGLSPDVADV
F16A2_CERS5      -------------------------MTIELED------------------LGLTPELADV
F16PA_RHOCB      -------------------------MAIELEG------------------LGLSPELADV
F16A1_RHOS1      ------------------------MKPFPTHP------------------DAIPAELQDV
F16A1_CERS4      ------------------------MKPFPTHP------------------DAIPAELQDV
F16A1_CERSP      ------------------------MKPFPTHP------------------DAIPAELQDV
F16A1_CERS5      ------------------------MKPFATHP------------------DAIPADLQDV
F16PA_PARDP      ------------------------MTAETIQT------------------DRIPPHLRPA
F16A1_BRASB      -----------------MTAPEGTLESFLEGD------------------CSVSEPLAIT
F16PA_METEP      ------------------MTKPYGSSLDDHLD-------------AEVAREPSLADTAAT
F16PA_METPB      ------------------MTKPNGSSLDDHLD-------------AEVARDASLADTAAT
F16PA_METRJ      ----------------MAISAAIGTPLETCLA-------------QAVDANPALKDAAAV
F16PA_AZOC5      --------------------MSE-VTLQAFLD-------------DWAGADPLRCAVAAT
F16A2_XANP2      --------------------MSELVTLKTYLG-------------TWAGADTGRTAVAQA
F16PA_ACICJ      --------------------MSDALRLDTCLD-------------QIASQLPALTASCRV
F16PA_BRUC2      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUSU      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUAB      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUO2      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUA2      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUA1      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUSI      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUME      ---MTLVGNFSPLVLVGDSDRVEAETVGAYLD-------------GWAGHDKVRLATANA
F16PA_BRUA4      ---MTMAGNFSPLVLVGDSDRVEAEAVGAYLD-------------NWAGKDGLRLATADA
F16A3_PSET1      -----------------------MKNLYTQLEQ-----------------DNVPKTLTLL
F16PA_ECOLI      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHIFL      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHIBS      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOK1      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOUT      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOL5      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHIF8      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHIB3      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECODH      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOSM      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOLC      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOL6      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECO24      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECOHS      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHIDS      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECO57      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ECO5E      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SHISS      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_CITK8      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_SALTY      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALPA      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALCH      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALEP      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALDC      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALA4      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALPK      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALSV      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALHS      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALNS      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALPB      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALTI      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALG2      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_SALAR      -----------------------MKTLGEFIVEKQHE------------FSQATGELTAL
F16PA_ENT38      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_KLEP3      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_KLEP7      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_CROS8      -----------------------MKTLGEFIVEKQHE------------FSHATGELTAL
F16PA_ERWT9      -----------------------MKTLGEFIVEKQHD------------FPHATGELTAL
F16PA_SODGM      -----------------------MKTLGEFIVEKQHD------------FPHATGELTAL
F16PA_YERPN      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPA      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPE      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPS      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPB      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPY      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPG      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERP3      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERPP      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_YERE8      -----------------------MKTLGEFIVEKQLD------------FSHATGELTAL
F16PA_SERP5      -----------------------MKTLGEFIVEKQHD------------FSHATGELTAL
F16PA_PHOLL      -----------------------MKTLGEFIVEKQQD------------FSHATGELTAL
F16PA_PROMH      -----------------------MKTLGEFIVEKQQD------------FPHATGELTAL
F16PA_PECAS      -----------------------MKTLGEFIVEKQHD------------FSHATGELTAL
F16PA_VIBCH      --------------------MQKMRTLGEFIVEKQHD------------FPHASGELSSL
F16PA_VIBC3      --------------------MQKMRTLGEFIVEKQHD------------FPHASGELSSL
F16PA_VIBVU      --------------------MSGMRTLGEFIVEKQAD------------FPHASGDLSSL
F16PA_VIBVY      --------------------MSGMRTLGEFIVEKQAD------------FPHASGDLSSL
F16PA_VIBPA      --------------------MSGMRTLGEFIVEKQAD------------FPHASGDLSSL
F16PA_VIBCB      --------------------MSGLRTLGEFIVEKQAD------------FPHASGDLSSL
F16PA_ALIFM      --------------------MSEIRTLGEFIVAKQHD------------FPHASGELSSL
F16PA_ALIF1      --------------------MSEIRTLGEFIVAKQHD------------FPHASGELSSL
F16PA_ALISL      --------------------MSEIRTLGEFIVAKQHD------------FPHASGELSSL
F16PA_PHOPR      --------------------MPNMKTLGEFIVEKQND------------FPHASGDLSSL
F16PA_AERS4      --------------------MRNMITMGEFIVKKQAD------------YPTATGELTSL
F16PA_AERHH      --------------------MRNMITMGEFIVKKQAD------------YPTATGELTSL
F16PA_HAHCH      --------------------MEIIKTLGEFIIDRQKD------------YPDASGELTSL
F16PA_PSYIN      -----------------------MITLGEYIIKKQHE------------SPEATGELSSI
F16PA_HAEIE      -----------------------MKTLSEFIVERQAE------------YPNAKGELSGI
F16PA_HAEI8      -----------------------MKTLSEFIVERQAE------------YPNAKGELSGI
F16PA_HAEIN      -----------------------MKTLSEFIVERQAE------------YPNAKGELSGI
F16PA_HAES1      -----------------------MKTLGQFIVEKQAE------------YPNAKGELSGI
F16PA_HISS2      -----------------------MKTLGQFIVEKQAE------------YPNAKGELSGI
F16PA_PASMU      -----------------------MKTLGQFIVEKQAE------------YPNAKGELSGI
F16PA_MANSM      -----------------------MKTLDEFIVDRQAE------------YPNAKGALTGI
F16PA_ACTSZ      -----------------------MKTLDEFIVEKQAE------------YPNAKGALTGI
F16PA_ACTP7      -----------------------MKTLGEFIIEKQAE------------YPEAKGELSGI
F16PA_ACTPJ      -----------------------MKTLGEFIIEKQAE------------YPEAKGELSGI
F16PA_ACTP2      -----------------------MKTLGEFIIEKQAE------------YPEAKGELSGI
F16PA_HAEDU      -----------------------MKTLGEFIIEKQAE------------YPEAKGELSGI
F16PA_DICNV      -----------------------MKSLGEFIIEKQAE------------YPQAKGSLSGI
F16PA_FLAJ1      -------------------MEERNKTLGEFIIENQKA------------FQYSSGELSRI
F16PA_FLAPJ      -------------------MEERNKTLGEFIIENQQS------------FQYSSGELSRI
F16A2_GRAFK      -------------------MSKPNQTLGEFIIENQSD------------FPGSSGELSRL
F16A1_GRAFK      --------------------MERHTTLGEFIIENQKD------------FPYAKGELSAL
F16PA_WIGBR      -----------------------MISLREFIFSNNVN------------KYISKEDLYSL
F16PA_CYTH3      ----------------MERNLSTVKTLVQFITESQKH------------VFGASGDLSKI
F16PA_CHLPM      --------------------MSKLITIERHILEQQKN------------FPEATGELTDL
F16PA_CHLL3      --------------------MSQLITIERHILEQQKN------------FPEATGELTDL
F16PA_CHLPD      ---------------------MNLITIERHILEQQKF------------FPEFTGELTDL
F16PA_PELPB      --------------------MSNLITIERHILEQQKF------------FPDAQGELTDL
F16PA_CHLL2      ---------------------MNLVTIERHILEQQKF------------FPEASGELTDL
F16PA_CHLCH      --------------------MSNLITIERHILEQQKF------------FPEAHGELTDL
F16PA_PROA2      --------------------MNKLITIERHFLEQQKS------------HPEATGELTDL
F16PA_CHLPB      --------------------MNKLITIERHFVEEQKL------------NPDATGELTDL
F16PA_CHLTE      --------------------MNKLTTIESHFLQLQKR------------YPEINSEVTDL
F16PA_CHLP8      --------------------MNKLTTIESHFLQQQKL------------YPEINSEVTGL
F16PA_CHLT3      --------------------MGDLITIERHVLESQKD------------HPGATGEFTKL
F16A2_SALRD      --MTGSHRTSHAGDGAPEDDLGTFQTLEQFILDRQDS------------FPHSTGAFSRL
F16A1_SALRD      ----MSHALSDGP--APSGALESVMTLEQFILDRRGR------------FPQSTGAFSRL
F16PA_NOSS1      MAKASESLDLSVNESTDKALDRDCTTLSRHVLQQLQS------------FSADAQDLSAL
F16PA_TRIV2      MAKASESLDLSVNESTDKALDRDCTTLSRHVLQQLQS------------FSADAQDLSAL
F16PA_NOSP7      MAKTPESLESSINEITDRALDRDCTTLSRHVLQQLQS------------FSPDAQDLSAL
F16PA_MICAN      ------MVSNIPFSIPEHSLDRDCTTLSRHVLQQLQS------------FSSDAQDLSAI
F16PA_CROS5      --MTFIMTSLQTPAVPEHSLDRDCTTLSRHVLQQLQS------------FSPEAQDLSAI
F16PA_SYNY3      -------MTVSEIHIPNSLLDRDCTTLSRHVLQQLNS------------FGADAQDLSAI
F16PA_SYNP2      ------MPDHNNDITQSPSLDRDCTTLSRHVLQQLQS------------FDTAAQDISAI
F16A1_ACAM1      ---MNSSDSTSLELSYDFALDRDCTTLSRHVLEHLQS------------FSPEAQDMSAL
F16PA_TRIEI      MVNTQAREDLHIRLEETQLLDRDCTTLSRHVLQQLH-------------FSPDAQDISSL
F16PA_THEEB      ---------MTDYAAHQQALDRDCLTLSRHVLQQLQS------------FDAAAQDLSAL
F16PA_SYNE7      ------MAQSTTSETHTRDLDRDCTTLSRHVLEQLQS------------FSPEAQDLAAL
F16PA_SYNP6      ------MAQSTTSETHTRDLDRDCTTLSRHVLEQLQS------------FSPEAQDLAAL
F16PA_SYNJA      -------------------MARDVLTLSRHVLQQFSG------------FTPEAQDFSAL
F16PA_SYNJB      -------------------MLRDVLTLSRHVLQQFGS------------FTAEAQDFSAL
F16PA_GLOVI      ------------MDTTPLTPLTKGITLYQHILSQQAL------------NPDATGEFSGL
F16PA_DESVH      ---------------------MPEVTVTEHLLLHQKK------------SPAATGQFTTL
F16PA_DESVV      ---------------------MPEVTVTEHLLLHQKK------------SPAATGQFTTL
F16PA_DESAG      ---------------------MRQVTVTEHLLLHQTK------------SPAATGQFTAL
F16PA_LAWIP      --------------------MSSEVTVTEHLLLQQQR------------APQATGHFTSL
F16PA_LEPIN      --------------MSVHPTQT--LSLSQYLIEEQLK------------LPQATGDFTAL
F16PA_LEPIC      --------------MSVHPTQT--LSLSQYLIEEQLK------------LPQATGDFTAL
F16PA_LEPBL      --------------MSVHPTQT--LSLSQYLIEEQLK------------LPQATGDFTAL
F16PA_LEPBJ      --------------MSVHPTQT--LSLSQYLIEEQLK------------LPQATGDFTAL
F16PA_LEPBP      --------------MNATPKQKKLISLSQFILEEQLK------------IPHASGEFSAL
F16PA_LEPBA      --------------MNATPKQKKLISLSQFILEEQLK------------IPHASGEFSAL
F16PA_SORC5      -----MSDQRDLSWKPPDAPSRIGITLETYILEGMLG------------FPAATGAFTSL
F16PA_SULSY      -------------------MAKIGMDLNSFILEQERL------------YPNATGSLSRA
F16A2_ACAM1      --------------------MSHPTTFNSHLW-QQHR------------LAQQPIEISIL
F16PA_AMOA5      ------------MPESQDIISQSIPSLTQFLGEEQAR------------FPNIPTAIPII
F16PA_SYNAS      ------------------MPIEFEQTFRNFLMEHQEK-------------YNRTYHFLIL
F16PA_GEOBB      -----------------MSNAPGTSKFQIDLRRHLRA-------------QNICDNLVHL
F16PA_GEOUR      -----------------MFSEPGKSKFQIDLRRHLRS-------------QNICDNLIHL
F16PA_GEOMG      ----------------MPFSEPGKTKFQVDLRRHLRN-------------QGICDNLVHL
F16PA_GEOSL      ----------------MPFSEPGKTKFQVDLRRHLRN-------------QDISDNLVHL
F16PA_PELPD      -----------------MFGEAGKTKFQIDLRQHLRD-------------QNISDNLVHL
F16PA_GEOLS      -----------------MGKEPGSTKFQTDFRRHLRE-------------QNISGNLVHL
F16PA_PELCD      --------------MEASVGQAGKTKFQIDLRRYLRE-------------DGEDEGLIHL
F16PA_METLZ      -MRGSVFGFVPSFRIRFFASSTHIIDTMKTLQEYLSA-------------SHAPEDLGKI
F16PA_METHJ      --------------MKYADISLRLY--MVFLRKYLES-------------CGCEPDLIAL
F16PA_METB6      ----------------------------MILREFLDK-------------EGTEKNLAEL
F16PA_HELPY      -------------------------------------------MDYKCFKGKHANIVIEI
F16PA_HELPS      -------------------------------------------MDYKHFKGKHANIVIEI
F16PA_HELPG      -------------------------------------------MDYKHFKGKHANIVIEI
F16PA_HELPH      -------------------------------------------MDYKHFKGKHANIVIEI
F16PA_HELPJ      -------------------------------------------MDYKRFKGKHANIVIEI
F16PA_HELAH      -------------------------------------------MDYKHFKGVHANIVIEV
F16PA_CAMC5      -----------------------------------------MRVDTRKCKGRMMQDLNEI
F16PA_CAMC1      -----------------------------------------------------MQELNQI
F16PA_CAMHC      --------------------------------------------------------MNEI
F16PA_CAMFF      --------------------------------------------------MQKGYKMQEI
F16PA_CAMJJ      --------------------------------------------------------MQEV
F16PA_CAMJ8      --------------------------------------------------------MQEV
F16PA_CAMJE      --------------------------------------------------------MQEV
F16PA_CAMJR      --------------------------------------------------------MQEV
F16PA_CAMJD      --------------------------------------------------------MQEV
F16PA_ARCB4      --------------------------------------------------------MQEI
F16PA_SULDN      --------------------------------------------------------MTDI
F16PA_NITSB      --------------------------------------------------------MTEI
F16PA_SULNB      --------------------------------------------------------MHTI
F16PA_WOLSU      -------------------------------------------------------MLEAI
F16PA_HELHP      -------------------------------------------------------MISII
F16PA_HALSA      ----------------------------------------------------MADVIDAV
F16PA_HALS3      ----------------------------------------------------MADVIDAV
F16PA_NATPD      ----------------------------------------------------MADAIDDI
F16PA_HALWD      ----------------------------MASSIDSHMTESTADSESESFSLTDDEIINSI
F16A1_HALMA      -----------------------------------------MSKSLDISTTEAEQTVTEV
F16A2_HALMA      -----------------------------------------------------MNTLDEI
                                                                             

F16A2_CUPNH      ILNVAMACKEIARAVAFGALGGLHGKASNQAGEAGAVNVQGEIQQKLDVLSNTTFLRVNE
F16A3_CUPNH      ILNVAMACKEIARAVAFGALGGLHGKASTQAGEEGAVNVQGEIQQKLDVLSNTTFLRVNE
F16A2_CUPTR      ILNVAMACKEIARAVAFGALGGLHGRAGGPDAAGAAINVQGEVQQKLDVLSNDTFLRVNE
F16A2_CUPMC      ILDVALACKALARVVSFGELGDALSDG-SAAPTGGGINVQGEVQKPLDVQSNEMFIRMNE
F16A2_LEPCP      ILDVSLACKAIARAVAFGELGDALGDA-AAMPTGGAVNVQGEVQKKLDVLSNEVFIRRNE
F16A2_POLNA      ILDVALACKAIARAVAFGELGGMLGN--HDADAGGSINVQGETQKKLDVISNQYFTRMNE
F16A1_RHOFT      ILDVALACRAIARAVALGELGGAMGN--HAAETGGSVNVQGETQKKLDVLSNEVFIRRTE
F16PA_HYDTE      ILDMARACKAIARQVAYGALAK------SNHAVTTTINVQGEEQKPLDVISNECFMRLTE
F16A3_METPP      ITDVSLACKAISRKVAFGGLAGVLG-------SAGSGNVQGEEQKTLDVLSNTMFLRATE
F16PA_RHORT      LLDVAQACKTISKMTAMGSLAGVHGY-------NGDVNPQGENQARLDLMSNQAFVRATE
F16A2_DECAR      LIDVAAAVKTISAMVAKGALAGHH-------GALDSTNVQGEVQKKLDVLTNDAILRHCE
F16A2_PARXL      LIDVAAAIKSISAMLTKGALGGNY-------GSAQSINTHGEEQKKLDVATNEIFVQQCE
F16PA_METI4      INDIESACKYVAAAVSKGKLISQE-------VNV-TINVQGEEQKPLDVIANEIFLKICE
F16PA_MAGSA      MTDIIFACKMISHEVNRGALAGNL-------GVAGSENVQGEEQKKLDVLANDIFLHMNA
F16PA_METFK      IQDIAATCQAVAREIRYGALRGNM-------GSAGRENVQGEEQKALDVISNDIFTAMAS
F16A1_METPP      IRHVAAACARISRAAARAPLAGQL-------GGAGSLNSQGEPQQRLDVLADACVSQALS
F16PA_NITEC      LNDIVTAIKTISNAVNKGALIGVM-------GALDTENVQGETQKKLDVITNEIMIRHNE
F16PA_NITEU      LNDIVTAIKTISNAVNKGALIGVM-------GALDTENVQGETQKKLDVITNEIMIRNNE
F16PA_THIDA      LNDVVTACKAISNAVNKGALLGVM-------GALESENVQGETQKKLDVITNDIMIRSNE
F16PA_NITOC      LNDIVTACKTISHLVNRGGLIDIL-------GAAGTENIQGEGQKKLDVISNDIMVNSLE
F16PA_ACIF5      LNDLTTSCKFIGAQVYRGALVGAL-------GSAGTDNVQGEVQKKLDIISNEAILKSMD
F16PA_HALHL      LNDISVACKRIADLVNKGDLVGML-------GSADSENVQGETQKKLDVVTNEVFIEALT
F16PA_DELAS      LEVVARACKRISQSVNKGAIGDVL-------GTAGSENVQGEVQKKLDIIANEVLIEANE
F16PA_ACISJ      VEVVARACKRISFAVNKGDLGDVM-------GTAGTENVQGEVQKKLDIIANEVLIEANE
F16PA_POLSJ      LEVVARACKGISQSVNKGALGGVL-------GTAGSENVQGEVQKKLDIIANEVLIEANE
F16PA_ACIAC      LEVVARACKHISHAVNKGALGGVL-------GSASSENVQGEIQKKLDIIANEVLIEANE
F16A1_POLNA      IEVVARACKSISQAVNKGALGDVM-------GSAGSENVQGEIQKKLDIIANEVLIEANE
F16PA_VEREI      LEVVARACKSISHAVSKGALGDVL-------GTAGSENVQGEVQKKLDIIANGVLIEANE
F16A2_RHOFT      LEVVARACKRISLTVNKGALGGVL-------GSAETENIQGEMQKKLDIIANEVLIEANE
F16A1_LEPCP      IEVVARACKRIAISVNKGALGEVL-------GSAGSENVQGEVQKKLDIISNEVLIEANE
F16A2_METPP      LEVVARACKSIAISVNKGALGGVL-------GSAGSENVQGEVQKKLDIIANEVLIEANE
F16A1_CUPTR      IEVVARACKAISNAVSKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLDANE
F16A1_CUPNH      IEVVARACKAISNAVSKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLDANE
F16PA_CUPPJ      IEVVARACKAISNSVNKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLDANE
F16A1_CUPMC      IEVVARACKAISNAVSKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLDANE
F16PA_RALSO      LEVVARACKAISHSVNKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLEANE
F16PA_RALPJ      LEVVARACKAISHSVNKGALAGVL-------GSAGTGNVQGETQQKLDVIANEVLLEANE
F16PA_BORBR      IEVVARACKAISHAVSKGALGGVL-------GSLESENVQGEVQKKLDVLSNEILLEANE
F16PA_BORPA      IEVVARACKAISHAVSKGALGGVL-------GSLESENVQGEVQKKLDVLSNEILLEANE
F16PA_BORPE      IEVVARACKAISHAVSKGALGGVL-------GSLESENVQGEVQKKLDVLSNEILLEANE
F16PA_BORPD      IEVVARACKAISHAVSKGALGGVL-------GSLESENVQGEVQKKLDVLSNEILLEANE
F16PA_BORA1      IEVVARACKAISHAVGKGALGGVL-------GSLESENVQGEVQKKLDVLSNEILLEANE
F16PA_JANMA      LEVVARACKTISHAVGKGALGEVL-------GTAQSENVQGEVQKKLDIISNDILLEANE
F16PA_HERAR      IEVVARACKTISHAVGKGALGEVL-------GSAQSENVQGEVQKKLDIISNDILLEANE
F16PA_HERSE      IEVVGRACKSISHAVGKGALGEVL-------GSAGSENVQGEVQKKLDVISNEILLEANE
F16PA_PARL1      VEIVARACKTISHCVNKGALGGML-------GNLTSENVQGEVQKKLDVIANEKLLEANE
F16A1_PARXL      IEVVARACKAISYHVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLEANE
F16PA_PARPJ      IEVVARACKAISYHVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLEANE
F16A1_PARP8      IEVVARACKAISYHVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLEANE
F16PA_BURCA      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURCH      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURCC      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURCJ      IEVVARACKAISYNVSKGALGEAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURL3      IEVVARACKAISYNVSKGALGEAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURM1      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURA4      IEVVARACKAISYNVSKGALGEAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURCM      IEVVARACKAISYNVSKGALGEAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURVG      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURM9      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURMS      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURPS      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURMA      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURP1      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURP0      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURP6      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURM7      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_BURTA      IEVVARACKAISYNVSKGALGDAL-------GTAGSENVQGEVQKKLDILSNEILLDANE
F16PA_PSEP1      IEVVARACKEISHHVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNDILLEANE
F16PA_PSEE4      IEVVARACKEISHHVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNDILLEANE
F16PA_PSEPK      IEVVARACKEISHHVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNDILLEANE
F16PA_PSEPG      IEVVARACKEISHHVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNDILLEANE
F16PA_PSEPW      IEVVARACKEISHHVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNDILLEANE
F16PA_PSESM      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNEILLEANE
F16PA_PSEU2      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNEILLEANE
F16PA_PSE14      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNEILLEANE
F16PA_PSEPF      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVLSNEILLEANE
F16PA_PSEF5      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVISNEILLEANE
F16PA_PSEA7      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVMSNEILLEANE
F16PA_PSEAE      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVMSNEILLEANE
F16PA_PSEAB      IEVVARACKEISHAVSKGALGGVL-------GSMGTENVQGEVQKKLDVMSNEILLEANE
F16PA_PSEMY      IEVVARACKAISHQVSKGALGGVL-------GSLDSENVQGEVQKKLDVISNEILLEANE
F16PA_PSEU5      IEVVARACKAISHQVSKGALGGVL-------GSAGSENVQGEVQKKLDVLSNEILLEANE
F16PA_CHRVO      IETVGRACKAISYSVNKGALADVL-------GEAGTGNIQGEAQKKLDVIANDFLLDANE
F16PA_AROAE      IEVVARAVKAIAVNVSKGALADLL-------GEAGTDNVQGEAQKKLDVIANEILLQANE
F16PA_AZOSB      IEVVARAVKAISVNVSKGALAGVL-------GEAGTDNVQGEAQKKLDVIANEILLQANE
F16A1_DECAR      IEVVSRACQAISIAIGKGGLGGVL-------GEAGSDNVQGEAQKKLDVLSNDILLDANE
F16PA_XANAC      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANC5      ITIVSRACKRISIAVSKGTLGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANOM      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANOP      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANOR      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANCP      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANC8      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_XANCB      ITIVSRACKRISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVLSNDILLEANA
F16PA_STRM5      IAVVARACTSISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVISNEILLEANA
F16PA_STRMK      IAVVARACTSISIAVSKGALGGVL-------GDAGTGNVQGEAQKKLDVISNEILLEANA
F16PA_SHEB8      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEB5      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEB9      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHESR      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHESM      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHESA      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEPC      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHESW      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEON      ILTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEHH      ILTLANTSKEISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHEPA      ILTLANTSKEISHAVRHGALAGVL-------GATEQENVQGETQKKLDIITNDMLKDALK
F16PA_SHESH      IHTLANTSKEISHAVRHGALAGVL-------GATEQENVQGETQKKLDVITNDMLKDALK
F16PA_SHEWM      IHTLANTSKEISHAVRHGALAGVL-------GATEQENVQGETQKKLDVITNDMLKDALK
F16PA_SHELP      LTTLADTSKAISHAVRHGALAGVL-------GATEQENVQGETQKKLDVITNDMLKEALT
F16PA_SHEDO      ILTLADTSKDISLAVRHGALAGVL-------GATEQENVQGETQKKLDVITNDMLKDALT
F16PA_SHEFN      LLTLADTSKAISGAVRHGALAGVL-------GATEQENIQGETQKKLDVITNDMLKDALK
F16PA_SHEAM      LTVLANSSKDISQAVRRGALAGVL-------GVAGTENVQGEDQKKLDVITNDMLKDALA
F16PA_MARMS      LAVTTDTCIAISDALKQGSLAGIL-------GMAGNENVQGEEQKKLDVISNDMLKDALI
F16PA_ALTMD      IRTLLAGCKEISFRVSQGALAGVL-------GSTLSENVQGETQKKLDVISNHILKDTLR
F16PA_PSEA6      LRTLLAGCKEISFRVSQGALAGVL-------GSTLSENVQGETQKKLDVISNQILKDILS
F16A1_PSET1      IRTILAACKEISFRVGQGELSGVL-------GSTLDENIQGETQKKLDVLTNQLLKDILL
F16PA_COLP3      IKTILAATKEISFRVSQGHLGDVM-------GSTLDENIQGEVQKQLDVVANELFKDILL
F16PA_IDILO      INTIQIAAKEISFRLHQGALAGVL-------GSTLDENIQGETQKKLDVVANQLLKTLLL
F16PA_CELJU      IRTLLAATKEIAFRVRQGALSGVL-------GSTLDENIQGETQKQLDVIANQLIKDLLL
F16A2_PSET1      IRTILATSKEIAFRVSQGELAGVL-------GSTLNENIQGEVQKKLDVIANQLLKDILL
F16PA_SACD2      IFSIELACKDIAKKVQLGALAGVL-------GATESENVQGETQKKLDVISNDILKASLA
F16PA_HYDCU      IKDVMVACKDIAYKLGQGELAGIL-------GATEDENVQGETQKMLDVISNDLLKDILV
F16PA_ACIBC      IDTIAATCKTIDQALQKGALAGIL-------GSAGNENVQGETQKKLDVISNDYLIDALK
F16PA_ACIBS      IDTIAATCKTIDQALQKGALAGIL-------GSAGNENVQGETQKKLDVISNDYLIDALK
F16PA_ACIBT      IDTIAATCKTIDQALQKGALAGIL-------GSAGNENVQGETQKKLDVISNDYLIDALK
F16PA_ACIBY      IDTIAATCKTIDQALQKGALAGIL-------GSAGNENVQGETQKKLDVISNDYLIDALK
F16PA_ACIAD      IETIANSCKKIDHAIQKGALADLL-------GSAGNENVQGETQKKLDVLSNDFLIDALK
F16PA_PSYA2      ITTVTDVGKTISQLLRKGALADIL-------GEAGNQNVQGEDQKKLDVLANDLLLDALA
F16PA_PSYCK      ITTVTDVGKTISQLLRKGALADIL-------GEAGNQNVQGEDQKKLDVLANDLLLDALA
F16PA_PSYWF      ITTITNVGKQITDLLRQGALADIH-------GEAGAENVQGEQQKKLDVIANDLLLEALT
F16PA_NEIM0      LLSVVSACTEINAKVRLGALAGVL-------GMTGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_NEIMB      LLSVVSACTEINAKVRLGALAGVL-------GMAGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_NEIMF      LLSVVSACTEINAKVRLGALAGVL-------GMAGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_NEIMA      LLSVVSACTEINAKVRLGALAGVL-------GMAGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_NEIG1      LLSVVSACTEINAKVRLGALAGVL-------GMAGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_NEIG2      LLSVVSACTEINAKVRLGALAGVL-------GMAGTGNIQGEDQKKLDVIANNIMIDTLK
F16PA_POLAQ      LIAVTQTCSTLSHEVAQGALIGLL-------GSAGTGNVQGEVQQKLDIIANDLLIEGVQ
F16PA_POLNS      LIAVVNTCSKLSHEVAQGALIGLL-------GPAGTGNVQGEVQQKLDIIANDLLIDGVQ
F16PA_CAUVC      VLTIAETCAQISRVVASGALSGSL-------GAAGSTNVQDEEQKKLDVITNDMLSDALK
F16PA_CAUSK      VTVIAGACAQISKVVASGAISGSL-------GAAGQVNVQDEEQKKLDIITNDILRGALK
F16PA_ALKEH      LRQVGDSCRRIADAVAGGALREMT-------GAADNVNVQGEEQKKLDVFANDVLIEGCN
F16PA_NITVU      VAALARAAVDISDLTCRGALAGITGQ-----AQG--RNTDGDIQKDLDVRADQIIRDALG
F16PA_NITWN      VAALAQAAIDISDLTCRGALAGITGQ-----AQG--RNTDGDVQKDLDVRADQIIRDALG
F16A2_NITHX      VAALAQAAIDISDLTCRGALAGITGE-----AQG--RNTDGDIQKDLDVRADQIIRDALS
F16A1_NITHX      VAALAQAAIDISDLTCRGALAGITGE-----AQG--RNTDGDVQKDLDVRADQIIRDALG
F16PA_BRADU      VDAIAAAAIEIADLIGAGDLADASGL-----TTG--RNSDGDVQRDLDVQADAILRRCLG
F16PA_RHOPB      IDAIAAASIDISELIGRGPLAGITGE-----AQGS-SNADGDVQKDLDVRCDEMILAGLQ
F16PA_RHOP5      IDAIAEASIEMAELIGRGALAGITGE-----AQGS-SNADGDVQKDLDVRCDEMILEALK
F16PA_RHOPA      VGAIAAGSIEISELIGQGALAGITGA-----AHGG-SNADGDVQKDLDVKAEQIIVKSLK
F16PA_RHOPT      VGAIAAGSIEISELIGQGALAGITGA-----AHGG-SNADGDVQKDLDVKAEQIIVKSLK
F16PA_RHOP2      VGAIAEASIEISDLIGQGALAGITGA-----AHGA-SNADGDVQKDLDVRAEAAIVAALK
F16PA_RHOPS      VGAIAEASIEISELIGQGALAGITGA-----AHGA-SNADGDVQKDLDVRAEAAIVAALK
F16PA_BRASO      IEALADAARELARQIAIAPLSGIDEG-----AAT--VNTDGDIQKALDIVADNLMREALR
F16A2_BRASB      IEALADAARELARQIAIAPLAGFDEG-----AAT--VNADGDVQKALDIVADNLMRDALR
F16PA_RHIME      IQRLAKAALDIRKLVNQGALGTAFNG-----THGG-SNTDGDLQKDLDILCDDQFLTCLQ
F16PA_SINMW      IQRLAKAALDIRKLVNQGALGTVFNG-----MHSG-SNTDGDVQKDLDILCDDQFLSCLQ
F16PA_XANFL      VCALATGCASLAAAIAEGPLAGDLAR-----TLS--SGEAGEGQKALDVISNDIVIGALK
F16A1_XANP2      LNALAAGTIQIARAIAEGPLAGDLAR-----TLS--SGEAGEGQKALDIISNDMVIDALR
F16A2_CERSP      MQRLARVGAGIARIISRNGLERDLGA-----GVG--TNAGGDGQKALDVIADDAFRAALE
F16A2_CERS4      MQRLARVGAGIARIISRNGLERDLGA-----GVG--TNAGGDGQKALDVIADDAFRAALE
F16A2_RHOS1      MQRLARVGAGIARIISRNGLERDLGA-----GVG--TNAGGDGQKALDVIADDAFRAALE
F16A2_CERS5      MQRLARVGGQIARLISRNGLETDLAA-----GVG--TNAGGDGQKALDVIADNAFRAALA
F16PA_RHOCB      MTRLARVGADLARTIARNGVETDLAA-----GVG--TNAGGDGQKALDVMADDAFREALT
F16A1_RHOS1      MDRLGTVAIEVANRIARGGIDEDLAG-----LCG--TNTDGDGQKALDVIADDAFRAALE
F16A1_CERS4      MDRLGSVAIEVANRIARGGIDEDLAG-----LCG--TNTDGDGQKALDVIADDAFRVALE
F16A1_CERSP      MDRLGSVAIEVANRIARGGIDEDLAG-----LCG--TNTDGDGQKALDVIADDAFRVALE
F16A1_CERS5      MDRLGSVAIEVATRIARGGIDEDLAG-----LCG--TNTDGDGQKALDVIADDAFRAALE
F16PA_PARDP      MQALAEAGARLAAIIRRGG---DLAQ-----PVG--TNADGDGQKALDVIADDLFCQTLA
F16A1_BRASB      VTALAFVAETLAGVISSGPLNGRLGE-----EVG--ANSDGDRQKKLDVVADELFAGALA
F16PA_METEP      IRALAAAAIDVSETVGRGSLAGDLAA-----QGE--HNSDGDVQKALDVIAHKRFMQALE
F16PA_METPB      IRALAAAAIDVSETVGRGALAGDLAA-----QGE--HNSDGDVQKALDVIAHKRFMQALE
F16PA_METRJ      VAAVGRSAVEISERIGRGALGGDLAA-----AGD--HNSDGDVQKALDVIAHESVTAALR
F16PA_AZOC5      VERLAEAGVSIAELVARGPLAEDFGK-----VRGDEANAGGDAQKELDVIAEEELVDALG
F16A2_XANP2      VTAIAEAGVGIADLVARGPLEEGLAS-----IRGVDPNAGGDAQKELDVVAEERIKAALL
F16PA_ACICJ      VEALAGAARQIAHLLARGPLSGDLGA-----VIGESLD--GDGQKALDAITHALVREAVI
F16PA_BRUC2      IKAILSGAGRLVGSIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUSU      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUAB      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUO2      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUA2      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUA1      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUSI      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUME      IKAILSGAGRLVGRIARGYLPGDPGK-----LVG--VNSDQDQQKSIDVGSHNLFVELLI
F16PA_BRUA4      IKAILAGATRLAGRIARGSLPGDPGK-----LVG--VNSDQDQQKCIDVGSHNLFVELLI
F16A3_PSET1      LQSIVGACTEIATRINHGALSDVL-------GSLPDHNVQGEVQKKLDVIANNILIESLK
F16PA_ECOLI      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHIFL      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHIBS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOK1      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOUT      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOL5      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHIF8      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHIB3      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECODH      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOSM      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOLC      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOL6      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECO24      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECOHS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHIDS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECO57      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ECO5E      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SHISS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENAQGEVQQKLDLFANEKLKAALK
F16PA_CITK8      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALTY      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALPA      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALCH      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALEP      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALDC      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALA4      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALPK      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALSV      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALHS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALNS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALPB      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALTI      LSAIKLGAKIIHRDINKAGLVD-------ILGASCAENVQGEVQQKLDLFANEKLKAALK
F16PA_SALG2      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENAQGEVQQKLDLFANEKLKAALK
F16PA_SALAR      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALK
F16PA_ENT38      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALR
F16PA_KLEP3      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALR
F16PA_KLEP7      LSAIKLGAKIIHRDINKAGLVD-------ILGASGAENVQGEVQQKLDLFANEKLKAALR
F16PA_CROS8      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVENVQGETQQKLDLFANEKLKAALK
F16PA_ERWT9      ISAIKLGAKIIHRDINKAGLVD-------ILGASGVENIQGEQQMKLDLYANEKLKAALK
F16PA_SODGM      LSAIKLGAKIIHRDINKAGLVD-------ILGTSGAENVQGEVQMKLDLFANEKLKAALK
F16PA_YERPN      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPA      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPE      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPB      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPY      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPG      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERP3      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERPP      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_YERE8      LSAIKLGAKIIHRDINKAGLVD-------ILGASGVSNIQGEDQMKLDLFANEKLKAALK
F16PA_SERP5      LSAIKLGAKIIHRDINKAGLVD-------ILGTSGVSNVQGEVQMKLDLYANEKLKAALK
F16PA_PHOLL      LSAIKLGAKIIHRDINKAGLVD-------ILGTSGVSNVQGEVQMKLDLYANEKLKAALK
F16PA_PROMH      LSAIKLGAKIIHRDINKAGLVD-------ILGTNGVSNVQGEAQMKLDLYANEKLKAALK
F16PA_PECAS      LSAIKLGAKIIHRDINKAGLVD-------ILGASGISNVQGEVQMKLDLYANEKLKAALK
F16PA_VIBCH      LASIRLAAKIVNREINKAGLAD-------IIGASGNDNIQGEEQQKLDLYANEKFKAALE
F16PA_VIBC3      LASIRLAAKIVNREINKAGLAD-------IIGASGNDNIQGEEQQKLDLYANEKFKAALE
F16PA_VIBVU      LSSIRLAAKIVNREINKAGLVD-------ITGAAGVENIQGEVQQKLDVYANEKFKSALE
F16PA_VIBVY      LSSIRLAAKIVNREINKAGLVD-------ITGAAGVENIQGEVQQKLDVYANEKFKSALE
F16PA_VIBPA      LASIRLAAKIVNREINAAGLGD-------ITGAVGTENVQGEAQQKLDVYANDKFKAALE
F16PA_VIBCB      LASIRLAAKIVNREINAAGLGD-------ITGAVGTENVQGEDQQKLDVYANDKFKAALE
F16PA_ALIFM      IGSIKLAAKIVNREINKAGLVD-------ITGASGEENIQGEQQQKLDVYANDKFKAALE
F16PA_ALIF1      IGSIKLAAKIVNREINKAGLVD-------ITGASGEENIQGEQQQKLDVYANDKFKSALE
F16PA_ALISL      IGSIKLAAKIVNREINKAGLVD-------ITGASGDENIQGEQQQKLDIYANDKFKAALE
F16PA_PHOPR      LGSIKLAAKIVNREINKAGLVD-------ITGAIGSENVQGEEQQKLDLYANDKFKAAME
F16PA_AERS4      LSSIRLAAKVVNREINKAGLAD-------IIGSMGAENVQGEVQQKLDVYANERFKAALE
F16PA_AERHH      LSSIRLAAKVVNREINKAGLAD-------IIGSMGAENVQGEVQQKLDVYANERFKAALE
F16PA_HAHCH      FSSIRLAAKILHREINKAGLAD-------ITGAAGDENVQGEQQQKLDVYANERFKNALA
F16PA_PSYIN      LGAIRLATKVVNRDINKAGLVD-------IIGATGVENVQGEVQQKMDLYANDVFKAALE
F16PA_HAEIE      LSSIRLLAKIIHRDINKAGLTN-------ILGQSGIENVQGESQMKLDLFAHNTMKAALM
F16PA_HAEI8      LSSIRLLAKIIHRDINKAGLTN-------ILGQSGIENVQGESQMKLDLFAHNTMKAALM
F16PA_HAEIN      LSSIRLLAKIIHRDINKAGLTN-------ILGQSGIENVQGESQMKLDLFAHNTMKAALM
F16PA_HAES1      LSSLRLVAKIIHRDINKAGLTNN------IIGNSGVENVQGETQMKLDLFAHNTMKQALI
F16PA_HISS2      LSSLRLVAKIIHRDINKAGLTNN------IIGNSGVENVQGETQMKLDLFAHNTMKQALI
F16PA_PASMU      LSSIRLVAKVIHRDINKAGLTNN------IIGTSGAENVQGETQMKLDLFAHNTMKQALI
F16PA_MANSM      LSSIRLVAKVIHRDINRAGLTNN------ILGFSGIDNVQGEHQMKLDLFAHNMMKQALM
F16PA_ACTSZ      LSSIRLVAKIIHRDINRAGLSND------ILGYAGNQNVQGENQMKLDVFANDTFKRALM
F16PA_ACTP7      LSSIRLAAKIIHREINRAGLSQD------ILGVAGSENIQGEAQMKLDVFANETMKKALL
F16PA_ACTPJ      LSSIRLAAKIIHREINRAGLSQD------ILGVAGSENIQGEAQMKLDVFANETMKKALL
F16PA_ACTP2      LSSIRLAAKIIHREINRAGLSQD------ILGVAGSENIQGEAQMKLDVFANETMKKALL
F16PA_HAEDU      LASIRLAAKIIHREINRAGLSQD------ILGFAGSENVQGETQMKLDIFANETMKKALL
F16PA_DICNV      LSAVRRAAKIINRDINRAGVVSDL-----VLGSMGRENVQGETQMKLDVFAHEAMKAAFY
F16PA_FLAJ1      INSIRLAAKVVNYKVNKAGLVD-------IIGAAGEQNIQGEDQQKLDVYANEVFIQTLI
F16PA_FLAPJ      INSIRLAAKVVNYKVNKAGLVD-------IVGAAGEQNIQGEDQQKLDVYANEIFIQTLI
F16A2_GRAFK      INSLRLAAKVVNHEVNKAGLVD-------IIGAYGETNVQGEDQQKLDVYANNKFIQTLT
F16A1_GRAFK      LSSIRLAGKVVNQQINKAGLAE-------ILGKAGKENVQGESQAKLDVLANEIFVSTLR
F16PA_WIGBR      FIIIELTSKIIHNYIILNNITR-------IKQEKIKKNIHGEHQTKLDLLSNKKFIDMIK
F16PA_CYTH3      LNDIAVAAKIINREVNKAGLLD-------ILGMEGGMNVQNEEVKKLDVYANDQFISALR
F16PA_CHLPM      LSDVAFAAKLVRREVVRAGLVD-------ILGFAGSTNVQGEEVKKLDLFANDKIINAIG
F16PA_CHLL3      LSDVAFAAKLVRREVVRAGLVD-------ILGFAGSTNVQGEEVKKLDLFANDKIINAIG
F16PA_CHLPD      LNDVAFAAKLVRREVVRAGLVD-------ILGFTGDTNIQGEQVKKLDLFANDKIINAIG
F16PA_PELPB      LNDVAFAAKLVRREVVRAGLVD-------ILGFTGSTNVQGEEVKKLDLFANEKIISAIG
F16PA_CHLL2      LTDVAFAAKLVRREVVRAGLVD-------ILGFAGTTNVQGEEVKKLDLFANEKIINAIG
F16PA_CHLCH      LTDVAFAAKLVRREVVRAGLVD-------ILGLAGSTNVQGEEVKKLDLFANEQIISAIG
F16PA_PROA2      LNDVAFAAKLVRREVVRAGLAD-------ILGMAGTTNVQGEEVKKLDLFANEKIINAIG
F16PA_CHLPB      LYDVAFAAKLVRREVVRAGLVD-------ILGMAGTTNVQGEEVKKLDLFANDKIINAIG
F16PA_CHLTE      LNDVAFAAKLVRREVVRAGLAD-------ILGLAGSTNVQGEEVKKLDLFANERLINAIG
F16PA_CHLP8      LNDVAFAAKLVRREVVRAGLAD-------ILGLAGSTNVQGEEVKKLDLFANERLINAIG
F16PA_CHLT3      LYDVAFAAKLVYRHVVRAGLVD-------ILGSAGSTNVQGEEVKKLDLFANEQFTKAIG
F16A2_SALRD      LRDISLAAKIVNRDMRRAGLLD-------VYGSTGERNVQGEVQQKMDALAHREFVQALR
F16A1_SALRD      LRDVSVAAKIINHNIRRAGILD-------VMGESGTVNVQDEKQKKLDEIADRELERALR
F16PA_NOSS1      MNRIALAGKLVARRLSRAGLME-G-----VLGFTGEVNVQGESVKKMDVYANDVFISVFK
F16PA_TRIV2      MNRIALAGKLVARRLSRAGLME-G-----VLGFTGEVNVQGESVKKMDVYANDVFISVFK
F16PA_NOSP7      MNRIALAGKLVARRMSRAGLME-G-----VLGFTGEVNVQGESVKKMDVYANDVFISVFK
F16PA_MICAN      MSRIALAGKLIARRLSKAGLMA-D-----VLGFTGETNVQGESVKKMDVFANEVFISVFK
F16PA_CROS5      MNRIALAGKLVARRLSRAGLMA-D-----VLGFTGETNVQGESVKKMDVYANDVFISVFK
F16PA_SYNY3      MNRIALAGKLIARRLSRAGLMA-D-----VLGFTGETNVQGESVKKMDVFANDVFISVFK
F16PA_SYNP2      MNRIALAGKLVARRLSRAGLME-G-----VLGFTGEENVQGESVKRMDLYANDVFISVFK
F16A1_ACAM1      MTRIGLAGKLIARRLSRAGLVE-G-----ALGFTGDINVQGEEVKKMDIYANEVFIAAFK
F16PA_TRIEI      MNRIGLAGKLIARRLTRAGLLE-D-----TLGFTGTVNVQGESVKKMDIYANDVFISVFK
F16PA_THEEB      MNRIALAGKLIARRLSRAGLME-G-----VLGFTGAVNIQGEDVKKMDVYANEVFIAAFK
F16PA_SYNE7      MQRIGLAAKLIARRLSHAGLVD-D-----ALGFTGEINVQGEAVKRMDVYANQVFISVFR
F16PA_SYNP6      MQRIGLAAKLIARRLSHAGLVD-D-----ALGFTGEINVQGEAVKRMDVYANQVFISVFR
F16PA_SYNJA      MNRIALAGKMIARRLSQAGLIE-G-----TLGVTGSVNVQGEEQQRMDDYANRAFIRALE
F16PA_SYNJB      MNRIALAGKMIARRLSQAGLIE-G-----ALGVTGSLNVQGEEQQQMDDYANRAFIRALE
F16PA_GLOVI      MVQISLAAKLISRQLAQAGLVE-N-----VLGFTGETNVQGEAVRHLDQYANETFIRVFQ
F16PA_DESVH      LNDLVLSAKIISRSVTKAGLL--D-----VLGGTGEVNVQGELVQKLDEFANRVLIYRME
F16PA_DESVV      LNDLVLSAKIISRSVTKAGLL--D-----VLGGTGEVNVQGELVQKLDEFANRVLIYRME
F16PA_DESAG      LYDLILAAKIISKSVNKAGLL--D-----VLGGTGQVNVQGEHVQKLDEYANRVLIHRME
F16PA_LAWIP      FHDLILSAKIISRSVNKAGLL--D-----VLGGTGDINIQGEKVQKLDEFADKVLLYRME
F16PA_LEPIN      MSHLVYAAKIVSREVRKAGLLE-N-----ILGATETVNVQGETQMKLDEYADKVFNHTLT
F16PA_LEPIC      MSHLVYAAKIVSREVRKAGLLE-N-----ILGATETVNVQGETQMKLDEYADKVFNHTLT
F16PA_LEPBL      MSHLVYAAKIVSREVRKAGLLE-N-----VLGSNETVNVQGETQMKLDEYADKVFNHTLT
F16PA_LEPBJ      MSHLVYAAKIVSREVRKAGLLE-N-----VLGSNETVNVQGETQMKLDEYADKVFNHTLT
F16PA_LEPBP      LSHLVYAAKIVGREVRKAGLLD-D-----ILGATEDTNVQGETQMKLDQYADNAFNQSLK
F16PA_LEPBA      LSHLVYAAKIVGREVRKAGLLD-D-----ILGATEDTNVQGETQMKLDQYADNAFNQSLK
F16PA_SORC5      LNQLGLVAKLVTSKVRRAGLA--N-----VLGYTGQTNVQGEVVQKLDEVANETLLSVLG
F16PA_SULSY      LVAIESATKVIASHVRMAGLA--D-----ILGMAGKKNIQGEEVQKLDELSNNLLIQYLS
F16A2_ACAM1      LTQMGFAAKVLAREISRAALMG-------NLGLMGETNATGDAQKKLDVFSNQIVIDAFS
F16PA_AMOA5      IQAMATSARFISKAVVQSMIDK-------DVSFTESLNCSGDTQQKLDIVAQSFFLEALE
F16PA_SYNAS      MDSIITAAQRIELYYRTGALKGNL-------GMAGSINVQGESVMKMDDIANEIVLHYLA
F16PA_GEOBB      MCEIAEASKYVINAVRTG-----------DLGVAGTSNLYGEEQLALDVLSDRIMRKRLI
F16PA_GEOUR      ICEIAEASKYVINAVRTG-----------DLGVAGTSNLYGEEQLALDVLSDRIMRKRLI
F16PA_GEOMG      ICEIAEASKYVINAVRTG-----------DLGVAGTSNLYGEEQLALDVLSDRIIKKRLI
F16PA_GEOSL      ICEIAEASKYVINAVRTG-----------DLGVAGTSNLYGEEQLALDVLSDRIIRKRLI
F16PA_PELPD      ICEIAEASKYVINAIRTG-----------DLGVAGTSNLYGEEQLALDVLSDRIIRKRLQ
F16PA_GEOLS      LCEIAEASKYVINAVRTG-----------DLGVAGTSNLYGEEQLALDVLSDRILRKRLM
F16PA_PELCD      ICEIAEASKYIVNSIRTG-----------DLGVAGTSNLYGEEQLALDVLSDRILRKRLA
F16PA_METLZ      IMMIADQAGPIRSAFIS------------NQNYAGSTNSSGEDQAEMDTWADTRITSVLQ
F16PA_METHJ      IRLISRQMDPIRKAFLD------------NQMYEHTLNASGELQAQMDTWADEHLIKVVG
F16PA_METB6      ILFLSGQAREVKKGFLSTCM---------NTGACGTQNMFGEDQKPLDKYADDVFIHALQ
F16PA_HELPY      ISLLEKGVKKAQEILEKPDAGS----------YTKLENSSGDTPIKADLALDKFLEENFL
F16PA_HELPS      ISLLEKGVKKAQEILEKPDAGS----------YTKLENSSGDTPIKADLALDKFLEENFL
F16PA_HELPG      ISLLEKGVKKAQEILEKPDAGS----------YTKLENSSGDTPIKADLALDKFLEENFL
F16PA_HELPH      ISLLEKGVKKAQEILEKPDAGS----------YTKLENSSGDTPIKADLALDKFLEENFL
F16PA_HELPJ      ISLLEKGVKKAQEILEKPDAGS----------YTQLENSSGDTPIKADLALDKFLEETFL
F16PA_HELAH      ISLLEKGVKKAQEILEKPDAGS----------YTKLENSSGDTPIKADLALDKFLEENFL
F16PA_CAMC5      FETIKSVAKEISEVIKYADLG-----------YTTHENATGDTQLKLDVQSDEIITAKFK
F16PA_CAMC1      FNTIKDIAKEISEVIKYADLG-----------YTTHENATGDTQLKLDVKSDEIITAKFK
F16PA_CAMHC      FKTLQIIAKKISEEVKYADFG-----------YTNHQNSTGDTQLKLDVKSDSIIEAEFR
F16PA_CAMFF      IKTIEKIAVKISEELKYADLG-----------YTDHANSTGDTQLKLDVKSDNIITQEFI
F16PA_CAMJJ      ISYIQKAVLEISNALKFPDTG-----------YSQNQNFTGDTQLKFDVLSDEIITKTLS
F16PA_CAMJ8      ISYIQKAVLEISNALKFPDTS-----------YSQNQNFTGDTQLKFDVLSDGIITKTLS
F16PA_CAMJE      ISYIQKAVLEISNALKFPDTS-----------YSQNQNFTGDTQLKFDVLSDEIITKTLS
F16PA_CAMJR      ISYIQKAVLEISNALKFPDTS-----------YSQNQNFTGDTQLKFDVLSDEIITKTLS
F16PA_CAMJD      ISYIQKAVLEISNALKFPDTS-----------YSQNQNFTGDTQLKFDVLSDEIITKTLS
F16PA_ARCB4      MKAIEESAIKIKHLIETGDTG-----------KSEFENSTGDTQLKLDIASDKIIEDIFK
F16PA_SULDN      FSAIQRTAIRIKDAIDTKDIG-----------YSQQENSSGETQLQLDIKCDMIIEEEFS
F16PA_NITSB      IEAIKESAKRIAKTIQTTDFG-----------YSDSANESGDQQLKLDVQSDLIIEEELS
F16PA_SULNB      FETIEKVALKIDHAIKTEDLG-----------YSESENSSGEDQLKLDVKSDYLIEEAFK
F16PA_WOLSU      FEKIKECAPYIQGVIGESAGE-----------YFETKNATGDQQLKADLKADMIIEQEFA
F16PA_HELHP      IDSLRESALHIDSLLKDTSTS-----------YLQSINASGDMQLEIDVRVDKFLSEKLL
F16PA_HALSA      FDAIADAAPEVRAGLPDHRAT------------RDDQNASGDTQLEADVWADDLLFDRTE
F16PA_HALS3      FDAIADAAPEVRAGLPDHRAT------------RDDQNASGDTQLEADVWADDLLFDRTE
F16PA_NATPD      VDVVVSTAPDVRDGLTGRRVY------------EADENPSGERQLEADVYADELLEARLL
F16PA_HALWD      LDILARTAPEIRNGLPGRRVK------------TNEENPSGESPMEADVFADELLRNRLG
F16A1_HALMA      IDTIVATTPDVRRAVADYRGQ------------SNSVNPTGDDQLAADLRADELFEQRVL
F16A2_HALMA      ERAVKDTAHYVSGNLANYANR------------AAGENPSGEQQVGGDVWADDLFFDALA
                                                      .   :     *   .  .     

F16A2_CUPNH      WGGYLAGMASEEMEAPYQIPDH--YPRGKYLLVFDPLDGSSNIDVNVSVGSIFSVLRAPE
F16A3_CUPNH      WGGYLAGMASEEMEAPYQIPEN--YPRGKYLLVFDPLDGSSNIDVNVSVGSIFSVLRAPE
F16A2_CUPTR      WGGYLAGMASEEMEAPYQIPAH--YPRGKYLLVFDPLDGSSNIDVNVSVGSIFSVLRAPE
F16A2_CUPMC      WNGQLAGMASEEMEEPYLIPSS--YPRGKYLLVFDPLDGSSNIDVNVSIGSIFSILRAPA
F16A2_LEPCP      WSGSLAGMASEEMETPYQIPGQ--YPRGKYLLVFDPLDGSSNIDVNVSVGSIFSILRAPQ
F16A2_POLNA      WGGHLAGMASEEMDDAYQIPAE--HPRGKYLLVFDPLDGSSNIDVNVSVGSIFSILRAPQ
F16A1_RHOFT      WAGNLAGMASEEMELPYQIPQQ--YPRGKYMLVFDPLDGSSNIDVNVCVGSIFSVLRAPQ
F16PA_HYDTE      WGGYLAAMASEEMDEPYLIPEQ--YPRGRYLLLFDPLDGSSNIDVNVSVGSIFSVLRAPE
F16A3_METPP      WGGHVAGMVSEELEAPYTLPPQ--YARGKYLLMFDPLDGSSNIDVNVTVGSIFAIHRAPQ
F16PA_RHORT      RTGHAAGLASEEMEEVLGFPES--YARGTLLLVFDPLDGSSNIDINGTVGSIFSILPMPR
F16A2_DECAR      WGGQLAGMASEEMDDPYPIPAE--YPRGRYLLVFDPLDGSSNSDVNVSVGTIFSIFSRRA
F16A2_PARXL      WDGLLAAMVSEEMESVYAIPPG--YPRGDYLLAFDPLDGSSNIDINGVVGSIFSVLRNGE
F16PA_METI4      QGDQLQGMVSEEMESPYIIPPE--HRRGKYLLIYDPLDGSSNLDVNLTVGSIFSVLKAPE
F16PA_MAGSA      LGGSYAGMASEELEDVHAVHGA--AD-GKYLLLFDPLDGSSNIDVNISVGSIFSILKLPE
F16PA_METFK      KQPHVAAVASEEMAQAQVFAGK--QG--KYLLVFDPLDGSSNVNLNLSVGSIFSILPAPE
F16A1_METPP      ACTHVAGWVSEEHADVTVSPEH--GSGGAYLVVFDPLDGSSNVETNVAIGSIFSVLPHLF
F16PA_NITEC      WAGHLAGMASEEMDDVYLIPNR--YPLGKYLLVFDPLDGSSNVDINISVGTIFSILRAPV
F16PA_NITEU      WAGHLSGMASEEMDDVYSIPSP--YPLGKYLLVFDPLDGSSNVDLNISVGTIFSILRSPV
F16PA_THIDA      WAGHLAGMASEEMDDVYAIPGQ--YPLGKYLLVFDPLDGSSNVDVNISVGTIFSILKAPV
F16PA_NITOC      WTGHLGAMASEEIEGIIPIPGQ--YPKGKYLLLFDPLDGSSNIDINISVGTIFSILRCPD
F16PA_ACIF5      WTGHLAGMASEEMDDPYPIPRN--IPRGKYLLLFDPLDGSSNTDVGISVGTIFSILKAPV
F16PA_HALHL      QNGHIAGLVSEEMDDIYTLPNP--SQRGRYLLLCDPLDGSSNIDVNVSVGTIFSIVRAPQ
F16PA_DELAS      WGGHLAAMASEEMEGIYLVPNR--YPHGEYLLMFDPLDGSSNIDVNVSIGTIFSVLKK--
F16PA_ACISJ      WGGHLAAMASEEMDGIYVVPNR--FPQGEHLLMFDPLDGSSNIDVNVSIGTIFSVLHKHH
F16PA_POLSJ      WGGHLAAMASEEMDSIYLVPNR--YPQGEYLLLFDPLDGSSNIDVNVSIGTIFSVLKK--
F16PA_ACIAC      WGGHLAAMASEEMDSIYVVPNR--YPQGEYLLLFDPLDGSSNIDVNVSIGTIFSVLKK--
F16A1_POLNA      WGGHLAAMASEEMDDIYVVPNR--YPQGEYLLMFDPLDGSSNIDVNVSIGTIFSVLKK--
F16PA_VEREI      WGGHLAAMASEEMDGIYLVPHR--YPQGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRK--
F16A2_RHOFT      WGGHLAAMASEEMDGIYIVPNR--YPQGEYLLMFDPLDGSSNIDVNVSIGTIFSVLVK--
F16A1_LEPCP      WGGHLAAMASEEMDSIHVVPNR--YPQGEYMLLFDPLDGSSNIDVNVSIGTIFSVLRK--
F16A2_METPP      WGGALAAMASEEMDSIYVVPNR--YPQGEYLLLFDPLDGSSNIDVNVSIGTIFSVLKK--
F16A1_CUPTR      WGGHLAAMASEEMESFYEIPNR--YPKGEYLLMFDPLDGSSNIDVNVSIGTIFSVLHM--
F16A1_CUPNH      WGGHLAAMASEEMESFYEIPNR--YPKGEYLLMFDPLDGSSNIDVNVSIGTIFSVLHM--
F16PA_CUPPJ      WGGHLAAMASEEMESFYEIPNR--YPKGEYLLMFDPLDGSSNIDVNVSIGTIFSVLHM--
F16A1_CUPMC      WGGHLAAMASEEMDSFYEIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLHM--
F16PA_RALSO      YGGNLAAMASEEMESFYEIPHR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLHM--
F16PA_RALPJ      YGGNLAAMASEEMESFYEIPHR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLHM--
F16PA_BORBR      WGGHLAAMASEEMETIHLIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRA--
F16PA_BORPA      WGGHLAAMASEEMETIHLIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRA--
F16PA_BORPE      WGGHLAAMASEEMETIHLIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRA--
F16PA_BORPD      WGGHLAAMASEEMETIHLIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLHA--
F16PA_BORA1      WGGHLAAMASEEMETIHRIPNR--YPKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRA--
F16PA_JANMA      WGGHLAAMASEEMETIHQIPNR--YPMGEYLLLFDPLDGSSNIDVNVSIGTIFSVLKA--
F16PA_HERAR      WGGHLAAMASEEMETIHPIPNR--YPMGEYLLLFDPLDGSSNIDVNVSIGTIFSVLKA--
F16PA_HERSE      WGGHLAAMASEEMETIHRIPNR--YPKGEYLLMFDPLDGSSNIDVNVSIGTIFSVLKA--
F16PA_PARL1      WGGHLAAMASEEMETIHLIPNR--YPKGEYLLLFDPIDGSSNIDVDLSVGTIFSVLTA--
F16A1_PARXL      WGGNLAGMASEEMEQFFPIPAN--YPKGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_PARPJ      WGGNLAGMASEEMEQFFPIPAN--YPKGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16A1_PARP8      WGGNLAGMASEEMEQFFPIPAN--YPKGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURCA      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURCH      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURCC      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURCJ      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURL3      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURM1      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURA4      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURCM      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURVG      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURM9      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURMS      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURPS      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURMA      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURP1      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURP0      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURP6      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURM7      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_BURTA      WGGNLAAMASEEMETFFPIPAN--YPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCP-
F16PA_PSEP1      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEE4      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEPK      WGGHLAGMASEEMDNAYQIPGR--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEPG      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEPW      WGGHLAGMASEEMDNAYQIPGR--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSESM      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPN
F16PA_PSEU2      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPN
F16PA_PSE14      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPN
F16PA_PSEPF      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPN
F16PA_PSEF5      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDINAPVGTIFSVLRCPN
F16PA_PSEA7      WAGNLAGMASEEMDHPYQIPGR--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEAE      WAGNLAGMASEEMDHPYQIPGR--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPN
F16PA_PSEAB      WAGNLAGMASEEMDHPYQIPGR--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPS
F16PA_PSEMY      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPD
F16PA_PSEU5      WGGHLAGMASEEMDNAYQIPGK--YPKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPD
F16PA_CHRVO      WGGSLAAMASEEMELPYHIPGE--YPKGEYLLMFDPLDGSSNIDVNISVGTIFSILRCPE
F16PA_AROAE      WGGHLAAMASEEVEEVHQIPFD--YPKGGYLLLFDPLDGSSNIDVNISVGTIFSVLRFPE
F16PA_AZOSB      WGGHLAAMASEEVETVHQIPFD--YPKGGYLLLFDPLDGSSNIDVNISVGTIFSVLRFPE
F16A1_DECAR      WGGHLAAMASEEMDLPHLVPHR--FPKGEYLLTFDPLDGSSNIDVNVSIGTIFSVLKCPE
F16PA_XANAC      WGGHLAACASEEMDHSQPVPDQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANC5      WGGHLAACASEEMDHSQPVPDQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANOM      WGGHLAACASEEMDHSQPVPEQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANOP      WGGHLAACASEEMDHSQPVPEQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANOR      WGGHLAACASEEMDHSQPVPEQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANCP      WGGHLAACASEEMDHSQPVPDQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANC8      WGGHLAACASEEMDHSQPVPDQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_XANCB      WGGHLAACASEEMDHSQPVPDQ--YPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPK
F16PA_STRM5      WGGHLAACASEEMDHSQPVPDI--YPRGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRCPT
F16PA_STRMK      WGGHLAACASEEMDHSQPVPDI--YPRGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRCPT
F16PA_SHEB8      ADGTVRGLASEEEDHVVEV-----SQNGQYLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHEB5      ADGTVRGLASEEEDHVVEV-----SKNGQYLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHEB9      ADGTVRGLASEEEDHVVEV-----RQNGQYLVCFDPLDGSSNIDINSLVGTIFSILPAPA
F16PA_SHESR      ADGTVRGLASEEEDHVVEV-----SANGQYLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHESM      VDGTVRGLASEEEDHVVEV-----SANGKYLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHESA      ADGTVRGLASEEEDHVVEV-----CANGQYLVCFDPLDGSSNIDINSLVGTIFSVLPAPQ
F16PA_SHEPC      ADGTVRGLASEEEDHVVEV-----STNGQYLVCFDPLDGSSNIDINSLVGTIFSILPASA
F16PA_SHESW      ADGTVRGLASEEEDHVVEV-----STNGQYLVCFDPLDGSSNIDINSLVGTIFSILPASA
F16PA_SHEON      ADGTVRGLASEEEDHVVEV-----SANGQYLVCFDPLDGSSNIDINSLVGTIFSVLPAPQ
F16PA_SHEHH      ADGTVRGIASEEEDYVVEA-----DANGEFLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHEPA      ADGTVRGIASEEEDYVVEA-----DANGEFLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHESH      GDDTVRGLASEEEDYIVEV-----GDKGEYLVCFDPLDGSSNIDINSLVGTIFSVLPAPT
F16PA_SHEWM      ADNTVRGLASEEEDYIVEV-----GDKGEYLVCFDPLDGSSNIDINSLVGTIFSVLPAPT
F16PA_SHELP      ADSTVRGLASEEEDHIVEV-----GQSGDFLVCFDPLDGSSNIDINSLVGTIFSVLPAPS
F16PA_SHEDO      AAGGVRGLASEEEDFVVEV-----SEQGEFLVCFDPLDGSSNIDINSLVGTIFSVLPAPT
F16PA_SHEFN      ADGNVRGLASEEEDYVVEV-----NAKGEYLVCFDPLDGSSNIDINSLVGTIFSVLPAPA
F16PA_SHEAM      AQGSVKALASEEEDEIVPL-----AQDGQFLVCFDPLDGSSNIDINSLVGTIFSVLPAPS
F16PA_MARMS      SCPSVRAIASEEEDYIVPA-----NTDGEYFIAFDPLDGSSNIDINAMVGTIFSIYRQTG
F16PA_ALTMD      ESGYVKAISSEEEDDVVPC-----DPEGKYLVSFDPLDGSSNTEINSLIGTIFSITHAPQ
F16PA_PSEA6      ESGYVKAISSEEEDDVVAC-----NPNGNYLVSFDPLDGSSNTDINSLIGTIFSITHAPQ
F16A1_PSET1      ESGYVKAIASEEEDYTVAG-----NPDAEYIVAFDPLDGSSNTDINSLVGTIFSVMKAPE
F16PA_COLP3      ESGFVKAISSEEEDHSVAG-----DENGKYIVSFDPLDGSSNIDINSLIGTIFSIHEAPK
F16PA_IDILO      ESPNVHAVASEEEDSIVES-----PNSGHYLVAFDPLDGSSNIDINGGVGTIFSILRKPE
F16PA_CELJU      EEPQVRAIASEEEDTVVAG-----NPKGAYTVAFDPLDGSSNIDINGQIGTIFTIYPARD
F16A2_PSET1      DDNSVRTVASEEEDHAVGA-----NPEGKFIVAFDPLDGSSNIDVNGQIGTIFTIYLARD
F16PA_SACD2      ANSNVLALASEEEDNVVAA-----NAGGRYVVAFDPLDGSSNIDINGQIGTIFTIFEALD
F16PA_HYDCU      ANPYVRGVGSEEEDYTIAG-----NADGKYLVTFDPLDGSSNIDVNLSVGTIFSVLEAQD
F16PA_ACIBC      VHPHVGGLASEELDDFTPA-----QENGEYLVLFDPLDGSSNIDINMCVGTIFSILPAKN
F16PA_ACIBS      VHPHVGGLASEELDDFTPA-----QENGEYLVLFDPLDGSSNIDINMCVGTIFSILPAKN
F16PA_ACIBT      VHPHVGGLASEELDDFTLA-----QENGEYLVLFDPLDGSSNIDINMCVGTIFSILPAKN
F16PA_ACIBY      VHPHVGGLASEELDDFTPA-----QENGEYLVLFDPLDGSSNIDINMCVGTIFSILPAKN
F16PA_ACIAD      VHPHVGGLASEELDEFTPG-----QQDGKYLVLFDPLDGSSNIDINMCVGTIFSILPAKN
F16PA_PSYA2      KNTHCAGVASEELDDAIPA-----NAEGSLLVLFDPLDGSSNIDINMAVGTIFSILPYQH
F16PA_PSYCK      QNSHCAGVASEELDDATPA-----NVDGSLLVLFDPLDGSSNIDINMAVGTIFSILPYQR
F16PA_PSYWF      ANKHCAGVASEELDDATPA-----NESGELLVLFDPLDGSSNIDINMPTGTIFSILPHNN
F16PA_NEIM0      ANPAVAGLASEEEDTFVSA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILEK--
F16PA_NEIMB      ANSAVAGLASEEEDTFVNA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILEK--
F16PA_NEIMF      ANPAVAGLASEEEDSFVSA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILEK--
F16PA_NEIMA      ANPAVAGLASEEEDSFVSA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILEK--
F16PA_NEIG1      ANPAVAGLASEEEDTFVSA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILAK--
F16PA_NEIG2      ANPAVAGLASEEEDTFVSA-----GENGRYLVLFDPLDGSSNIDVNISVGTIFSILAK--
F16PA_POLAQ      GCKSLAGLASEEMELPVPV-----QGTGDYLLLFDPLDGSSNIDVNVSIGTIFSILKKQD
F16PA_POLNS      GCKSLAGLASEEMELPVPV-----QGTGDYLLLFDPLDGSSNIDVNVSIGTIFSVLKKQD
F16PA_CAUVC      ACGPVAGLASEELEEVEPT-----GRVGGYLVTFDPLDGSSNIDVNVSVGTIFSVLPAP-
F16PA_CAUSK      ACGPVAGLASEELEEIETT-----GREGGFLVTFDPLDGSSNIDVNVSVGTIFSILPAP-
F16PA_ALKEH      WGGTVAGMASEEEDDIYTLPEG--EPRGPWLLLFDPLDGSSNIDVNVSVGTIFSVLPAPD
F16PA_NITVU      -KLPIAALASEEMA---DLDIL--NPAAPICVAFDPLDGSSNINTNMSVGTIFSIMPTP-
F16PA_NITWN      -KQPIAALASEEME---ELDIL--NPGAPICVAFDPLDGSSNINTNMSVGTIFSIMPTP-
F16A2_NITHX      -ALPIAVLASEEMA---ELDIL--NPGAPISVAFDPLDGSSNINTNISVGTIFSIMPTP-
F16A1_NITHX      -ALPIAVLASEEMA---ELDIL--NPGAPISVAFDPLDGSSNINTNISVGTIFSIMPTP-
F16PA_BRADU      -KLSIAALASEEMR---EPQIG--DRAARICVAIDPLDGSSNIDINMTVGTIFSILPAP-
F16PA_RHOPB      -KIPYAALASEESE---TLVLG--DPGAPISVAFDPLDGSSNIDTNMTVGTIFSIVPNK-
F16PA_RHOP5      -KLPFAALASEESE---ALVYG--DPMAPISVAFDPLDGSSNIDTNATVGTIFSIIPTI-
F16PA_RHOPA      -DVPYAALASEESD---TLLDG--DPNAPISIAYDPLDGSSNIDTNMTVGTIFSIIPNQ-
F16PA_RHOPT      -DVPYAALASEESD---TLLDG--DPNAPISIAYDPLDGSSNIDTNMTVGTIFSIIPNQ-
F16PA_RHOP2      -NVPYAALASEESD---TLLMG--DPQAPISIAYDPLDGSSNIDTNMTVGTIFSVIPNE-
F16PA_RHOPS      -NVPYAALASEEAE---ALLMG--DPQAPISIAYDPLDGSSNIDTNMTVGTIFSIIPNE-
F16PA_BRASO      -RAPVAGILSEEGD---RPETV--NEAAPLCVAIDPLDGSSNLQNNISVGTIFSIRPRG-
F16A2_BRASB      -KAPVAGILSEEVD---RPETV--NAAAPLCVAIDPLDGSSNLQNNISVGTIFSIRPRG-
F16PA_RHIME      -GAPVACYASEELE---NPVLL--DPSARLAVAIDPLDGSSNIDNNVSIGTIFSVLPAAK
F16PA_SINMW      -GAPVACYASEELE---NPVLL--DPAARLAVAIDPLDGSSNIDNNISIGTIFSVLPAAK
F16PA_XANFL      -AAPVAAVASEEND---APVLL--DPTAPLLVAIDPLDGSSNIDTDISVGTIFAVFPRPE
F16A1_XANP2      -KAPVAAVASEEND---APVLL--DPEAPLLVAIDPLDGSSNIDTDISVGTIFAVFPHQD
F16A2_CERSP      -GSAVAYYASEEQD---EVVTL--GE-GSLALAIDPLDGSSNIDVNVSIGTIFSIFPAAA
F16A2_CERS4      -GSAVAYYASEEQD---EVVTL--GE-GSLALAIDPLDGSSNIDVNVSIGTIFSIFPAAA
F16A2_RHOS1      -GSAVAYYASEEQD---EVVTL--GE-GSLALAIDPLDGSSNIDVNVSIGTIFSIFPAAA
F16A2_CERS5      -GSAVAHYASEEQD---EVVTL--GE-GALALAIDPLDGSSNIDVNVSIGTIFSIFPAAE
F16PA_RHOCB      -GTAVAYYASEEQD---EVVTL--GK-GTLALAIDPLDGSSNIDVNVSIGTIFSIFPATD
F16A1_RHOS1      -GSAVRFYASEEQD---TAVTL--NEAGTLALAIDPLDGSSNIDTNLSVGTIFAIWPAAA
F16A1_CERS4      -GSAVRFYASEEQD---TAVTL--NEAGTLALAIDPLDGSSNIDTNLSVGTIFAIWPAAA
F16A1_CERSP      -GSAVRFYASEEQD---TAVTL--NEAGTLALAIDPLDGSSNIDTNLSVGTTFAIWPAAP
F16A1_CERS5      -GSAVRFYASEEQE---EAVTL--NEAGTLALAIDPLDGSSNIDTNLSVGTIFAIWPAAA
F16PA_PARDP      -GAGVRWLASEEQE---QAVAL--DPEGTLAVAIDPLDGSSNIDTNVSIGTIFSIYPAEA
F16A1_BRASB      -PTPVRWYASEERP---TAEML--NPEGTLALAIDPLDGSSNIDVNISIGTIFSVFEAKE
F16PA_METEP      -EAPVAQVASEEAE---DVVTL--KAGAPLAVAIDPLDGSSNIGVGMVVGTIFGIRPVTP
F16PA_METPB      -EAPVAQVASEEAE---DVVSL--KPGAPLAVAIDPLDGSSNIGVGMVVGTIFGIRPVTL
F16PA_METRJ      -GAPVAEVASEEAE---EVMRL--NPDAPLAVAIDPLDGSSNIGVNMAVGMIFGIRPSIK
F16PA_AZOC5      -RAPVAFLASEESE---TPIPL--DPHGRVVVAVDPLDGSSNIDTNVSIGTIFSILPYDL
F16A2_XANP2      -PTPTAFLASEESE---ELIPL--NPDGRLVIAVDPLDGSSNIDTNVSVGTIYSILPYDA
F16PA_ACICJ      -ASGAAAFASEEAA---APEWL--DPVGEVAVAVDPLDGSSNIDTLAPVGTIFSILPARH
F16PA_BRUC2      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUSU      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUAB      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUO2      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUA2      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUA1      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUSI      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUME      -AAGVASILSEEAD---LPVAG--KADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADV
F16PA_BRUA4      -AAGAASILSEEAD---LPVAG--KADGLIAVAIDPLDGSGNVGLGAPLGTIFSIFPADT
F16A3_PSET1      KNKQVRAVASEEVEDIILC-----NSFGKYLICFDPLDGSSNTDVNGSLGTIFSITSASA
F16PA_ECOLI      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHIFL      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHIBS      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOK1      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOUT      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOL5      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHIF8      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHIB3      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECODH      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOSM      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOLC      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOL6      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECO24      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECOHS      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHIDS      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECO57      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ECO5E      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SHISS      ARDIVAGIASEEEDEIVVFEG---CEYAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_CITK8      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALTY      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALPA      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALCH      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALEP      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALDC      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALA4      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALPK      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALSV      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALHS      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALNS      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALPB      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALTI      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALG2      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SALAR      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ENT38      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_KLEP3      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_KLEP7      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_CROS8      ARDIVAGIASEEEDEIVVFEG---CEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ERWT9      ARGIVAGIASEEEDEIVIFEG---VENGKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SODGM      ARGQVAGIASEEEDEIVVFEG---VENGKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPN      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPA      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPE      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPS      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPB      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPY      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPG      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERP3      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERPP      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_YERE8      ARGEVAGIASEEEDDIVIFDGGR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_SERP5      ARGEVAGIASEEEDEIVIFDGER-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_PHOLL      ARGEVAGIASEEEDDIVIFEGDR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_PROMH      ARGEVAGIGSEEEDDIVIFEGDR-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYHR--
F16PA_PECAS      ARGEVAGIASEEEDEIVIFEGDK-AENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBCH      ARDQVCGVASEEEDEAVAFSKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBC3      ARDQVCGVASEEEDEAVAFNKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBVU      ARDQVCGVASEEEDEAVAFNKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBVY      ARDQVCGVASEEEDEAVAFNKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBPA      ARDQVCGVASEEEDEAVAFNKEL-NQNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_VIBCB      ARDQVCGVASEEEDEAVAFNKEL-NQNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ALIFM      ARDQVCGVASEEEDEAVAFNKEL-NQNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ALIF1      ARDQVCGVASEEEDEAVAFNKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ALISL      NRDQVCGVASEEEDEAVAFNKEL-NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_PHOPR      ARDQVCGVASEEEDEAVTFNKDL-NRNAKYVILMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_AERS4      ARGEVCGIASEEEEDFVSFDSEL-SRHSKYVVLIDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_AERHH      ARGEVCGMASEEEEDFVSFDSEL-SRHSKYVVLIDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_HAHCH      QRGVVCGIASEEEEQFVRFEETK-NLGGKYVVLIDPLDGSSNIDVNVSVGTIFSVYRR--
F16PA_PSYIN      ARGEVCGVASEEEDEFVSFNDQR-CINSKYVVLMDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_HAEIE      AREEVAGFASEEEESFIAFDTER-GRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_HAEI8      AREEVAGFASEEEESFIAFDTER-GRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_HAEIN      AREEVAGFASEEEESFIAFDTER-GRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_HAES1      TREEVAGFASEEEENFVAFDTER-GRNAKYVILTDPLDGSSNIDVNVAVGTIFSIYRR--
F16PA_HISS2      TREEVAGFASEEEENFVAFDTER-GRNAKYVILTDPLDGSSNIDVNVAVGTIFSIYRR--
F16PA_PASMU      SREEVAGFASEEEENFVAFDTER-GRNAKYVILTDPLDGSSNIDVNVAVGTIFSIYRR--
F16PA_MANSM      AREEVAGFASEEEENFVAFDTER-GRNARYVILTDPLDGSSNIDVNVSVGTIFSIYRR--
F16PA_ACTSZ      AREEVAGFASEEEDDFVAFDTER-GRNARYIILTDPLDGSSNIDVNVAVGTIFSIYRR--
F16PA_ACTP7      AREEVAGFASEEDDNFVAFENDR-AKNAKYILMTDPLDGSSNIDVNVSVGTIFSIYKR--
F16PA_ACTPJ      AREEVAGFASEEDDNFVAFENDR-AKNAKYILMTDPLDGSSNIDVNVSVGTIFSIYKR--
F16PA_ACTP2      AREEVAGFASEEDDNFVAFENDR-AKNAKYILMTDPLDGSSNIDVNVSVGTIFSIYKR--
F16PA_HAEDU      AREDVAGFASEEDDNFIAFDSER-NRNAKYILMTDPLDGSSNIDVNVSVGTIFSIYKR--
F16PA_DICNV      SRDDIAGFASEEEEEFTAFDTER-GHNAKYIILMDPLDGSSNIDVNVSVGSIFSIYHR--
F16PA_FLAJ1      NREIVCGIASEENDDFITVQGSDNCHNNKYVILMDPLDGSSNIDVNVSVGTIFSVFRR--
F16PA_FLAPJ      NREIVCGIASEENDDFITVAGSDNSHNNKYVVLMDPLDGSSNIDVNVSVGTIFSVFRR--
F16A2_GRAFK      NREIVCGIASEENDDFIQIEGHKGDHQNKYVVLMDPLDGSSNIDVNVSVGTIFSIYQR--
F16A1_GRAFK      NRGEICGLASEELEDYLVFD-EEMHKNAEYIVLIDPLDGSSNIDVDITVGTIFSIYRR--
F16PA_WIGBR      THYNIAGIASEEEAKFISFKQ---EKYGKYIFLIDPLDGSLSADCNTPVGTIFSLYCR--
F16PA_CYTH3      SGGQCCAIASEENTDIIPIENNG-HSKSNYVVLIDPLDGSSNIDVNVAIGSIFSIYRR--
F16PA_CHLPM      QHGRFAIMGSEENEEIITPPNNE---NGSYALLFDPLDGSSNIDVNVSVGTIFSIYKI--
F16PA_CHLL3      QHGRFAIMGSEENEGIIIPPKNE---TGSYALLFDPLDGSSNIDVNVSVGTIFSIYRI--
F16PA_CHLPD      QHGRFAIMGSEENDGIIIPPKNE---TGSYALLFDPLDGSSNIDVNVSVGTIFSIYKL--
F16PA_PELPB      QHGRFAIMGSEENEGVIIPPKNE---SGNYALLFDPLDGSSNIDVNVSVGTIFSIYKL--
F16PA_CHLL2      QHGRFAVMGSEENDGIIIPPKNE---TGNYALLFDPLDGSSNIDVNVSVGTIFSIYRL--
F16PA_CHLCH      AHGRFAVMGSEENEEIIIPTNNE---SGNYVLLFDPLDGSSNIDVNVSVGTIFSIYKL--
F16PA_PROA2      EHGRFALMGSEENEGTIIPPNND---TGRYILLFDPLDGSSNIDVNVSVGTIFSIYRL--
F16PA_CHLPB      QHGRFALMGSEENEGTIIPPKNE---SGKYVLLFDPLDGSSNIDVNVSVGTIFSIYRL--
F16PA_CHLTE      QHGRFAIMGSEENEEIIKPPKFE---SGEYVLLFDPLDGSSNIDVNVSVGTIFSIYRL--
F16PA_CHLP8      QHGRFAIMGSEENEETITPPKFE---SGEYVLLFDPLDGSSNIDVNVSVGTIFSIYRL--
F16PA_CHLT3      HHGRFAVMASEENEDIILPPLDK---YGKYVLLFDPLDGSSNIDANVSVGTIFSIFKR--
F16A2_SALRD      RGGECCLIGSEEHAEAIPLSTVSKEGDGKYIVLLDPLDGSSNIDVNVSVGTIFSIYRLP-
F16A1_SALRD      RGGECCLVGSEEQADTISLSPRG-DFQERFAVFFDPLDGSSNTDVNASVGTIFSVYTLP-
F16PA_NOSS1      QSGLVCRLASEEMDEPYYIPENC--PIGRYTLLYDPIDGSSNTDTNLSLGSIFSIRQQE-
F16PA_TRIV2      QSGLVCRLASEEMDEPYYIPENC--PVGRYTLLYDPIDGSSNTDTNLSLGSIFSIRQQE-
F16PA_NOSP7      QSGLVCRLASEEMENPYYIPENC--PIGRYTLLYDPIDGSSNTDNNLSLGSIFAIRQQE-
F16PA_MICAN      QSGLVCRLASEEMDKPYYIPENC--PIGRYTLLYDPIDGSSNVDINLNVGSIFAIRQQE-
F16PA_CROS5      QSGLVCRLASEEMDKPYYIPENC--PIGRYTLLYDPIDGSSNVDINLNVGSIFAIRQQK-
F16PA_SYNY3      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPIDGSSNVDINLNVGSIFAIRQQE-
F16PA_SYNP2      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPIDGSSNVDINLNVGSIFSIRQQE-
F16A1_ACAM1      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPIDGSSNVDVNLNVGSIFSIRQQV-
F16PA_TRIEI      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPLDGSSNLDTNLNVGSIFSVRQQE-
F16PA_THEEB      QSGLVCRLASEEMAQPYYIPENC--PIGRYTLLYDPLDGSSNVDINLNVGSIFAIRQQE-
F16PA_SYNE7      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPLDGSANVDVDLNVGSIFAVRRQE-
F16PA_SYNP6      QSGLVCRLASEEMEKPYYIPENC--PIGRYTLLYDPLDGSANVDVDLNVGSIFAVRRQE-
F16PA_SYNJA      QTGLVCRLVSEELKTPARLPENC--SLSRLALLIDPLDGSSNIDANLSVGSIFSVLHPL-
F16PA_SYNJB      QTGLVCRLVSEEMKTPARLPENC--SLSRLALMIDPLDGSSNIDANLSVGSIFSVLHPL-
F16PA_GLOVI      NTNLVCLLVSEELEDPLPLSNQC--PIGSYALVIDPVDGSSNIDVNVSVASIFSVQRR--
F16PA_DESVH      RSGAVCAMASEENADIIKVPEKL--HRGDYVLIFDPLDGSSNIDVNINVGTIFSILRRK-
F16PA_DESVV      RSGAVCAMASEENADIIKVPEKL--HRGDYVLIFDPLDGSSNIDVNINVGTIFSILRRK-
F16PA_DESAG      RTGVLCAMASEENADLIRVPERF--EAGDYILIFDPLDGSSNIDVNINVGTIFSILKRKP
F16PA_LAWIP      RSGVLCAMASEEHAELIKVSAAF--PRGDYILIFDPLDGSSNIDVNINVGTIFSILRRK-
F16PA_LEPIN      RSGHLCILGSEEHEETVPVPNGY--KIGKYTIAIDPLDGSSNIDANVSIGTIFSVHLRK-
F16PA_LEPIC      RSGHLCILGSEEHEETVPVPNGY--KIGKYTIAIDPLDGSSNIDANVSIGTIFSVHLRK-
F16PA_LEPBL      RSGHLCILGSEEHEETVSVPSGY--KIGKYTIAIDPLDGSSNIDANVSIGTIFSVHLRK-
F16PA_LEPBJ      RSGHLCILGSEEHEETVSVPSGY--KIGKYTIAIDPLDGSSNIDANVSIGTIFSVHLRK-
F16PA_LEPBP      ICGHLCVLASEEHEDIIPIPGGY--NIGKYTMAIDPLDGSSNIDTNVSIGTIFSIHQRL-
F16PA_LEPBA      ICGHLCVLASEEHEDIIPIPGGY--NIGKYTMAIDPLDGSSNIDTNVSIGTIFSIHQRL-
F16PA_SORC5      RRGHCAAVVSEELGEMRLLSTD---PRAKYIVVVDPLDGSSNIDVNISIGTIFGVLRKS-
F16PA_SULSY      QSGEFFALASEELDEPI-FPEEG--KDAKYVIAFDPLDGSSNIDVNISIGTIFSIHRRV-
F16A2_ACAM1      NIGLVAVIASEELDQVKLIECGQ---QAQYILCTDPLDGSSNTDTGSAVGTIFGIYRR--
F16PA_AMOA5      ATHEVCAVISEEADSVVPLRN----KNARYIVALDPLDGSSNINVNSPIGTLFSIYQR--
F16PA_SYNAS      ASNRVIQVVSEESDDIVDMNKD----GGRYFVYFDPLDGSSNVAHGLPVGFLFGIAKRNL
F16PA_GEOBB      HSGVVCNIASEEMDEIYQCQASA---DGLYSVAYDPLDGSSLVDVNLAVGTIVSIYAG--
F16PA_GEOUR      HSGVVCNIASEEMDEIYQVTTDS---NGLYSVAYDPLDGSSLVDVNLAVGTIVSIFSG--
F16PA_GEOMG      HSGVVCNIASEEMDEIFQAQADA---DGLYSVAYDPLDGSSLVDVNLAVGTIVSIYEG--
F16PA_GEOSL      HSGVVCNIASEEMDEIFQAQADA---DGLYSVAYDPLDGSSLVDVNLAVGTIVSIYEG--
F16PA_PELPD      HSGVVCNIASEEMEEIFQVTSNP---QGMFSVAYDPLDGSSLVDVNLAVGTIVGIYQG--
F16PA_GEOLS      YSGVVCNIASEEMDEIFQVTSNP---LGMFSVAYDPLDGSSLVDVNLAVGTIVGIYQG--
F16PA_PELCD      KSGVVSNIVSEETNDIVFVAPHR---TGNYSVSYDPLDGSSLVDVNLAVGTIVSIYKG--
F16PA_METLZ      ESGLVRSIASEEQEDITEMSPS-----AKYSVVMDPLDGSSLIKVNLTVGTIVGIYE---
F16PA_METHJ      ESGLVRELASEEQADIIRFENSR----CEYCMVMDPLDGSSLISTNLAVGTIVGIYEN--
F16PA_METB6      KSRLVRYIATEEQDHVIEVSGAK----NQFGVVIDPLDGSSLLDVNLCVGSIIGIYP---
F16PA_HELPY      SLENIKSVFSEEKETPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGIYEK--
F16PA_HELPS      SLENVKSVFSEEKETPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGVYEK--
F16PA_HELPG      SLENIKSVFSEEKETPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGVYEK--
F16PA_HELPH      SLENIKSVFSEEKETPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGIYEK--
F16PA_HELPJ      SLENVKSVFSEEKETPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGVYEK--
F16PA_HELAH      SLENVKSVFSEEKEKPVTKE------NGSYLIAYDPLDGSSVMEANFLVGTIIGIYEK--
F16PA_CAMC5      ALSCVKALVSEEKDEILPIN-----TNGKFIIAYDPLDGSSLVDVNFAVGSIFGIYEN--
F16PA_CAMC1      QLSCVKALISEEKEDELEIN-----KNAKFIIAYDPLDGSSLVDVNFAVGSIFGIYED--
F16PA_CAMHC      KISSVKSLVSEEKEDELVLN-----ENAKFIIAYDPLDGSSLVDVNFAVGSIFGIYEN--
F16PA_CAMFF      GVSSVRSLVSEEKEDALDIH-----KDGEFIIAYDPLDGSSLVDVNFAVGSIFGVYKN--
F16PA_CAMJJ      QCSSIKAIISEEKDEILTLN-----EKANFIVAYDPLDGSSLMDVNFAIGSIFAIYEE--
F16PA_CAMJ8      QCSSIKAIISEEKDEILTLN-----ERANFIVAYDPLDGSSLMDVNFAIGSIFAIYEE--
F16PA_CAMJE      QCSSIKAIISEEKDEILTLN-----ERANFIVAYDPLDGSSLMDVNFAIGSIFAIYEE--
F16PA_CAMJR      QCSSIKAIISEEKDEILTLN-----ERANFIVAYDPLDGSSLMDVNFAIGSIFAIYEE--
F16PA_CAMJD      QCSSIKAIISEEKDEILTLN-----EKAKLIVAYDPLDGSSLMDVNFAIGSIFAIYEE--
F16PA_ARCB4      NIPSIKAIVSEEQEAIVNLH-----ENGKYLIAYDPLDGSSLVDVNLSVGSIFGIYEN--
F16PA_SULDN      HVTSIHTIASEEKEREVILH-----KDGRYFIAYDPLDGSSLIDVNLSVGSIFGIYEG--
F16PA_NITSB      KTSSVRVLASEEKSEPITIN-----ERGKYLVGYDPLDGSSLVDVNLSVGSIFGIYEN--
F16PA_SULNB      SVSLVKDLISEEKEGVMPLH-----SNGKYTICYDPLDGSSLADVNLSVGSIFGIYDG--
F16PA_WOLSU      KIPSIKGLCSEEKEGCLILN-----PEGRYMIAYDPLDGSSLVEVNMSVGTIFGIYEG--
F16PA_HELHP      NLPCVKAICSEEQEEIMYSEN----KNAPYIIAYDPLDGSSLIDSNLSIGTIFGIYNE--
F16PA_HALSA      SIEGVNWYASEERDAVVTVGD----AEGGYAVALDPLDGSSNVKSNNPCGTVVGIYDQ--
F16PA_HALS3      SIEGVNWYASEERDAVVTVGD----AEGGYAVALDPLDGSSNVKSNNPCGTVVGIYDQ--
F16PA_NATPD      DVDAVGSYASEERESVIEADE----G-GRYHVAADPLDGSSNLKSNNTMGTLFGVYEE--
F16PA_HALWD      SLDGIGEYASEERS---SADD----TGSGLSVCIDPLDGSSNLKSNAAMGTIAAVYDA--
F16A1_HALMA      GIDGVASYASEERA---DVKT----TDGRLHVAMDPLDGSSNLEPNSGMGTIFGIYSE--
F16A2_HALMA      YIDGIGAYASEERS---DVVD----CGEGYSIAIDPLDGSSNLASNNSVGTIIGVYDA--
                          :**                   .  **:***         .    :     

F16A2_CUPNH      GAS------------AVTEQDFLQPGSAQVAAGYALYGPTTMLVLTV-----GNG-----
F16A3_CUPNH      GAD------------TVTEQDFLQPGSAQVAAGYALYGPTTMLVLTV-----GNG-----
F16A2_CUPTR      GTA------------DVTEQAFLQPGTAQVAAGYALYGPTTMLVLTV-----GNG-----
F16A2_CUPMC      DVVASG--------RDVTEADFLQPGAAQVAAGYTIYGPTTQLVLTV-----GNG-----
F16A2_LEPCP      DVIDSG--------RDVTEADFLQPGAAQVAAGYALYGPTTMLMLTV-----GNG-----
F16A2_POLNA      EAVESG--------RDVVEADFFQPGAEQVAAGYALYGPTTMLVLSV-----GNG-----
F16A1_RHOFT      DALDSG--------RDLNEADFLQAGRQQVAAGYAVYGPSTLLVLTV-----GNG-----
F16PA_HYDTE      GKT------------EITVDDFLQPGTQQVAAGYAIYGPTTMLVLTV-----GRG-----
F16A3_METPP      PRQ------------DPQPQDYLQPGTTMVCGGYAIYGPSTMLVLTL-----GDG-----
F16PA_RHORT      PGE------------APQTADFLQSGRQQVAAGYALYGPSTMFVLTI-----GSG-----
F16A2_DECAR      A-------------GDAELGDYLRPGSEQVAAGYAIYGPSTMMVLTL-----GNG-----
F16A2_PARXL      GNGNANEKNGSDPRGTVGESAFLRPGCEQVAAGYAVYGPSTMLVLSV-----GNG-----
F16PA_METI4      SG------------EPLEEKHFLRPGREQLAAGFTLYGPSVMFILTL-----GNG-----
F16PA_MAGSA      GA------------NAGSKDAFLQPGVKQVAAGYALYGSSTMLVLTT-----GNG-----
F16PA_METFK      GS--------------VDEASFLQAGSRQLAAGYALYGTSTMLVLTM-----GHG-----
F16A1_METPP      RG------------TPASAAAFMQPGRRQVAAGYAIYGPSTVLVLSL-----GQG-----
F16PA_NITEC      ----PGQAAS--------MEDFLQPGTKQVCAGYALYGSSTMLVLTT-----GHG-----
F16PA_NITEU      ----PSRAAS--------MEDFLQPGVKQVCAGYALYGSSTMLVLTT-----GHG-----
F16PA_THIDA      ----AGRAAK--------AEDFLQAGTKQVCAGYAIYGSSTMLVLTF-----GHG-----
F16PA_NITOC      ----DVSEPT--------QEDFLQPGTQQVCAGFCVYGPTTMMVLTA-----GHG-----
F16PA_ACIF5      ----AGRDAE--------LADFLQPGVEQVCAGYALYGSSNMLVYST-----GYG-----
F16PA_HALHL      ----GSENPS--------AGDFLQHGTEQVAAGYCLYGPSTILVLAVK----GQG-----
F16PA_DELAS      --PEGHPGVT--------EQDFMQPGTQQVAAGYCIYGPQTTLVLTV-----GDG-----
F16PA_ACISJ      DDPTTDEPVT--------EADFLQPGHQQVAAGYCIYGPQTTLVLTV-----GDG-----
F16PA_POLSJ      --PDDHAGVE--------EKDFLQPGNKQVAAGYCVYGPQTTLVLTV-----GDG-----
F16PA_ACIAC      --PEGHPGVT--------TEDFLQAGSSQVAAGYCIYGPQTTLVLTV-----GDG-----
F16A1_POLNA      --SEDDRGVE--------ESDFLQAGNQQVAAGYCVYGPQTTLVLTV-----GDG-----
F16PA_VEREI      --PDGERRVE--------ETDFLQPGTRQVAAGYCIYGPQTMLALTV-----GAG-----
F16A2_RHOFT      --PDGQ-GVL--------EQDFLQPGNQQVAAGYCVFGPQTTLVLTV-----GDG-----
F16A1_LEPCP      --VGHQHGVS--------EEDFLQPGKFQAAAGYCVYGPQTTLVLTV-----GDG-----
F16A2_METPP      --QSDTPGVS--------TQDFLQPGSAQVAAGYCVYGPQTTLVLTV-----GDG-----
F16A1_CUPTR      --PKPGQTVT--------EADFLQPGTHQVAAGYAVYGPQTTLVLTV-----GNG-----
F16A1_CUPNH      --PKPGQTVT--------EADFMQPGTHQVAAGYAVYGPQTTLVLTV-----GNG-----
F16PA_CUPPJ      --PKPGQTVT--------EADFLQPGTHQVAAGYAVYGPQTTLVLTV-----GNG-----
F16A1_CUPMC      --HKPGQTVT--------EHDFMQPGTQQVAAGYAVYGPQTTLVLTV-----GNG-----
F16PA_RALSO      --PKPGQTVT--------EADFMQPGVRQVAAGYAVYGPQTTLVLTV-----GNG-----
F16PA_RALPJ      --PKAGEAVT--------EADFMQPGSKQVAAGYAVYGPQTTLVLTV-----GNG-----
F16PA_BORBR      --PHRVAGAD------VCEQDFLQPGSQQVAAGYAVYGPQTMLVLTI-----GNG-----
F16PA_BORPA      --PHRVAGAD------VCEQDFLQPGSQQVAAGYAVYGPQTMLVLTI-----GNG-----
F16PA_BORPE      --PHRVAGAD------VCEQDFLQPGSQQVAAGYAVYGPQTMLVLTI-----GNG-----
F16PA_BORPD      --PHRVAGAEE-----VCEQDFLQPGSQQVAAGYAVYGPQTMLVLTI-----GTG-----
F16PA_BORA1      --PHHVSGAE------VSEADFLQPGRDQVAAGYAVYGPQTMLVLTI-----GQG-----
F16PA_JANMA      --ADGMQAPT--------EADFLQPGSKQVVAGYAVYGPQTVLVLTT-----GNG-----
F16PA_HERAR      --ADGMQAAK--------EADFLQAGSKQVVAGYAVYGPQTVLVLTT-----GNG-----
F16PA_HERSE      --PEGMTEPT--------EQDFMQPGTRQVAAGYAVYGPQTVLVLTT-----GDG-----
F16PA_PARL1      --PEDVSGRA------VTEADFLQPGRKQVAAGYAIYGPQTLLILSV-----GTG-----
F16A1_PARXL      ----DGQQPT--------EQSFLQPGTQQVAAGYAVYGPQTVLVLTT-----GNG-----
F16PA_PARPJ      ----DGQQPT--------EQSFLQPGTQQVAAGYAVYGPQTVLVLTT-----GNG-----
F16A1_PARP8      ----DGQQPT--------EQSFLQKGTQQVAAGYAVYGPQTVLVLTT-----GNG-----
F16PA_BURCA      ----DGKQAT--------EESFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURCH      ----DGKQAT--------EESFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURCC      ----DGKQAT--------EESFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURCJ      ----DGKQAT--------EESFLQPGTQQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURL3      ----DGKQAT--------EESFLQPGTQQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURM1      ----DGKQAT--------EESFLQPGTQQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURA4      ----DGKQAT--------EESFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURCM      ----DGKQAT--------EESFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURVG      ----HGKQAT--------EESFLQPGTEQVAAGYAVYGPQSVFVLTT-----GNG-----
F16PA_BURM9      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURMS      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURPS      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURMA      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURP1      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURP0      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURP6      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURM7      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_BURTA      ----DGQQAT--------EQSFLQPGTEQVAAGYAVYGPQTVFVLTT-----GNG-----
F16PA_PSEP1      QYLSQNESLN--------EEAFLQPGTEQVAAGYAIYGPQTMLILTL-----GNG-----
F16PA_PSEE4      QYLSQNESLN--------EAAFLQPGTEQVAAGYAIYGPQTMLILTL-----GNG-----
F16PA_PSEPK      QYLSQNESLN--------EEAFLQPGTEQVAAGYAIYGPQTMLILTL-----GNG-----
F16PA_PSEPG      QYLSQNESLN--------EEAFLQPGTEQVAAGYAIYGPQTMLILTL-----GNG-----
F16PA_PSEPW      EYLSQNETLN--------ENAFLQPGTEQVAAGYAIYGPQTMLILTL-----GNG-----
F16PA_PSESM      EYLSQNEALN--------EKAFLQPGTEQVAAGYAIYGPQTMLVLTL-----GDG-----
F16PA_PSEU2      EYLSQNEALN--------EKAFLQPGTEQVAAGYAIYGPQTMLVLTL-----GDG-----
F16PA_PSE14      EYLSQNEALN--------EKAFLQPGTEQVAAGYAIYGPQTMLVLTL-----GDG-----
F16PA_PSEPF      EYLSQNEALD--------EKAFLQPGTQQVAAGYAIYGPQTMLVLTL-----GHG-----
F16PA_PSEF5      EYLSQNEALN--------EKAFLQPGTQQVAAGYAIYGPQTMLVLTL-----GDG-----
F16PA_PSEA7      EYLNQNDTLR--------EEAFLQPGTTQVAAGYAIYGPQTMLMLTL-----GNG-----
F16PA_PSEAE      EYLNQNDTLR--------EEAFLQPGTTQVAAGYAIYGPQTMLMLTL-----GNG-----
F16PA_PSEAB      EYLNQNDTLR--------EEAFLQPGTTQVAAGYAIYGPQTMLMLTL-----GNG-----
F16PA_PSEMY      RN-GDTGDLG--------EDAFLQPGTQQVAAGYAIYGPQTMLMLTL-----GDG-----
F16PA_PSEU5      ACFSQNDALG--------EEAFLQPGTKQVAAGYAIYGPQTMLVLTL-----GHG-----
F16PA_CHRVO      ----GVTQPT--------ETDFLQPGTHQVAAGYTVYGPQTMLVLTF-----GSG-----
F16PA_AROAE      G----IQEPN--------EQCFLQPGREQVAAGYALYGPSTLLILTV-----GNG-----
F16PA_AZOSB      G----EAEPT--------EQSFMQPGREQVAAGYAVYGPSTQLVLTV-----GHG-----
F16A1_DECAR      GADLSTPEAA--------EQAFLQPGTAQVAAGYAVYGPTTLLVLTV-----GDG-----
F16PA_XANAC      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANC5      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANOM      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANOP      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANOR      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANCP      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANC8      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_XANCB      ----GTEKPG--------DEHFLQPGTQQVAAGYCIYGPSTMLVLTL-----GHG-----
F16PA_STRM5      ----NVELPG--------DDAFLQPGSKQIAAGYCIYGPSTQLVLTV-----GHG-----
F16PA_STRMK      ----NVELPG--------DDAFLQPGSKQIAAGYCIYGPSTQLVLTV-----GHG-----
F16PA_SHEB8      GE-------------LTETS-FLQSGRAQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEB5      GE-------------LTETS-FLQSGRAQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEB9      GE-------------LTETS-FLQSGRAQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHESR      GE-------------LTETS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHESM      GE-------------LTETS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHESA      GE-------------LTETS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEPC      GE-------------LTETS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHESW      GE-------------LTETS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEON      GE-------------LTEAS-FLQSGRNQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEHH      GE-------------LTEKS-FLQAGHNQVAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEPA      GE-------------LTEKS-FLQAGRNQVAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHESH      GE-------------LSESS-FLQAGRQQVAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEWM      GE-------------LTESS-FLQAGRKQVAAGYVLYGPSTMLALTT-----GKG-----
F16PA_SHELP      GE-------------LSEQS-FLQPGRQQVAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEDO      GP-------------LTEQS-FLQSGRKQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_SHEFN      GE-------------LNEQS-FLQAGRKQVAAGYVLYGPSTMMALTT-----GQG-----
F16PA_SHEAM      GD-------------VSEQS-FLQPGRKQLAAGYVLYGPSTMLALTT-----GQG-----
F16PA_MARMS      DKP------------ATEAD-FLIPGKEQVAAGYVLYGPSTMLVLTT-----GDG-----
F16PA_ALTMD      WMK------------PDDPSAFLQPGTQMVAAGYVLYGPSTMLALTT-----GRG-----
F16PA_PSEA6      WMD------------ADDPSAFLQPGTQIVAAGYVLYGPSAMLALST-----GRG-----
F16A1_PSET1      GAD------------PADQSIFMQPGINQVAAGYVLYGPSTILALTT-----GKG-----
F16PA_COLP3      DIA------------AGDDDMFKQAGDKQVCAGYVLYGPSTMLVMTT-----GSG-----
F16PA_IDILO      GEE-------------TSENMFLQPGKAQVAAGYVLYGPATMLVMTT-----GKA-----
F16PA_CELJU      DVP------------ADSEAQFQQPGHQQVCAGYVLYGPSTILVMTT-----GGP-----
F16A2_PSET1      DVP------------YDSDEQFNQLGANQVCAGYVLYGPSSLLVMST-----GGP-----
F16PA_SACD2      GVA------------ANSGKHFLQQGNKQVCAGYVLYGASTLMVITV-----DGP-----
F16PA_HYDCU      DQS------------GDNQEVFLQNGRKQVAAGYVLYGPSSLLVMTT-----GNG-----
F16PA_ACIBC      A--------------VTQAQDFMQAGTQQVAAGYVLYGPSTMMALTV-----GNG-----
F16PA_ACIBS      A--------------VTQAQDFMQAGTQQVAAGYVLYGPSTMMALTV-----GNG-----
F16PA_ACIBT      A--------------VTQAQDFMQAGTQQVAAGYVLYGPSTMMALTV-----GNG-----
F16PA_ACIBY      A--------------ITQAQDFMQAGTQQVAAGYVLYGPSTMMALTV-----GNG-----
F16PA_ACIAD      S--------------ITQTQDFMQAGTEQVAAGYVLYGPSTMMALTC-----GEG-----
F16PA_PSYA2      QGK------------VSENSDFLQAGNQQLAAGYLLYGTSTVLALTI-----TDN-----
F16PA_PSYCK      QGQ------------VSENSDFLQAGNQQLAAGYLLYGTSTVLTLTI-----TDN-----
F16PA_PSYWF      KGQ------------AAQNADFLQKGTEQLAAGYLLYGSSAMLAFTL-----SESLDANN
F16PA_NEIM0      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_NEIMB      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_NEIMF      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_NEIMA      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_NEIG1      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_NEIG2      PEG------------ALATESFLQTGRQQLAAGYVLYGPQTQLVFTF-----GHG-----
F16PA_POLAQ      PQA------------PLQTADFLLSGRHQVAAGYVVYGPQTTMALTL-----GDG-----
F16PA_POLNS      PAA------------PLQTSDFLLSGRHQVAAGYVVYGPQTTMALTL-----GDG-----
F16PA_CAUVC      AGH------------APTEGDFLQPGRNQVAAGYAVYGPQTMLVVTL-----SGG-----
F16PA_CAUSK      ATG------------IPTEADFLQPGRQQVAAGYAVYGPQTMLVLTL-----SKG-----
F16PA_ALKEH      TGR------------DPVNEDLLQPGHRQVAAGYAVYGPSTVLVLTL-----GDG-----
F16PA_NITVU      -SDVN--------------AAFRQAGSAQLAAGFVVYGPQTSLVLTL-----GRG-----
F16PA_NITWN      -SDVN--------------AAFRQAGSEQLAAGFVVYGPQTSLVLTL-----GQG-----
F16A2_NITHX      -PDAS--------------AAFTQPGSAQLAAGFVVYGPQTSLILTL-----GQG-----
F16A1_NITHX      -PDAS--------------AAFTQPGSAQLAAGFVVYGPQTSLILTL-----GQG-----
F16PA_BRADU      -DDLA--------------LAFHQRGSAQFAAGFVTYGPQTSLVLTL-----GDG-----
F16PA_RHOPB      -QGE---------------APFSAPGNVQLAAGFVVYGPQTSLVLTL-----GNG-----
F16PA_RHOP5      -VGV---------------APFTAPGKVQLAAGFVVYGPQTSLVLTT-----GDG-----
F16PA_RHOPA      -PGV---------------KPFTAAGSCQIAAGFVVYGPQTSLVLTL-----GDG-----
F16PA_RHOPT      -PGV---------------KPFTAAGSCQIAAGFVVYGPQTSLVLTL-----GDG-----
F16PA_RHOP2      -PGV---------------APFTAPGSCQLAAGFVVYGPQTSLVLTL-----GDG-----
F16PA_RHOPS      -PGV---------------APFTAPGSCQLAAGFVVYGPQTSFVLTL-----GDG-----
F16PA_BRASO      -RDVL--------------SSFFEPGTAQRAAGFFVYGPQTCLVLAI-----DRR-----
F16A2_BRASB      -RDVL--------------SSFFEPGTAQRAAGFFVYGPQTCLVLAI-----DHR-----
F16PA_RHIME      GPDVDP------------SQSFLQPGNRQLAAGFFIYGPQTALVLSL-----GKG-----
F16PA_SINMW      GPDVDP------------SQSFLQPGNRQLAAGFFVYGPQTALVLSL-----GRG-----
F16PA_XANFL      GADASE------------PSAFLQNGRDMLAAGYVIYGPHTAMMLTL-----GAG-----
F16A1_XANP2      GTDAAS------------VTAFLQNGRDMLAGGYVIYGPHTALMLTV-----GAG-----
F16A2_CERSP      GPEA----------------SFLRPGTEQIAGGYIIYGPQCALVCSF-----GQG-----
F16A2_CERS4      GPEA----------------SFLRPGTEQIAGGYIIYGPQCALVCSF-----GQG-----
F16A2_RHOS1      GPEA----------------SFLRPGTEQIAGGYIIYGPQCALVCSF-----GQG-----
F16A2_CERS5      SPEA----------------SFLRLGTEQIAAGYIIYGPQCALVCSF-----GRG-----
F16PA_RHOCB      DPNT----------------SFLRKGSEQIAGGYIIYGPQCALVCSF-----GRG-----
F16A1_RHOS1      TAEA----------------SFLRQGSELIAAGYVIYGPQVCMMVSF-----GKG-----
F16A1_CERS4      TAEA----------------SFLRLGSELIAAGYVIYGPQVCMMVSF-----GKG-----
F16A1_CERSP      RPNP----------------SFLRLGSELIAAGYVIYGPQVCMMVSF-----GKG-----
F16A1_CERS5      TAET----------------SFLRPGSDLIAGGYIIYGPQVCLMVSF-----GQG-----
F16PA_PARDP      TAEA----------------SFLRPARQQIGAGYIIYGPRCAMMVTF-----GDG-----
F16A1_BRASB      SGVE----------------SFLRPGREQIAAGYVVYGPQTVFILAT-----RTT-----
F16PA_METEP      G-EDPN-------------ASFLTPGTTQTAAGFVVYGPATTFVVTL-----GNG-----
F16PA_METPB      G-TDVN-------------ASFLTPGTTQTAAGFVVYGPATTFVVTL-----GNG-----
F16PA_METRJ      DPANPL-------------ASFTTPGSTQIAAGFVTYGPATALILTL-----GEG-----
F16PA_AZOC5      EQHPDP------------AAALLQPGSAQIAAGFLVYGPATILVSSL-----GQG-----
F16A2_XANP2      AVHTDP------------VSAVMRPGVNQVASGFLAYGPATILVATF-----GEG-----
F16PA_ACICJ      ASGADP------------ASPFLQTGRRQLAAGFFIYGPRTALAVTF-----GNG-----
F16PA_BRUC2      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUSU      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUAB      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUO2      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUA2      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUA1      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUSI      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUME      ------------------EEPFLQPGNRQIAAGYVSYGNSVDLGFSV-----GEG-----
F16PA_BRUA4      ------------------AEPFLQPGNRQIAAGYVSFGNSVDLGFSV-----GEG-----
F16A3_PSET1      AQTEVS------------EEDFFSTGRSIIAAGYVLYGPSLMLALST-----GSG-----
F16PA_ECOLI      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SHIFL      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SHIBS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOK1      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOUT      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOL5      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SHIF8      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SHIB3      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECODH      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOSM      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOLC      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOL6      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECO24      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECOHS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SHIDS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ECO57      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYSTG---CGVHA----
F16PA_ECO5E      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYSTG---CGVHA----
F16PA_SHISS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_CITK8      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALTY      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALPA      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALCH      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALEP      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALDC      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALA4      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALPK      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALSV      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALHS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALNS      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALPB      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALTI      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLIYTTG---CGVHA----
F16PA_SALG2      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_SALAR      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ENT38      ---------VTPVGTAVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_KLEP3      ---------VTPVGTPVTEEDFLQPGNRQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_KLEP7      ---------VTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_CROS8      ---------VTPVGTPVTMEDFLQPGSQQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_ERWT9      ---------ITPAGTPVTEEDFLQPGSQQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_SODGM      ---------ITPLGTPVTKEDFLQPGNKQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_YERPN      ---------ITPFGTPITEEDFLQPGTKQVTAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPA      ---------ITPFGTPITEEDFLQPGTKQVTAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPE      ---------ITPFGTPITEEDFLQPGTKQVTAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPS      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPB      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPY      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPG      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERP3      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERPP      ---------ITPFGTPITEEDFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_YERE8      ---------ITPFGTPITEADFLQPGTKQVAAGYVVYGSSTMLVYTTG---YGVHT----
F16PA_SERP5      ---------ITPVGIPVTEEDFLQPGSAQVAAGYVVYGSSTMLVYTTG---YGVHA----
F16PA_PHOLL      ---------ITPIGQPVTEKDFLQPGHRQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_PROMH      ---------ITPIGQPVTLDDFLQPGNRQVAAGYVVYGSSTMLVYTTG---CGVHA----
F16PA_PECAS      ---------ITPLGTSVTEADFLQPGSQQVAAGYIVYGSSTMLVYTTG---HGVHA----
F16PA_VIBCH      ---------VSPVGTPPTQEDFLQPGNKQVAAGYVIYGSSTMLVYTTG---NGVNG----
F16PA_VIBC3      ---------VSPVGTPPTQEDFLQPGNKQVAAGYVIYGSSTMLVYTTG---NGVNG----
F16PA_VIBVU      ---------VSPIGTPPTQEDFLQPGHKQVAAGYIIYGSSTMLVYTTG---NGVNG----
F16PA_VIBVY      ---------VSPIGTPPTQEDFLQPGHKQVAAGYIIYGSSTMLVYTTG---NGVNG----
F16PA_VIBPA      ---------VSPIGTPATEEDFLQPGHKQVAAGYVIYGSSTMLVYTTG---NGVNG----
F16PA_VIBCB      ---------VSPIGTPPTEEDFLQPGHKQVAAGYVIYGSSTMLVYTTG---NGVNG----
F16PA_ALIFM      ---------ISPIGTPATEEDFLQPGHKQVAAGYIIYGSSTMLVYTTG---NGVHG----
F16PA_ALIF1      ---------ISPIGTPATEEDFLQPGHKQVAAGYIIYGSSTMLVYTTG---NGVHG----
F16PA_ALISL      ---------ISPIGSPATEEDFLQPGNKQVAAGYIIYGSSTMLVYTTG---NGVHG----
F16PA_PHOPR      ---------VSPIGTTPTQDDFLQPGNQQVAAGYVIYGSSTMLVYTTG---NGIHG----
F16PA_AERS4      ---------LSAPGTGVTLEDFLQPGNRQVAAGYVVYGSSTMLVYTTG---FGVNG----
F16PA_AERHH      ---------VSKPGAGVTLEDFLQPGNRQVAAGYVVYGSSTMLVYTTG---FGVNG----
F16PA_HAHCH      ---------VSPEGEHVTEEDFLQPGHKQIAAGYIIYGSSTMLVYTTG---NGVNG----
F16PA_PSYIN      ---------ISEPGKPAILEDFLQPGTEQVAAGYVIYGSSTMLVYTTG---YGTHG----
F16PA_HAEIE      ---------VSPIGSPVTLEDFMQPGNKQVAAGYIVYGSSTMLVYTTG---HGVNG----
F16PA_HAEI8      ---------VSPIGSPVTLEDFMQPGNKQVASGYIVYGSSTMLVYTTG---HGVNG----
F16PA_HAEIN      ---------VSPIGSPVTLEDFMQPGNKQVAAGYIVYGSSTMLVYTTG---NGVNG----
F16PA_HAES1      ---------VSPIGTPVTLEDFLQPGHKQVAAGYIVYGSSTMLVYTTG---NGVNG----
F16PA_HISS2      ---------VSPIGTPVTLEDFLQPGHKQVAAGYIVYGSSTMLVYTTG---NGVNG----
F16PA_PASMU      ---------VSPIGTPVTLADFMQPGNRQVAAGYIVYGSSTMLVYTTG---NGVNG----
F16PA_MANSM      ---------VSPIGSPVTLEDFMQPGNRQVAAGYVVYGSSTMLVYTTG---NGVNG----
F16PA_ACTSZ      ---------ISPVGTPVTLEDFMQPGHKQVAAGYVVYGSSTMLVYTTG---NGVNG----
F16PA_ACTP7      ---------VSPIGSPVTMEDFLQEGRKQVASGYVTYGSSTMLVYTTG---NGVNG----
F16PA_ACTPJ      ---------VSPIGSPVTMEDFLQEGRKQVASGYVTYGSSTMLVYTTG---NGVNG----
F16PA_ACTP2      ---------VSPIGSPVTMEDFLQEGRKQVASGYVTYGSSTMLVYTTG---NGVNG----
F16PA_HAEDU      ---------ISPIGSPVTIEDFLQEGRKQVAAGYVTYGSSTMLVYTTG---NGVNG----
F16PA_DICNV      ---------VTPIGTPVTLEDFLQPGHKQIAAGYIIYGSSTMLVFTTG---NGVNG----
F16PA_FLAJ1      ---------ITPIGTPVTSEDFLQPGINQVAAGYVIYGTSTMLVYTTG---FGVNG----
F16PA_FLAPJ      ---------ITPVGTPVTIEDFLQPGINQVAAGYVIYGTSTMLVYTTG---DGVNG----
F16A2_GRAFK      ---------VTPVGTPVQKEDFLQPGNKQVAAGYIIYGTSTMLVYTTG---HGVNG----
F16A1_GRAFK      ---------ISKKGTPATLEDFLQPGINQVAAGYLIYGTSTILVYTTG---NGVNG----
F16PA_WIGBR      ---------VTPIGVEISEKDFLQPGNKQILSGYILYGSSTILVFTVK---SGVHI----
F16PA_CYTH3      ---------VSESG-PGETVDCMQVGNKQVAAGYIIYGSSTMMVYTTG---DGVNG----
F16PA_CHLPM      ---------KNSDPRKADISDCLQKGSEQVAAGYVIYGSSVVMVYTTG---NGVHG----
F16PA_CHLL3      ---------KSSDPGNASISDCLQKGSEQVAAGYVIYGSSVVMVYTTG---HGVHG----
F16PA_CHLPD      ---------KGDDPGKASLNDCLQHGYEQVAAGYVIYGSSVVMVYTTG---HGVHG----
F16PA_PELPB      ---------KGDDPGKASLSDCLQHGYEQVAAGYVIYGSSVVMVYTTG---HGVHG----
F16PA_CHLL2      ---------KGDDPGKASISDCLQQGSEQVAAGYVIYGSSVVMVYTTG---NGVHG----
F16PA_CHLCH      ---------KTSDPAKASLADCLQAGSEQVAAGYVIYGSSVVMVYTTG---HGVHG----
F16PA_PROA2      ---------TGDDPKEADINDCLQKGSEQVAAGYVIYGSSVMMVYTTG---QGVHG----
F16PA_CHLPB      ---------TGDDPSKADINDCLQKGSQQVAAGYVIYGSSVVMVYTTG---HGVHG----
F16PA_CHLTE      ---------KSGEPSQASLEDCLQKGADQIAAGYVIYGSSVMMVYTTG---HGVHG----
F16PA_CHLP8      ---------KSDNPSQASIEDCLQKGADQVAAGYVIYGSSVMLVYTTG---HGVHG----
F16PA_CHLT3      ---------KSDAGGPGTLEDCLQKGAEQVASGYVIYGSSVMLVYTTG---QGVHG----
F16A2_SALRD      ---------DGYEEEEPDPAAALQPGTEQVAAGYVVYGSSTMLVYTTG---NGVNG----
F16A1_SALRD      ---------EGADEGD-ALDVALRPGAEQVAAGYVAYGSSTMFVFTTG---NGVNG----
F16PA_NOSS1      -----------GDDSDGQAKDLLTNGRKQIAAGYILYGPSTMLVYTMG---TGVHS----
F16PA_TRIV2      -----------GDDSDGQAKDLLTNGRKQIAAGYILYGPSTMLVYTMG---KGVHS----
F16PA_NOSP7      -----------GTDSDGKATDLLANGRKQLAAGYILYGPCTMLVYTIG---KGVHS----
F16PA_MICAN      -----------DNDLDGEARDLLQNGRKQIAAGYILYGPSTILVYSIG---RGVHA----
F16PA_CROS5      -----------EDDLDGEGNDLLKDGREQIAAGYIVYGPSTMLVYSIG---HGVHS----
F16PA_SYNY3      -----------GDDLDGSASDLLANGDKQIAAGYILYGPSTILVYSLG---SGVHS----
F16PA_SYNP2      -----------GMDLDGDAADLLQNGHKQIAAGYILYGPSTMLVYSIG---TGVHS----
F16A1_ACAM1      -----------GNDPDHTGQDLLQDGHQQIAAGYILYGPSTVLVYSIG---KGVHV----
F16PA_TRIEI      -----------GNDENGLAQDLLQNGHKQIAAGYILYGPSTMLVYSIG---QGVHA----
F16PA_THEEB      -----------GTDLDSTAADLLQDGHQQIAAGYILYGPSTMLVYSLG---KGTHV----
F16PA_SYNE7      -----------FYDESHEAKDLLQPGDRQIAAGYVLYGASTLLVYSMG---QGVHV----
F16PA_SYNP6      -----------FYDESHEAKDLLQPGDRQIAAGYVLYGASTLLVYSMG---QGVHV----
F16PA_SYNJA      -----------EDRPEADNQDLLQPGRRQLAAGYILYGPSTQLVYSVG---KGVHS----
F16PA_SYNJB      -----------EDRPEADNQDLLQPGRRQLAAGYILYGPSTQLVYSVG---KGVHG----
F16PA_GLOVI      -----------NPRATDETSSLLQKGTGQVAAGYVLYGPNTMFVYTSS---QGVHG----
F16PA_DESVH      ----------SPASDDVCIDDVLQPGYEQVAAGYILYGPSTMLVFSTG---QGVHG----
F16PA_DESVV      ----------SPASDDVCIDDVLQPGYEQVAAGYILYGPSTMLVFSTG---QGVHG----
F16PA_DESAG      ---------GASGSKDVTLGDVLQSGVEQVAAGYFLYGPSTMLVYSSG---QGVHG----
F16PA_LAWIP      ----------PGKTGDVELDEVLQPGSEQIAAGYFLYGTSTMLVYTAG---QGVHG----
F16PA_LEPIN      ---------SP-AGTPGTLSDLLQQGSGQRAAGYVLYGSSTMLILCTG---KGVSG----
F16PA_LEPIC      ---------SP-AGTPGTLSDLLQQGSGQRAAGYVLYGSSTMLILCTG---KGVSG----
F16PA_LEPBL      ---------SP-ADTPGTLSDLLQKGSGQRAAGYVLYGSSTMLVLCTG---KGVSG----
F16PA_LEPBJ      ---------SP-ADTPGTLSDLLQKGSGQRAAGYVLYGSSTMLVLCTG---KGVSG----
F16PA_LEPBP      ---------EPNSKEPGNERDLLQKGHLQRCAGYIIYGSSTMLVLSTG---KGVSG----
F16PA_LEPBA      ---------EPNSKEPGNERDLLQKGHLQRCAGYIIYGSSTMLVLSTG---KGVSG----
F16PA_SORC5      -----------DAKMGADPSDFLRPGRDLVAAGYVLYGSSTLLVITTGL--GGVHG----
F16PA_SULSY      ---------------NSDVSDFLQEGYKQVAAGYVIYGSSTMLVLSTG---NGVNG----
F16A2_ACAM1      ----------QTSGYCSTEADVLQPGTELVTAGYVLYGTSTMLVYTTG---GRVDG----
F16PA_AMOA5      ---------ISPSETPIQDADVLIPGKQQLAAGYMLYSTVNTLVYATI---YGVHG----
F16PA_SYNAS      DGNMK-----------GPEDFHLREGNDYIAAGMFVI-PTGMFTLALRD--AGCWR----
F16PA_GEOBB      -------------------CDLLQPGRNQVAAMYILYGPRVSLVYTVGDGV---------
F16PA_GEOUR      -------------------CDLLQEGRKQVAAMYILYGPRVSLVYTVGDGV---------
F16PA_GEOMG      -------------------CNLLQKGRNQVAALYILYGPRVSMVYSVGRGV---------
F16PA_GEOSL      -------------------CNLLQKGRNQVAAMYILYGPRVSLVYSVGKGV---------
F16PA_PELPD      -------------------SDLLQPGRHMVGAMYILYGPRVSMVYSVGKGV---------
F16PA_GEOLS      -------------------DNLLQPGRNMVGAMYILYGPRVSMVYSVGKGV---------
F16PA_PELCD      -------------------SDLMQPGNKQAAALYILYGPRTTLVYTTGNGV---------
F16PA_METLZ      -------------------GDVLQAGNKLRAAFYMLYGPLTTLTISLGNGV---------
F16PA_METHJ      -------------------GGVLQPGSKLRAAFYTLFGPLTVLVVSVGKGV---------
F16PA_METB6      -------------------GHVLEKGTKMIAALYMLYGPLTLLTFTTKHGV---------
F16PA_HELPY      --------------------DYKA--QNLAASLYVVFGHKIELVVALE------------
F16PA_HELPS      --------------------DYKA--QNLAASLYVVFGHKIELVVALE------------
F16PA_HELPG      --------------------DYKA--QNLVASLYVVFGHKIELVVALE------------
F16PA_HELPH      --------------------DYKA--QNLVASLYVVFGHKIELMVALE------------
F16PA_HELPJ      --------------------DYKA--QNLVASLYVVFGHKIELVVALE------------
F16PA_HELAH      --------------------DYKA--HNLAASLYVVFGHKIELVVALD------------
F16PA_CAMC5      --------------------ELKP--QNLIAAAYSIYGPRLELVINDKK-----------
F16PA_CAMC1      --------------------EVKP--ENLIAAAYSIYGPRLELVIAEKK-----------
F16PA_CAMHC      --------------------EIKA--ENLKAAAYIIYGPRLEMVFTD-------------
F16PA_CAMFF      --------------------ELKP--SNLVAAIYCIYGPRLEMVVCE-------------
F16PA_CAMJJ      --------------------KASA--KNLRAALYSMYGARLELVICK-------------
F16PA_CAMJ8      --------------------KASA--KNLRAALYSMYGARLELVICK-------------
F16PA_CAMJE      --------------------KASA--KNLRAALYSMYGARLELVICK-------------
F16PA_CAMJR      --------------------KANA--KNLRAALYSMYGARLELVICK-------------
F16PA_CAMJD      --------------------KASA--KKLRAALYSMYGARLELVICK-------------
F16PA_ARCB4      --------------------EFNA--QNIVASVYVVFGPRVEMVVTTT------------
F16PA_SULDN      --------------------AFGA--KNMVASCYVVFGPRVEMVFAHN------------
F16PA_NITSB      --------------------DFHG--NSLKAAVYVVYGPRVEMVISTI------------
F16PA_SULNB      --------------------EPKG--ENLVASAYVVYGPRIEIIRAVKG-----------
F16PA_WOLSU      --------------------EFGA--KNLIASAYIVYGPGIELVIAHE------------
F16PA_HELHP      --------------------ELSA--KHLIASGYIIYGPRLEMVVAQE------------
F16PA_HALSA      --------------------PLPAPGSSLVAAGFVLYGPTTTMVVAR-------------
F16PA_HALS3      --------------------PLPAPGSSLVAAGFVLYGPTTTMVVAR-------------
F16PA_NATPD      --------------------PLPAAGDALVAAGYVLYGPITTLITAR-------------
F16PA_HALWD      --------------------PLPARGSDLVAAAYVLYGATTTMIAAV-------------
F16A1_HALMA      --------------------QPPTVGTNLLAAGFVIYGPITSMVVAR-------------
F16A2_HALMA      --------------------ELPAAGREMVASLMVLYGPYTTLTIARS------------
                                                .          :                 

F16A2_CUPNH      --VNGFTLDPNL----GEFFLTHPNLQVPADTQEFAINASNSRFWEAPVQRYIAECMAGK
F16A3_CUPNH      --VNGFTLDPNL----GEFFLTHPHLRVPPDTQEFAINASNSRFWEAPVQRYIGECMAGK
F16A2_CUPTR      --VNGFTLDPNL----GEFFLTHPDLRVPADTREFAINASNSRFWEAPIRQYVSECLAGQ
F16A2_CUPMC      --VAAFTLDPNL----GEFLLTRSDIRVPEQTQEFAINSSNSRFWEPPVKRYVDECLAGK
F16A2_LEPCP      --VAGFTLNPTL----GEFMLTHANVTVPADTREFAINASNARFWEPPVKRYVDECLAGA
F16A2_POLNA      --VAGFTLDPML----GEFMLTHDKLQVPENTQEFAINASNSRFWEPPVKRYVDECLAGK
F16A1_RHOFT      --VNGFTLDPNL----GEFMLTHPKMQIPPETHEFAINASNSRFWQAPVKRYVDECLAGQ
F16PA_HYDTE      --VVGFTLDPDF----GEFMLTHPNIRIPESTKEFAINTSNARFWEPPVKRYVDECLKGK
F16A3_METPP      --THAFTLDPQL----GEWVLSHPNLRIPEKTREFAINASNSRFWEPAVKRYVDECLAGS
F16PA_RHORT      --VHGFTLDPLL----GDFILTHPSMTVIPESGEFAINSSNSRFWEPPIRAYVDELLAGR
F16A2_DECAR      --THGFTLDRES----GNFILTHANIRVPEDTREFAINTSNERFWEPPVQRYVSECKAGK
F16A2_PARXL      --THGFTLEREI----GNFVLTHSNIRIPEDTVEFAINASNERFWEPPVRRYVQECKDGR
F16PA_METI4      --VHGFTLDREV----GIFTLTHPDMRITPSTKEFAINASNERFWEPPVRRYVEECIKGK
F16PA_MAGSA      --VNGFTLDNNV----GMFLLTHPNMTIPADTKEFAINASRERFWEPPVKRYIDECRQGK
F16PA_METFK      --VHGFTLDPDQ----GEFYLTHPGLTIAASTEEFAINMSNQRFWQPPVQRYIAECIAGS
F16A1_METPP      --VHMFTLDPDAPGDAARWVLTRADVEVPVSTTEFAINASNQRFWEKPVQRYVAECLAGQ
F16PA_NITEC      --VNGFTLDRDI----GEFVLTHPGMKIPADTREFAINASNQRFWEEPVQRYVSECLAGS
F16PA_NITEU      --VNGFTLDRDI----GEFVLTHPNMRIPADTREFAINASNQRFWEAPVQRYVAECLAGS
F16PA_THIDA      --TNGFTLDRDV----GEFVLTHPAMKIPTETKEFAINASNMRFWEKPVQRYVDECLAGK
F16PA_NITOC      --VNGFTLDQDI----GEFILTHPNMTIPEDTMEFAINMSNQRFWAAPVQRYIEDCLQGK
F16PA_ACIF5      --VNGFTLDPSI----GEYILTHNQMRIPEDTSEYAINMSNHRHWQKPVQRYIDELNQGT
F16PA_HALHL      --VQMFTLNRDF----GEFILTRKDVQIPEDTQEFAINVSNQRHWEEPVQRYIDECLQGK
F16PA_DELAS      --VSMFTLDREQ----GSFVLVQENIRIPEDTKEFAINMSNMRHWDTPVKRYVDECLAGV
F16PA_ACISJ      --VAMFTLDREQ----GSFVLTRENIRIPEDTKEFAINMSNMRHWDAPVRRYIDECLQGK
F16PA_POLSJ      --VAMFTLDREQ----GSFVLIEENVRIPEDTKEFAINMSNMRHWDAPVKRYIDECLQGT
F16PA_ACIAC      --VAMFTLDREQ----GSFVLVEENVKIPADTREFAINMSNMRHWDAPVKRYIDECLAGT
F16A1_POLNA      --VAMFTLDREQ----GSFVLTEENVTIPDDTQEFAINMSNMRHWDEPVKRYINECLEGK
F16PA_VEREI      --VALFTLDREQ----GSFVLTQENLRIPEETREFAINMSNMRHWAAPVKRYIDECLQGR
F16A2_RHOFT      --VAMFTLDREQ----GSFILTAENMRVPVDTQEFAVNMSNQRHWDTPVKRYIDECLQGK
F16A1_LEPCP      --VAVFTLDRET----GSFVLTQSNLQIPADTHEFAINASNHRHWAPPMKRYIDECLAGR
F16A2_METPP      --VAMFTLDREQ----GSWVLTTDEVRIPEDTREFAVNMSNQRHWAPPMQRYIDECLQGK
F16A1_CUPTR      --VHMFTLDREA----GSFVLTQSNVTIPEDTKEFAINMSNMRHWAPPVRKYIDECLAGD
F16A1_CUPNH      --VHMFTLDREA----GSFVLTHSNVTIPDDTKEFAINMSNMRHWAPPVRRYIDECLAGE
F16PA_CUPPJ      --VHVFTLDREA----GSFVLTQSDVQIPEDTKEFAINMSNMRHWAPPVRKYIDECLAGD
F16A1_CUPMC      --VHMFTLDREA----GSFVLTQSDVMIPEDTKEFAINMSNMRHWAPPVRRYIDECLAGD
F16PA_RALSO      --VHMFTLDREV----GSFILTNRDVKIPADTKEFAINMSNMRHWAPPVRRYIDECLAGT
F16PA_RALPJ      --VHMFTLDREV----GSFVLTHRDVKIPVDTKEFAINMSNMRHWAPPVRRYIDECLAGT
F16PA_BORBR      --VVGFTLDREM----GSWVLTHESMRIPEDTKEFAINMSNMRHWAPPVKRYIDECLAGK
F16PA_BORPA      --VVGFTLDREM----GSWVLTHESMRIPEDTKEFAINMSNMRHWAPPVKRYIDECLAGK
F16PA_BORPE      --VVGFTLDREM----GSWVLTHESMRIPEDTKEFAINMSNMRHWAPPVKRYIDECLAGK
F16PA_BORPD      --VVGFTLDREM----GSWVLTHENMRVPEDTKEFAINMSNMRHWAPPVRRYIDECLAGT
F16PA_BORA1      --VVGFTLDREM----GSWVLTHEKISIPADTKEFAINMSNMRHWDAPVKRYIDECLAGK
F16PA_JANMA      --VQCFTLDREM----GSWVMTQRDMQIPANTKEFAINASNARHWHPPVKRYVDEMLAGT
F16PA_HERAR      --VQCFTLDREM----GSWVMTQKNMQIPADTKEFAINASNARHWYPPVKRYVDEMLAGT
F16PA_HERSE      --VHCFTLDREM----GAWVLTQKDIKIPEDTKEFAINASNQRHWFPPVKRYVDEMLAGS
F16PA_PARL1      --VYEFALDREM----GSWVLTNERIRIPSGNREFAINMSNMRHWAPPVRRYIDECLAGT
F16A1_PARXL      --VNCFTLDREL----GSWVLTQSDMRIPVETREYAINASNERHWYPPVQQYIGELKDGK
F16PA_PARPJ      --VNCFTLDREL----GSWVLTQSDMRIPVETREYAINASNERHWYPPVEQYIGELKAGK
F16A1_PARP8      --VNCFTLDREL----GSWVLTQSDMRIPVETREYAINASNQRHWYEPVQQYIGELNAGK
F16PA_BURCA      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURCH      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURCC      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURCJ      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURL3      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURM1      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYDPVKRYVDELNAGK
F16PA_BURA4      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYEPVQRYVDELNAGK
F16PA_BURCM      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYEPVQRYVDELNAGK
F16PA_BURVG      --VNCFTLDREV----GSWVLTQSNMQIPADTREYAINASNARHWYEPVQRYVSELNAGK
F16PA_BURM9      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURMS      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURPS      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURMA      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURP1      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURP0      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURP6      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURM7      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYEPVKRYIDELNAGA
F16PA_BURTA      --VNCFTLDREV----GSWVLTQSNLRIPEDTREYAINASNARHWYDPVKRYVDELNAGA
F16PA_PSEP1      --VKGFTLDREL----GSFVLTHENIRVPETTAEFAINMSNQRHWEAPVQRYVGELLAGE
F16PA_PSEE4      --VKGFTLDREL----GSFVLTHENIRVPETTAEFAINMSNQRHWEAPVQRYVGELLAGE
F16PA_PSEPK      --VKGFTLDREL----GSFVLTHENIRVPETTAEFAINMSNQRHWEAPVQRYVGELLAGE
F16PA_PSEPG      --VKGFTLDREL----GSFVLTHENIQVPATTAEFAINMSNQRHWEAPVQRYVGELLAGE
F16PA_PSEPW      --VKGFTLDREL----GSFVLTHENIQVPATTAEFAINMSNQRHWEAPVQRYVGELLAGE
F16PA_PSESM      --VKGFTLDREM----GSFVLTHEDITIPETTQEFAVNMSNQRHWEAPVQRYVSELLAGE
F16PA_PSEU2      --VKGFTLDREM----GSFVLTHEDITIPESTQEFAVNMSNQRHWEAPVQRYVSELLAGE
F16PA_PSE14      --VKGFTLDREM----GSFVLTHEDIKIPESTQEFAINMSNQRHWEAPVQRYVNELLAGE
F16PA_PSEPF      --VKGFTLDREM----GSFVLTHEDITIPESTQEFAINMSNQRHWEAPVQRYVSELLAGE
F16PA_PSEF5      --VKGFTLDREM----GSFVLTHEDIKIPESTQEFAINMSNERHWEAPVKRYVEELLAGD
F16PA_PSEA7      --VKGFTLDREL----GSFVLTHDNISVPESTAEFAINMSNQRHWEAPVKRYVEELLAGK
F16PA_PSEAE      --VKGFTLDREL----GSFVLTHDNISVPESTAEFAINMSNQRHWEAPVKRYVEELLAGK
F16PA_PSEAB      --VKGFTLDREL----GSFVLTHDNISVPESTAEFAINMSNQRHWEAPVKRYVEELLAGK
F16PA_PSEMY      --VKGFTLDREL----GSFVLTHDNIKVPESTKEFAINMSNQRHWEAPVQRYVSELLAGE
F16PA_PSEU5      --VMGFTLDREL----GSFVLTHENLCVPQSTAEFAINMSNQRHWEAPVQRYVGELLAGK
F16PA_CHRVO      --VHGFTLDREH----GSFVLTHPDMKVPERTAEFAINMSNMRHWEAPVRRYVEEMLAGK
F16PA_AROAE      --VHGFTLDREM----GSFVYTHPFMTVPVDTQEYAINASNARHWEPPVQRYVAELQQGR
F16PA_AZOSB      --VHAFTLDREM----GSFIYTHPFMTIPDDTHEFAINASNARFWEEPVQRYVGELQAGK
F16A1_DECAR      --VAVFTLDREQ----GQFILTLENVQIPADTKEFAINMSNQRFWEAPVQRYVAEMQVGK
F16PA_XANAC      --THAFTLEREE----GSFLLTQANMRVPEDTAEYAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANC5      --THAFTLEREE----GSFLLTQANMRVPEDTAEYAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANOM      --THAFTLEREE----GSFLLTQANMRVPDETAEYAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANOP      --THAFTLEREE----GSFLLTQANMRVPDETAEYAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANOR      --THAFTLEREE----GSFLLTQANMRVPDETAEYAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANCP      --THAFTLEREE----GSFLLTQADMRVPEDTAEFAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANC8      --THAFTLEREE----GSFLLTQADMRVPEDTAEFAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_XANCB      --THAFTLEREE----GSFLLTQADMRVPEDTAEFAINMSNQRHWEPAMQAYVGDLLAGK
F16PA_STRM5      --THAFTLDREK----GEFVLTTENMQIPAATQEFAINMSNQRHWEAPMQAYVGDLLAGK
F16PA_STRMK      --THAFTLDREK----GEFVLTTENMQIPAATQEFAINMSNQRHWEAPMQAYVGDLLAGK
F16PA_SHEB8      --VQLFTLHPET----NEFLLTNAAMSISPDTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEB5      --VQLFTLHPET----NEFLLTNAAMSISPETQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEB9      --VQLFTLDPET----NEFLLTNAAMSISPETQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHESR      --VQLFTLHPET----NEFLLTNAAMSISPDTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHESM      --VQLFTLHPET----NEFLLTNAAMSISPDTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHESA      --VQLFTLHPET----NEFLLTNAAMSISPDTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEPC      --VQLFTLHPET----NEFLLTNAAMSISADTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHESW      --VQLFTLHPET----NEFLLTNAAMSISADTQEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEON      --VQLFTLHPET----NEFLLTNATMSISPDTSEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEHH      --VQLFTLNPET----NQFLLTNAAMAVSKDTGEFAINMSNQRFWEAPMQTYISDLLLGK
F16PA_SHEPA      --VQLFTLNPET----NEFLLTNGAMAISKDTGEFAINMSNQRFWEAPMQTYISDLLLGK
F16PA_SHESH      --VQLFTLNPET----NEYLLTTEAMSISKDTGEFAINMSNQRFWEAPMQTYISDLLLGT
F16PA_SHEWM      --VQLFTLNPET----NEYLLTTEAMSISKDTGEFAINMSNQRFWEAPMQTYISDLLLGT
F16PA_SHELP      --VQLFTLNPET----NEYLLTNEAMSISKDTSEFAINMSNQRFWEAPMQTYIADLLLGK
F16PA_SHEDO      --TQLFTLNPDT----QEFLLTDAAMAISPDTGEFAINMSNQRFWEAPMQTYIADLLLGD
F16PA_SHEFN      --TQFYTLAPDS----QEFLLTDDSVQITPDTAEFAINMSNQRFWEAPMQTYIADLLLGE
F16PA_SHEAM      --VQLFTLDPVS----GDYLLTVDGVQISKDTGEFAINMSNQRFWEPGMQAYIADLIQGK
F16PA_MARMS      --VNMFTYDPTK----RVFTLTHEKVQVAKDTQEFAINMSNQRFWSANMQSYVNDLVKGK
F16PA_ALTMD      --THIYTLDKTH----GGFLLTHPNIQVPEQTSEFSINASNQRHWEPAMQAYIADLLAGK
F16PA_PSEA6      --THLYTLDKTH----GGFLLTQKNIQVPAQTSEFAINASNQRHWEDPVQNYIGDLIAGE
F16A1_PSET1      --TRFFTLDKTH----GTFLLTQDFAKIPADTNEYAINASNQRHWQPAMQNYINDLVAGD
F16PA_COLP3      --THFYVLDRTH----GGFLLVERNVQVPADTQEFAVNMSNQRFWQAPMQNYISDLLAGD
F16PA_IDILO      --VRIYTLDQTV----GEFLLTHEKAEIPKDTKEFAINMSNRRHWADPIRAYISDLLEGE
F16PA_CELJU      --TRGYTLDATH----GSYLLTQAQLSVPLNTQEFALNMANQRFWSAPFQRYVQDLLLGE
F16A2_PSET1      --TRCYTLDSTH----GGYLLTNNQLSVPEQSSEFAVNMANYRYWDEPTQVYFDKLLY--
F16PA_SACD2      --TSCLTLDPAT----QTFSLTNTALQVPDQTQEFAVNLANERFWLPKFKSYVADLKLGE
F16PA_HYDCU      --VNLFTLDTNI----GEFVLTKEALQIPEDTAEFAINMSNQRFWEPEMKQYIDDCLLGE
F16PA_ACIBC      --VAFFTLDPET----QTFLLTTENVQVSADTQEFAINASNQRHWEQPVKQYIEELLAGK
F16PA_ACIBS      --VAFFTLDPET----QTFLLTTENVQVSADTQEFAINASNQRHWEQPVKQYIEELLAGK
F16PA_ACIBT      --VAFFTLDPET----QTFLLTTENVQVSADTQEFAINASNQRHWEQPVKQYIEELLAGK
F16PA_ACIBY      --VAFFTLDPVT----QTFLLTTENVQVSADTQEFAINASNQRHWEQPVKQYIEELLAGK
F16PA_ACIAD      --VAFFTFDPES----QTFILTSDAIQLDADTQEFAINASNQRHWEEPVKRYIDELLAGK
F16PA_PSYA2      --VVMFSLDPDT----NDYVLIEENVTVDADTSEYAINASNYRYWRAPMQQYIDELIAGE
F16PA_PSYCK      --VVMFSLDPDT----NDYVLIEENVTIDADTSEYAINASNYRYWRAPMQQYIDELIAGE
F16PA_PSYWF      EGVVMFSLNPST----GEFELVKNNITIDADTKEYAINASNARHWLPPMQQYINELLAGS
F16PA_NEIM0      --VYMFTLN-AE----NEFVLTKEKPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGE
F16PA_NEIMB      --VYMFTLN-AE----NEFVLTKENPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGE
F16PA_NEIMF      --VYMFTLN-AE----NEFVLTKEKPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGE
F16PA_NEIMA      --VYMFTLN-AE----NEFVLTKEKPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGE
F16PA_NEIG1      --VYVFTLN-AE----NEFVLTKENPKVPESTKEFAINMSNRRHWLPPVQQYVDELLAGE
F16PA_NEIG2      --VYVFTLN-AE----NEFVLTKENPKVPESTKEFAINMSNRRHWLPPVQQYVDELLAGE
F16PA_POLAQ      --VVMFTLNKVT----GEFLLIKDAVTIAHSTKEFAINMSNMRHWADPVKRYVEECLAGV
F16PA_POLNS      --VVMFTLNKVT----GEFLLIKDSVTISHSTKEFAINMSNMRHWADPVRRYVEECLAGV
F16PA_CAUVC      --VNGFTLS-AD----GRWLLTHPDLAIKPDTAEFAINMSNQRHWAPAVRRYIDGCLQGK
F16PA_CAUSK      --VAGFTLD-AD----GAWRLTHGDVAIPADTAEFAINMSNQRHWAQPVRRYIDGCLQGK
F16PA_ALKEH      --VYAFTLDRGQ----GEWFLTSSKMKVPEQTAEFAINCSYQRIWPAPIKRYIEECLDGE
F16PA_NITVU      --VDIFTLDRAD----RVFKLTGSSVQIPTDANEFAINASNRRHWDLPVRAYIDECLAGA
F16PA_NITWN      --VDIFTLDRVD----RVFKLTGSAVKIPAEATEFAINASNRRHWDLPVRAYIDECLAGA
F16A2_NITHX      --VDIFTLDRVE----RVFKLTGSMMQIPADATEFAINTSNRRHWDLPVRAYIDECLMGA
F16A1_NITHX      --VDIFTLDRVE----RVFKLTGSMMQIPADATEFAINTSNRRHWDLPVRAYIDECLMGA
F16PA_BRADU      --VDIFTLDRKA----GCFRLARSAIQISEAGEEFAINASNRRHWDPPVRAFIDECLAGV
F16PA_RHOPB      --VDIFTLDRRD----RTYKCIRQQVQIPEHTAEFAINASNHRHWEQPVRDFVEECLAGA
F16PA_RHOP5      --VDIFTLDRAA----HVYKRIRHKVRIPTDTPEFAINASNHRHWEQPVRDFVEECLAGT
F16PA_RHOPA      --VNIFTLDRKA----KVYRLIRERVKVPADTAEYAVNASNHRHWEQPIRDFVDECIAGA
F16PA_RHOPT      --VNIFTLDRKA----KVYRLIRERVKVPADTAEYAVNASNHRHWEQPIRDFVDECIAGA
F16PA_RHOP2      --VDIFTLDRAA----KTYRLIRERVQVPADTAEYAINASNHRHWEQPVRDFVDECLAGT
F16PA_RHOPS      --VDIFTLDRKD----HVYRLIREKVKVAGDTAEYAINASNHRHWEQPVRDFVDECLAGA
F16PA_BRASO      --VDLYVLHPTL----HEFILAKSGIRIPQDTPEFAINASNRRHWSGAVRNYVDECLSGA
F16A2_BRASB      --VDLYVLHPTL----REFVLARSGLRIPQDTPEFAINASNRRHWSGTVRNYVDECLAGA
F16PA_RHIME      --TEIFIFSSRL----GCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDDCLAGS
F16PA_SINMW      --TEIFIFSSRL----GCFVDAYKSVGIPDRANEFAINMSNYRHWEEAIRLYVDDCLAGS
F16PA_XANFL      --TWHFALD-RA----GLFRLVDAEVKVKEGAAEFAINMSNYHHWDVPVRDYVDDCLAGK
F16A1_XANP2      --TWHFALD-RD----GSFRLVNAAVRVKEDAAEFAINMSNYHHWDDPIRAYVDDCLAGR
F16A2_CERSP      --VQHWVLDLDA----GIFRRMPDIRPLPAETSEFAINASNYRHWPQPIRAFVDDLVAGA
F16A2_CERS4      --VQHWVLDLDA----GIFRRMPDIRPLPAETSEFAINASNYRHWPQPIRAFVDDLVAGA
F16A2_RHOS1      --VQHWVLDLDA----GIFRRMPDIRPLPAETSEFAINASNYRHWPQPIRAFVDDLVAGA
F16A2_CERS5      --VHHWVLDLDA----GIFRRMADIRPLPAETSEFAINASNYRHWPKPVRAFIDDLMAGA
F16PA_RHOCB      --VHHWVLDLDS----RSFKRLPDIKALPQDTSEYAINASNYRHWPSPIRAFIDDLVAGA
F16A1_RHOS1      --TQKYVLDPGS----RSFVLVDRAVKVPPSSTEFAINASNYRHWPKPIRAYIDDCVAGT
F16A1_CERS4      --TQKYVLDPGS----RSFVLVDRAVKVPPSSTEFAINASNYRHWPKPIRAYIDDCVAGT
F16A1_CERSP      --TQKYVLDPGS----RSFVLVDRAVKVPPSSTEFAINASNYRHWPKPIRAYIDDCVAGT
F16A1_CERS5      --TQKYVLDPGS----RSFVLVDRAVKVPPASTEFAINASNYRHWSKPIRAYIDDCVAGT
F16PA_PARDP      --VQHYALDPED----DAFRLVATRRQMPDCALEFAINASNYRHWPQPIRAYIDDCLAGS
F16A1_BRASB      --LAQFVLH--R----GHFFLVSDSLRIPDRTTEFAINASNYRHWSRPIRAFVDDCIAGD
F16PA_METEP      --TRIFTLDRTD----NVFRLTHDAMKIVPSASEYAINASNVRHWDGPVKSYIEDCLRGS
F16PA_METPB      --TRIFTLDRAE----KVFRLTHDALQIVPSANEYAINASNVRHWDGPVKSFIEDCLRGT
F16PA_METRJ      --TQSYVLDRTE----GRFKLTSPAMSVPPSTKEFAINASNARHWDAPVKAYIEDCQRGT
F16PA_AZOC5      --TQVFVFDHDT----ATFILAREKVEIPAATKEYGINQSNVRHWAKATQRYIDDCLAGK
F16A2_XANP2      --TQVFVHDRQT----GEFVLARTNVEIPAETKEYGVNQSNVRHWAEPMSAYIADCLAGK
F16PA_ACICJ      --TRIFTLDPVS----GAFLAPAPPATVPAATREYAINGSNLRHWEEPIRDYIVELKQGR
F16PA_BRUC2      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUSU      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUAB      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUO2      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUA2      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUA1      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUSI      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUME      --VIFATLDPVS----GQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16PA_BRUA4      --VIFATFDPAS----GIFHITRRNVTLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGK
F16A3_PSET1      --THIYTLDPSN----NNFMLTHPNLNIPEDTNEFSFNLSNQFKWPENVQKYIVDLQLGT
F16PA_ECOLI      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHIFL      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHIBS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOK1      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOUT      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOL5      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHIF8      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHIB3      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECODH      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOSM      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOLC      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOL6      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECO24      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECOHS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHIDS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECO57      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ECO5E      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SHISS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_CITK8      -----FTYDPSL----GVFCLCQERMRFPEKGNTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALTY      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALPA      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALCH      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALEP      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALDC      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALA4      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALPK      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALSV      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALHS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALNS      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALPB      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALTI      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALG2      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_SALAR      -----FTYDPSL----GVFCLCQERMRFPEKGKTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_ENT38      -----FTYDPSL----GVFCLCQERMRYPEKGSTYSINEGNYIKF-PNGVKKYIKFCQEE
F16PA_KLEP3      -----FTYDPSL----GVFCLCQERMRFPEKGNTYSINEGNYIKF-PQGVKKYIKYCQEE
F16PA_KLEP7      -----FTYDPSL----GVFCLCQERMRFPEKGNTYSINEGNYIKF-PQGVKKYIKYCQEE
F16PA_CROS8      -----FTYDPSL----GVFCLCQERMRFPQSGNTYSINEGNYIKF-PMGVKKYIKYCQEE
F16PA_ERWT9      -----FTYDPSL----GVFCLSAERMTFPENGYTYSINEGNYIRF-PQGVKKYLKFCQEE
F16PA_SODGM      -----FTYDPSL----GVFCLSHESVRFPATGQMYSINEGNYIKF-PNGVKKYIKYCQEM
F16PA_YERPN      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPA      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPE      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPS      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPB      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPY      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPG      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERP3      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERPP      -----FTYDPSL----GVFCLSHEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_YERE8      -----FTYDPSL----GVFCLSGEKVRYPATGCMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_SERP5      -----FTYDPSL----GVFCLSHEKVRFPATGNMYSINEGNYIKF-PRGVKKYIKYCQEQ
F16PA_PHOLL      -----FTYDPSL----GVFCLSHEKVQFPPNGNMYSINEGNYIKF-PMGVKKYIKYCQEQ
F16PA_PROMH      -----FTYDPSL----GVFCLSHESVHFPPTGNMYSINEGNYIKF-PLGVKKYIKYCQEQ
F16PA_PECAS      -----FTYDPSL----GVFCLSHEKVCFPEKGNMYSINEGNYIKF-PSGVKKYIKYCQEQ
F16PA_VIBCH      -----FTYDPSL----GTFYLSHENMRIPENGKIYSINEGNYIRF-PTGVKKYIKFCQEN
F16PA_VIBC3      -----FTYDPSL----GTFYLSHENMRIPENGKIYSINEGNYIRF-PTGVKKYIKFCQEN
F16PA_VIBVU      -----FTYDPSL----GTFCLSHENMMIPQNGNIYSINEGNYIRF-PMGVKKYIKYCQEN
F16PA_VIBVY      -----FTYDPSL----GTFCLSHENMMIPQNGNIYSINEGNYIRF-PMGVKKYIKYCQEN
F16PA_VIBPA      -----FTYDPSI----GSFCLSHENMMIPEDGKIYSINEGNYIRF-PQGVKKYIKYCQEN
F16PA_VIBCB      -----FTYDPSI----GSFCLSHENMMIPEDGKIYSINEGNYIRF-PQGVKKYIKYCQEN
F16PA_ALIFM      -----FTYDPSL----GVFCLSHENMQVPKDGNIYSINEGNYIRF-PEGIKQYLKFCQES
F16PA_ALIF1      -----FTYDPSL----GVFCLSHENMQIPKDGNIYSINEGNYIRF-PEGIKQYLKFCQES
F16PA_ALISL      -----FTYDPSL----GVFCLSHEDMKIPQDGNIYSINEGNYIRF-PEGVKQYLKYCQEI
F16PA_PHOPR      -----FTYDPSL----GVFCLSHENMQIPEDGQIYSINEGNYIRF-PQGVKKYIKFCQED
F16PA_AERS4      -----FTYDPSI----GCFCLSHENIRIPEEGKIYSINEGNYIKF-PDGVKKYLKYCQER
F16PA_AERHH      -----FTYDPSI----GCFCLSHENIRIPEEGKIYSINEGNYIKF-PDGVKKYLKYCQER
F16PA_HAHCH      -----FTYDPTI----GVFCLSHPNLRIPEDGTIYSINEGNYIHF-PEGVKKYIKFCQEE
F16PA_PSYIN      -----FTCDPSL----GTFYLSHENMKIPDNGSIYSINEGNYLKF-PQGVKKYLKYCQEI
F16PA_HAEIE      -----FTYDPSI----GTFCLSHENMQMPKEGKIYSINEGQYLKF-PQGVKKYIKYCQEE
F16PA_HAEI8      -----FTYDPSI----GTFCLSHENMQMPKEGKIYSINEGQYLKF-PQGVKKYIKYCQEE
F16PA_HAEIN      -----FTYDPSI----GTFCLSHENMQMPKEGKIYSINEGQYLKF-PQGVKKYIKYCQEE
F16PA_HAES1      -----FTYDPSL----GVFCLSHENIQIPPNGKIYSINEGQYLKF-PMGVKKYIKYCQEK
F16PA_HISS2      -----FTYDPSL----GVFCLSHENIQIPPNGKIYSINEGQYLKF-PMGVKKYIKYCQEK
F16PA_PASMU      -----FTYDPSL----GVFCLSHENIQIPANGKIYSINEGQYLKF-PQGVKKYIKYCQEE
F16PA_MANSM      -----FTYDPSL----GTFCLSHENMQIPATGKIYSINEGQYLKF-PMGVKKYIKYCQEE
F16PA_ACTSZ      -----FTYDPSL----GVFCMSHENLQIPSTGRIYSINEGQYLKF-PMGVKKYIKYCQEE
F16PA_ACTP7      -----FTYDPSL----GLFILSHPDMKMPTEGKYYSINEGQYVTF-PMGVKKFIKYCQES
F16PA_ACTPJ      -----FTYDPSL----GLFILSHPDMKMPTEGKYYSINEGQYVTF-PMGVKKFIKYCQES
F16PA_ACTP2      -----FTYDPSL----GLFILSHPDMKIPTEGKYYSINEGQYVTF-PMGVKKFIKYCQES
F16PA_HAEDU      -----FTYDPSL----GLFILSHPDMKMPAEGKYYSINEGQYVTF-PLGVKKFIKYCQEN
F16PA_DICNV      -----FTYDPSL----GTFLLSHENIKIPKDGAIYSINEGGYLKF-PQGIKKYIKYCQED
F16PA_FLAJ1      -----FTLNPAI----GTFYLSHPNMKFPENGNIYSVNEGNYVHF-PQGVKNYIKYCQR-
F16PA_FLAPJ      -----FTLNPAI----GTFYLSHPNMKYSKDGHIYSMNEGNYVHF-PQGVKNYIKYCQS-
F16A2_GRAFK      -----FTLNPAL----GSWYLSHPDMKFPEEGQIYSINEGNYIHF-PQGVKDYIKYCQQ-
F16A1_GRAFK      -----FTFDPGI----GSFFLSHSDIKFPKKGNTYSVNEGNYVHF-PQGIKKYIKWVQEL
F16PA_WIGBR      -----FTYHPFF----STFFLSKKNFNYPKKNNIYSINEANYNNF-SLGIKKYIMSCKS-
F16PA_CYTH3      -----FTLDPSI----GEFCLSHPNLKIPEDGFIYSVNEGNYADF-PREIQEYIYYCKTP
F16PA_CHLPM      -----FTYDPTI----GEFLLSHENIVTPKHGKYYSINEGSYAQF-NDTTKKYLDYIKEE
F16PA_CHLL3      -----FTYDPTI----GEFLLSHENITTPGSGKYYSINEGSYAQF-NDGTKRYLDYIKEE
F16PA_CHLPD      -----FTYDPTI----GEFLLSHENIVTPKSGKYYSINEGSYGQF-NEGTKKYLDYIKEE
F16PA_PELPB      -----FTYDPTI----GEFLLSHENIITPKSGKYYSINEGSYAQF-NEGTKRYLDYIKEE
F16PA_CHLL2      -----FTYDPTI----GEFLLSHENIVTPKTGKYYSINEGSYAQF-NEGTKKYLDYIKEE
F16PA_CHLCH      -----FTYDPTI----GEFLLSDENITTPKRGKYYSMNEGSYAQF-NEGTKRYLDYIKTE
F16PA_PROA2      -----FTYDPTI----GEFLLSHENITTPERGKYYSINEGSLHQF-NDSTVNFINYLKED
F16PA_CHLPB      -----FTYDPTI----GEFLLSHENITTPKQGKYYSINEGSRKQF-NDSTVNYINYLKEE
F16PA_CHLTE      -----FTYDQTV----GEFLLSHENITTPEHGKYYSVNEGSWQEF-NDGTKRFLDYLKEE
F16PA_CHLP8      -----FTFDQTV----GEFLLSHENITTPEHGKYYSVNEGSWNEF-HDGTKLFLDYLKEE
F16PA_CHLT3      -----FTLDPSI----GEFLLSHENIKTPKRGKIYSMNEGYYRYF-DDGIKKYIKYLQQE
F16A2_SALRD      -----FTLDPSI----GEFLLSHPDIQTPSRGRLSSINSGYYHSF-EEGLRDYLDWLQQK
F16A1_SALRD      -----FTLDPGI----GEFLLTHPDLQIPQAPAMYSINEADIEDF-SPELRAFLQWLKTK
F16PA_NOSS1      -----FTLDPSL----GEFILSEENIRIPDHGAVYSVNEGNFWQW-EESMREYIRYVHRT
F16PA_TRIV2      -----FTLDPSL----GEFILSEENIRIPDHGAVYSVNEGNFWQW-EESMREYIRYVHRT
F16PA_NOSP7      -----FVLDPSL----GEFILTEENIRIPNHGSVYSVNEGNFWQW-EESIREYIRYVHRT
F16PA_MICAN      -----FVLDPSL----GEFILAQENIIIPDHGPIYSTNEGNFWQW-DEAIRDYTRYVHRH
F16PA_CROS5      -----FLLDPSL----GEFILAQENIQIPDHGPVYSTNEGNFWQW-DDAIRDYTRYVHRH
F16PA_SYNY3      -----FILDPSL----GEFILAQENIRIPNHGPIYSTNEGNFWQW-DEALRDYTRYVHRH
F16PA_SYNP2      -----FILDPSL----GEFILAEENITMPNHGSIYSVNEGNFWQW-EDSIRDYIRYMHRH
F16A1_ACAM1      -----FILDPSL----GEFILAAENLTIPKHGPVYSVNEGNFWQW-EDALRDFTRYVHRH
F16PA_TRIEI      -----FTLDPSL----GEFILVNENIKIPEHGPVYSVNEGNFWQW-DDSMRDYIRYVHRH
F16PA_THEEB      -----FVLDPSL----GEFILAIENLQIPASGAIYSVNEGNFWAW-EEPIRNYVRHVHRQ
F16PA_SYNE7      -----FVLDPSL----GEFVLAQSDIQLPNSGQIYSVNEGNFWQW-PEGYRQYIREMHRR
F16PA_SYNP6      -----FVLDPSL----GEFVLAQSDIQLPNSGQIYSVNEGNFWQW-PEGYRQYIREMHRR
F16PA_SYNJA      -----FTLDPSL----GEFILSKSDLRIPERGSVYSLNEGYFCQW-SEGIQNYVRYVHRR
F16PA_SYNJB      -----FTLDPSL----GEFILSRSDIRIPERGSVYSLNEGYFCQW-SEGIQNYVRYVHRR
F16PA_GLOVI      -----FTLDAGL----GEFVLSHPNIRIPERGDYYSINDAYSAEW-QPGTRAFIDYLKQA
F16PA_DESVH      -----FTLDPSV----GEFLLSHPDMSIPERGRIYSINESYWNYW-DEPTREIVSYFKGD
F16PA_DESVV      -----FTLDPSV----GEFLLSHPDMSIPERGRIYSINESYWNYW-DEPTREIVSYFKGD
F16PA_DESAG      -----FTLDPSV----GEFLLSHPDIRYPEQGRIYSVNESYWHYW-DEPTREVVSYFKGP
F16PA_LAWIP      -----FTLDPSV----GEFLLSHTDIKIPDEGFIYSVNEGYWDYW-DTPTREAVMYFKQP
F16PA_LEPIN      -----FTLDPSC----GEFILSHPDMQIPETGGIYSINEGNYNYW-SDEVKNYIRDIKSI
F16PA_LEPIC      -----FTLDPSC----GEFILSHPDMQIPETGGIYSINEGNYNYW-SDEVKNYIRDIKSI
F16PA_LEPBL      -----FTLDPSC----GEFILSHPDMQMPETGGIYSINEGNYNYW-SDEVKNYIRDIKSI
F16PA_LEPBJ      -----FTLDPSC----GEFILSHPDMQMPETGGIYSINEGNYNYW-SDEVKNYIRDIKSI
F16PA_LEPBP      -----FTLDPSV----GEFLLSHPNMQMPESGDIYSANEGNASYW-SPEVQAYLQKIKSI
F16PA_LEPBA      -----FTLDPSV----GEFLLSHPNMQMPESGDIYSANEGNASYW-SPEVQAYLQKIKSI
F16PA_SORC5      -----FTYDPTV----GEFFLSHENIRIPERGSTYSINEGHSARW-PEDVRRWNAWIKED
F16PA_SULSY      -----FTLDPAV----GMYLLSHPNMKIPEKGKIYSINESNDKKWIDAGLKEYIESLKDE
F16A2_ACAM1      -----FTLDPSL----GEFLLSHENIRCPETGKTYSANLSYYQEW-HPHIQNFADYLSDR
F16PA_AMOA5      -----FTYDPTV----NQFFLTHPALRMPENGITYAINHSYLHTF-PHYIQNYIAYCRRQ
F16PA_SYNAS      -----FHADETA------TYVKPMRMTLPDDPKKWELS------FNSANTTVFSEKVQSW
F16PA_GEOBB      ----------------HEFTMNNLMEFTLTRENVKMAPEGNIYAPGGLRNKYNAGDEKFI
F16PA_GEOUR      ----------------HEFTMNQLMEFNLTRENIRMQPDGNIYSPGGLRNKYNEGDEKFI
F16PA_GEOMG      ----------------HEFTMNHLMEFTLSRENIVMQEEGNIYAPGGLRNKYQEGTEQFV
F16PA_GEOSL      ----------------HEFTMNHLMEYTLSRENVTMKPDGDIYSPGGLRKKYLPETEKFV
F16PA_PELPD      ----------------YEFTMNQLMEFTLSREQIQMHPSGDIYSPGGLRKKYCEGNERFI
F16PA_GEOLS      ----------------YEFTMNHLMEFTLTREKVQMNPSGDIYSPGGLRKKYTPENEAYI
F16PA_PELCD      ----------------HEFGMNQLMEYTLLRRNIRMESKASIYAPGGLRSLYTDGTDKFV
F16PA_METLZ      ----------------SIFAMNEEG-TYVLLKENVRIPEGTLCGSGGLRPEWTEKHIQYM
F16PA_METHJ      ----------------QSFAWDPESEHYLLLKDHFSVPEGKQYGTGGVRNEWLLPHLKVI
F16PA_METB6      ----------------HEFVQCETG-EFVLRHENLKIPEGKIQSPGALRRDYLTAHAQWI
F16PA_HELPY      --------EVYRYSFYQNKFHFIETIVLENKGK-IVASGGNQKDFSLGLKKALEGFFAE-
F16PA_HELPS      --------EVYRYGFYQNKFHFIETIVLENKGK-IIASGGNQKDFSSGLKKALEGFFAE-
F16PA_HELPG      --------EVYRYAFYQNKFHFIETIVLENKGK-IIASGGNQKDFSLGLKKALEGFFAE-
F16PA_HELPH      --------EVYRYAFYQNKFHFIETIVLENKGK-IVASGGNQKDFSLGLKKALEGFFAE-
F16PA_HELPJ      --------EVYRYAFYQNKFHFIETIVLENKGK-IIASGGNQKDFSLGLKKALEGFFAE-
F16PA_HELAH      --------QVYRYAFYQNKFHFIETIALENKGK-IVASGGNQKDFSMGLKKALEGFFTE-
F16PA_CAMC5      ----GTKPKFYRLGKDGNFKFV-RELELAQKGK-LNATGATQKGWSKTHRNFINELFDE-
F16PA_CAMC1      ----GALPKFYRLGKDGEFKFV-KELELKEKGK-LNATGATQKGWSQTHRNFINELFNE-
F16PA_CAMHC      ----GNAPKFYRLQKDGNFAFI-NELKLENKGK-LNATGATQKNWSQTHRNFIRSLFDE-
F16PA_CAMFF      -----DTPKLYRLDRDGSFKFI-KDLSLKEKGK-LNATGGTQKGWSGAHRDFIKTLFDE-
F16PA_CAMJJ      -----DQPKLYRLNANNEFIFI-KDLKMNEKGK-INATGGTQKFWEEKHAKFIKSLFDE-
F16PA_CAMJ8      -----DQPKLYRLNANNEFIFI-KDLKMNEKGK-INATGGTQKFWEEKHAKFIKSLFDE-
F16PA_CAMJE      -----DQPKLYRLNANNEFIFI-KDLRMNEKGK-INATGGTQKFWEEKHAKFIKSLFDE-
F16PA_CAMJR      -----DQPKLYRLNANNEFIFI-KDLKMNEKGK-INATGGTQKFWEEKHAKFIKNLFDE-
F16PA_CAMJD      -----EQPKLYRLNANNEFIFI-KDLKINEKGK-INATGGTQKFWEEKHAKFIKSLFDE-
F16PA_ARCB4      ------DVKMYRLL-DGKFTFI-QNIKLNEKGK-LNAPGSTQNCWAPFHKQLIDDIFND-
F16PA_SULDN      ------KTKLHLLQ-GKEFEFV-KEIRLNEKGK-LNAPGGTQQNWKPYHKKMVDSFFNE-
F16PA_NITSB      ------KAERFILQ-NGKFLFM-EELQLGEKGK-LNAPGGTQQYWYPHHKALVEDLFSQ-
F16PA_SULNB      -----ERPKHYRAQ-DGFFNLVSKEVILKEKGK-LNAPGGTQQNWCDYHKSFVDDLFAE-
F16PA_WOLSU      ------KVELYTFQ-FGRFEHR-KTLALQEKGK-INAPGATQACWHPKHKEFIDSLFAE-
F16PA_HELHP      --------QALHYRYNGNMWRNLGALALNTKGK-INAPGGTQKHWENKHKAMIESLFAQ-
F16PA_HALSA      ----DDTVRESLVSETGATTDL-GPVELPADPT-VYGFGGRVPDWTPAFESFVRDVEDD-
F16PA_HALS3      ----DDTVRESLVSETGATTDL-GPVELPADPT-VYGFGGRVPDWTPAFESFVRDVEDD-
F16PA_NATPD      ----DGTVTESVIDEDGTRTVVTDDLTLPSDPV-VYGFGGRVPNWTPAFADYVESVASE-
F16PA_HALWD      ----EGNVADYVIYQDGSYEPIEQEVRVPSEPT-VYGFGGRVPNWPRDFNSFVSDIESDT
F16A1_HALMA      ----DGSVREYIL-EDGDKRVVDDDVTVPEDPT-VFGFGGGVDSWTDEFESYAEAVRHE-
F16A2_HALMA      ----DRDVVQEHLLRDGHSERW-GQFELPAEAT-VVGLAGKTGERSDAFNDIAQSFERD-
                                                                             

F16A2_CUPNH      SGPRGKDFNMRWIASMVAEAHRILMRG-GVFMYPRDSKDPAK-----PGRLRLLYEANPI
F16A3_CUPNH      SGPRGKDFNMRWIASMVAEAHRILMRG-GVFMYPRDTKDPAK-----PGRLRLLYEANPI
F16A2_CUPTR      TGPRGKDFNMRWIASMVAEAHRILMRG-GVFMYPRDTKDPAR-----PGRLRLLYEANPI
F16A2_CUPMC      TGPRGKDFNMRWVASMVAEAHRILMRG-GVFMYPRDTKDPAK-----PGRLRLLYEANPV
F16A2_LEPCP      TGPRGKDFNMRWIASMVAEAHRILMRG-GVFMYPRDTKDASK-----PGRLRLLYEANPI
F16A2_POLNA      TGPRDKDFNMRWIASMVAEAHRILMRG-GVFLYPRDSKDAAK-----PGRLRLLYEANPI
F16A1_RHOFT      TGPRGKDFNMRWIASMVAEAHRILMRG-GVFMYPRDNKDPAK-----PGRLRLLYEANPV
F16PA_HYDTE      TGPRGKDFNMRWVASLVAETHRILSRG-GVFLYPRDNKEPKK-----PGRLRLLYECNPI
F16A3_METPP      TGPRGTDFNMRWIASLVAETHRILMRG-GVFLYPRDSKDPNK-----AGRLRLLYEANPI
F16PA_RHORT      SGPRSKDYNMRWIAALVADVHRILLRG-GIYLYPRDTKTPDL-----AGRLRLLYEAAPV
F16A2_DECAR      SGVRGEDFNTRWIASMVAEVHRILIRG-GIFMYPKDSKDPSK-----PGRLRLLYEANPM
F16A2_PARXL      SGCRASDFNMRWIASMVAEVHRILMRG-GVFMYPRDSKTPAM-----EGRLRLLYEANPM
F16PA_METI4      TGPRGKDFNMRWIASMVAEVYRILIRG-GLFMYPRDTKDLSK-----PGRLRLLYEANPM
F16PA_MAGSA      EGPRGKDFNMRWVASMVAEVHRILCRG-GVFLYPADTENMKK-----GGKLRLMYEANPM
F16PA_METFK      SGPRGKDFNMRWVATMVAEVHRLLVRG-GVFLYPLDSRAVGR-----GGRLRLLYEANPM
F16A1_METPP      SGPRGRDFNMRWVASLVAEVHRILTRG-GVFLYPRDSREPFR-----PGRLRLLYEAAPM
F16PA_NITEC      TGPRNRDFNMRWVASMVAEVHRILTRG-GIFMYPRDTKDPSK-----PGRLRLMYEASPM
F16PA_NITEU      TGPRGRDFNMRWVASMVAEVHRILTRG-GIFMYPRDTKDPSK-----PGRLRLMYEANPM
F16PA_THIDA      TGPRGKDFNMRWVASMVAEVHRILTRG-GIFMYPKDTKDPSK-----AGKLRLMYEANPM
F16PA_NITOC      EGCRNKNFNMRWVASMVSEVYRILTRG-GIFMYPWDSRDPDK-----PGRLRLMYEANPM
F16PA_ACIF5      DGPRQRDFNMRWVGSMVADVHRILCRG-GIFLYPFDQRDPKK-----PGKLRLLYEANPM
F16PA_HALHL      EGPRGQDFNMRWVASMVAEVHRILCRG-GVFMYPLDAKIKAKG---QNGRLRLMYEANPM
F16PA_DELAS      EGPRGKDFNMRWIASMVADVHRIMTRG-GIFMYPWDRREPNK-----PGKLRLMYEANPM
F16PA_ACISJ      EGPRGKDFNMRWIASMVADVHRILMRG-GIFMYPWDKREPNK-----PGKLRLMYEANPM
F16PA_POLSJ      EGPRGKDFNMRWVASMVADVHRILSRG-GIFMYPWDKREPEK-----AGKLRLMYEANPM
F16PA_ACIAC      EGPREKDFNMRWIASMVADVHRILTRG-GIFLYPWDKREPNK-----PGKLRLMYEANPM
F16A1_POLNA      DGPRGKDFNMRWIASMVADVHRILCRG-GVFLYPWDKREPEK-----AGKLRLMYEANPM
F16PA_VEREI      SGPRGKDFNMRWVASMVADMHRILSRG-GVFLYPWDRREPHK-----PGKLRLLYEANPM
F16A2_RHOFT      DGPRGKDFNMRWVGSMVADVHRILTRG-GVFLYPWDKREPEK-----PGKLRLMYEANPM
F16A1_LEPCP      EGPRGKDFNMRWVGSMVADVHRILTRG-GIFLYPWDQREPDK-----PGKLRLMYEANPM
F16A2_METPP      DGPRGKDFNMRWVASMVADVHRILCRG-GVFMYPWDKREPAK-----AGKLRLMYEANPM
F16A1_CUPTR      EGPRGKNFNMRWVASMVADVHRILTRG-GIFMYPWDKREPEK-----PGKLRLMYEANPM
F16A1_CUPNH      EGPRGKNFNMRWVASMVADVHRILTRG-GVFMYPWDKREPEK-----PGKLRLMYEANPM
F16PA_CUPPJ      EGPRGKNFNMRWIASMVADVHRILTRG-GIFMYPWDKREPEK-----AGKLRLMYEANPM
F16A1_CUPMC      EGPRGKNFNMRWIASMVADVHRILTRG-GVFMYPWDKREPEK-----PGKLRLMYEANPM
F16PA_RALSO      EGPRGKDFNMRWIASMVADVHRILTRG-GIFMYPWDKREPGK-----AGKLRLMYEANPM
F16PA_RALPJ      EGPRGKDFNMRWIASMVADVHRILTRG-GIFMYPWDKREPGK-----AGKLRLMYEANPM
F16PA_BORBR      TGPLGKDYNMRWIASMVADVHRILTRG-GIFMYPWDAREPGK-----AGKLRLMYEANPM
F16PA_BORPA      TGPLGKDYNMRWIASMVADVHRILTRG-GIFMYPWDAREPGK-----AGKLRLMYEANPM
F16PA_BORPE      TGPLGKDYNMRWIASMVADVHRILTRG-GIFMYPWDAREPGK-----AGKLRLMYEANPM
F16PA_BORPD      TGPLGKDYNMRWIASMVADVHRIMTRG-GIFMYPWDAREPGK-----AGKLRLMYEANPM
F16PA_BORA1      TGPLGKDYNMRWIASMVADVHRILTRG-GIFMYPWDAREPGK-----AGKLRLMYEANPM
F16PA_JANMA      TGPRAKDFNMRWIASMVADVHRILNRG-GIFMYPADAREPDK-----PGKLRLMYEANPM
F16PA_HERAR      TGPRGKDFNMRWIASMVADVHRILNRG-GIFMYPADAREPDK-----PGKLRLMYEANPM
F16PA_HERSE      TGVRGKDFNMRWIASMVADVHRILNRG-GIFMYPADAREPNK-----PGKLRLMYEANPM
F16PA_PARL1      TGPREANFNMRWTASMVADIHRILKRG-GIFMYPWDAREPDR-----AGKLRLMYEANPM
F16A1_PARXL      EGSRQSDFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDK-----PGKLRLMYEANPM
F16PA_PARPJ      DGPRQSDFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDK-----PGKLRLMYEANPM
F16A1_PARP8      DGPRQADFNMRWIASMVADVHRILNRG-GIFMYPADKRDPSK-----PGKLRLMYEANPM
F16PA_BURCA      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURCH      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURCC      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURCJ      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURL3      DGPRGDNFNMRWIASMVSDVHRILNRG-GVFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURM1      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURA4      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURCM      DGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURVG      EGPRGDNFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURM9      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURMS      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURPS      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURMA      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURP1      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURP0      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURP6      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURM7      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_BURTA      EGPRGENFNMRWIASMVADVHRILNRG-GIFMYPADKRTPDR-----PGKLRLMYEANPM
F16PA_PSEP1      TGPLKKNYNMRWIASMVADVHRILTRG-GLFMYPRDAREPSK-----PGKLRLMYEANPM
F16PA_PSEE4      TGPLKKNYNMRWIASMVADVHRILTRG-GLFMYPRDAREPSK-----PGKLRLMYEANPM
F16PA_PSEPK      TGPLKKNYNMRWIASMVADVHRILTRG-GLFMYPRDAREPSK-----PGKLRLMYEANPM
F16PA_PSEPG      TGPLKKNYNMRWIASMVADVHRILTRG-GLFMYPRDAREPSK-----PGKLRLMYEANPM
F16PA_PSEPW      TGPLKKNYNMRWIASMVADVHRILTRG-GLFMYPRDAREPSK-----PGKLRLMYEANPM
F16PA_PSESM      DGPLKKNYNMRWVAAMVADVHRILTRG-GLFMYPRDSREPSK-----PGKLRLMYEANPM
F16PA_PSEU2      DGPLKKNYNMRWVAAMVADVHRILTRG-GLFMYPRDSREPSK-----PGKLRLMYEANPM
F16PA_PSE14      EGPLKKNYNMRWVAAMVADVHRILTRG-GLFMYPRDSREPSK-----PGKLRLMYEANPM
F16PA_PSEPF      EGPLKKNYNMRWVAAMVADVHRILTRG-GLFMYPRDSREPSK-----PGKLRLMYEANPM
F16PA_PSEF5      TGPLKKNYNMRWVAAMVADVHRILTRG-GLFMYPRDSREPEK-----PGKLRLMYEANPM
F16PA_PSEA7      EGPLGKNYNMRWIASMVADVHRILTRG-GVFMYPRDAREPEK-----PGKLRLMYEANPM
F16PA_PSEAE      EGPLGKNYNMRWIASMVADVHRILTRG-GVFMYPRDAREPEK-----PGKLRLMYEANPM
F16PA_PSEAB      EGPLGKNYNMRWIASMVADVHRILTRG-GVFMYPRDAREPEK-----PGKLRLMYEANPM
F16PA_PSEMY      TGPLGRNYNMRWIASMVADVHRILTRG-GVFMYPRDAREPDK-----PGKLRLMYEANPM
F16PA_PSEU5      EGPLGKNYNMRWIASMVADVHRILTRG-GIFMYPRDAREPDK-----AGKLRLMYEANPM
F16PA_CHRVO      TGPRGRDFNMRWVASMVAEVHRIITRG-GIFMYPKDARDPSK-----AGKLRLMYEGNPM
F16PA_AROAE      TGPRGKDFNMRWVASMVADVHRVLTRG-GIFMYPLDEKCRDQ-----GGKLRLMYEANPM
F16PA_AZOSB      TGPRGKDFNMRWVASMVADVHRILTRG-GIFMYPLDEKCRAQ-----GGKLRLMYEANPM
F16A1_DECAR      EGPLGKDYNMRWVASMVADVHRIMTRG-GIFMYPMDSKIKGQ-----GGKLRLMYEANPM
F16PA_XANAC      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----PGKLRLMYEANPM
F16PA_XANC5      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----PGKLRLMYEANPM
F16PA_XANOM      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----PGKLRLMYEANPM
F16PA_XANOP      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----PGKLRLMYEANPM
F16PA_XANOR      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----PGKLRLMYEANPM
F16PA_XANCP      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDAAK-----PGKLRLMYEANPM
F16PA_XANC8      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDAAK-----PGKLRLMYEANPM
F16PA_XANCB      DGARGKDFNMRWIASMVADVHRILTRG-GIFIYPWDKKDAAK-----PGKLRLMYEANPM
F16PA_STRM5      EGARGKNFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----AGKLRLMYEANPM
F16PA_STRMK      EGTRGKNFNMRWIASMVADVHRILTRG-GIFIYPWDKKDPSK-----AGKLRLMYEANPM
F16PA_SHEB8      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHEB5      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHEB9      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPSDNKDPKK-----PYKLRLMYEANPM
F16PA_SHESR      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHESM      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHESA      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHEPC      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHESW      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHEON      IGPREKSFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKDPKK-----PYKLRLMYEANPM
F16PA_SHEHH      IGPREKSFNMRWIAAMVGDVHRVLCRG-GIFTYPTDNKNPEK-----PYKLRLMYEANPM
F16PA_SHEPA      IGPREKSFNMRWIAAMVGDVHRVLCRG-GIFTYPTDNKNPEK-----PYKLRLMYEANPM
F16PA_SHESH      IGPREKAFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKNPQK-----PYKLRLMYEANPM
F16PA_SHEWM      IGPREKAFNMRWIAAMVGDVHRVLSRG-GIFTYPTDNKNPQK-----PYKLRLMYEANPM
F16PA_SHELP      IGPREKSFNMRWIAAMVGDVHRVLSRG-GLFTYPTDNKNPEK-----PYKLRLMYEANPM
F16PA_SHEDO      IGPREKPFNMRWIAAMVGDVHRVLSRG-GIFTYPADNKNPNK-----PYKLRLMYEANPM
F16PA_SHEFN      IGPREQSFNMRWIAAMVGDVHRVLCRG-GIFSYPTDNKNPAK-----PFKLRLMYEANPM
F16PA_SHEAM      EGPRGKNFNMRWIAAMVGDVHRVLCRG-GLFTYPTDTKDPKK-----PFKLRLMYEANPM
F16PA_MARMS      EGSRGKNFNMRWVAAMVGDVHRILCRG-GIFIYPWDNKDPSK-----AGKLRLMYEANPM
F16PA_ALTMD      DGPRGKNFNMRWVAAMVGDIHRLLCRG-GIFMYPFDNRDPSK-----PGKLRLLYEANPM
F16PA_PSEA6      DGPREKDFNMRWVAAMVGDIHRVLSRG-GIFMYPFDRRNPEM-----PGKLRLLYEANPM
F16A1_PSET1      TGPRARNFNMRWIAAMVGDVHRVLSRG-GLFTYPTDTKNPSQ-----PNKLRLLYEANPM
F16PA_COLP3      TGPREKNFNMRWIAAMVGDIHRVLCRG-GIFTYPADSRKPEQ-----PYKLRLMYEANPM
F16PA_IDILO      EGPRGKNFNMRWNAAMVSDVHRVISRG-GLFTYPWDARKPEK-----PFKLRLLYEAAPM
F16PA_CELJU      TGPRAKRFNMRWNAAMVGDVHRVLTRG-GIFMYPSDNRNPRQ-----PAKLRLLYEANPM
F16A2_PSET1      TCKSFDKSSVRWNAAMVGDVHRILCRG-GLFLYPQDNRAGNE-----NGKIRLLYEANPL
F16PA_SACD2      EGVRGKRFNMRWNASMVGDVHRVLMRG-GIFMYPSDTRNPKQ-----PAKLRLLYEANPM
F16PA_HYDCU      EGPLAKRYNMRWVASMVAEVHRILIRG-GIFMYPYDNRDPSK-----AGKLRLMYEGNPM
F16PA_ACIBC      TSVREKDFNMRWVACMVGDVHRILCRG-GIFLYPYDLKDPKK-----AGRLRLMYEANPM
F16PA_ACIBS      TSVREKDFNMRWVACMVGDVHRILCRG-GIFLYPYDLKDPKK-----AGRLRLMYEANPM
F16PA_ACIBT      TSVREKDFNMRWVACMVGDVHRILCRG-GIFLYPYDLKDPKK-----AGRLRLMYEANPM
F16PA_ACIBY      TSVREKDFNMRWVACMVGDVHRILCRG-GIFLYPYDLKDPKK-----AGRLRLMYEANPM
F16PA_ACIAD      TSVRGKDFNMRWVACMVADIHRILCRS-GIFMYPYDLKDPSK-----AGRLRLMYEANPM
F16PA_PSYA2      IGVRGRDFNTRWVAAMVGDVHRILCRG-GLFTYPFDTKYANK-----AGKLRLMYEANPM
F16PA_PSYCK      TGVRGRDFNTRWVAAMVGDVHRILCRG-GLFTYPFDTKYANK-----AGKLRLMYEANPM
F16PA_PSYWF      SGPRGKNFNTRWVAAMVGDVHRILCRG-GIFIYPKDTKDPNK-----AGKLRLMYEANPM
F16PA_NEIM0      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYPQDKRDPAK-----PGKLRLMYEANPM
F16PA_NEIMB      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYPQDKRDPAK-----PGKLRLMYEANPM
F16PA_NEIMF      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYPQDKRDPSK-----PGKLRLMYEANPM
F16PA_NEIMA      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYPQDKRDPSK-----PGKLRLMYEANPM
F16PA_NEIG1      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYLQDKRDPSK-----PGKLRLMYEANPM
F16PA_NEIG2      TGTRGKNYNMRWVASMVAEIHRILMRG-GVFMYLQDKRDPSK-----PGKLRLMYEANPM
F16PA_POLAQ      GGAREKDFNMRWIASMVADVHRVLSRG-GVFMYPWDQREPHK-----PGKLRLMYEANPM
F16PA_POLNS      SGARDKDFNMRWIASMVADVHRVLSRG-GVFMYPWDQREPHK-----PGKLRLMYEVNPM
F16PA_CAUVC      DGARGKNFNMRWVASMVADVHRIMMRG-GVFMYPWDAREPDK-----PGKLRLMYEANPM
F16PA_CAUSK      SGPRGKNFNMRWVASMVADVHRIAMRG-GIFMYPWDAREPDK-----PGKLRLLYEANPM
F16PA_ALKEH      EGPRGKRFNMRWIASMVADLHRIFTRG-GVFLYPADEKRPNG-------RLRVLYEINPM
F16PA_NITVU      DGPCGKNFNMRWIGSLVAEAFRILIRG-GIFLYPGDARDGYE-----EGRL-VVYEAHPM
F16PA_NITWN      DGAGGKNYNMRWIGSLVAEAFRILIRG-GIFLYPGDARDGYE-----EGRLRLVYEAHPM
F16A2_NITHX      DGPSGKNFNMRWIGSLVAEAFRILVRG-GIFLYPGDARDGYE-----DGRLRLVYEAHPM
F16A1_NITHX      DGPSGKNFNMRWIGSLVAEAFRILVRG-GIFLYPGDARDGYE-----DGRLRLVYEAHPM
F16PA_BRADU      EGPANHDFNMRWVGSLVAEAYRILTRG-GVFLYPSDARPGYG-----DGRLRLTYEAHPM
F16PA_RHOPB      DGPRSKDFNMRWIGSLVAEAYRILTRG-GIFLYPGDSRPGYG-----DGRLRLLYECHPM
F16PA_RHOP5      EGPRSKDFNMRWLGSLVAEAYRILTRG-GVFLYPGDGRPGYS-----EGRLRLLYECHPM
F16PA_RHOPA      DGPRAKDFNMRWIGSLVAEVYRILTRG-GVFLYPGDNRPGYG-----NGRLRLLYETHPM
F16PA_RHOPT      DGPRAKDFNMRWIGSLVAEVYRILTRG-GVFLYPGDNRPGYG-----NGRLRLLYETHPM
F16PA_RHOP2      DGPRAKNFNMRWIGSLVAEAYRILTRG-GVFLYPADSRPGYG-----EGRLRVLYETHPM
F16PA_RHOPS      DGPRAKNFNMRWIGSLVAEAYRILTRG-GVFLYPADSRPGYG-----DGRLRLLYETHPM
F16PA_BRASO      AGPRGRDFNMRWIASLVAEAYRILMRG-GVFLYPADSRPGYR-----EGRLRLVYEAHPM
F16A2_BRASB      AGPRGRDFNMRWIASLVAEAYRILMRG-GVFLYPADSRPGYR-----EGRLRLVYEAHPM
F16PA_RHIME      EGPRERDFNMRWIASLVAETYRILIRG-GIFLYPADGRKGYS-----QGRLRLVYEANPI
F16PA_SINMW      EGPRERDFNMRWIASLVAEAYRILVRG-GIFLYPADSRKGYS-----HGRIRLVYEANPI
F16PA_XANFL      KGPRERDFNMRWVASMVADAHRIFQRG-GIYLYPGDGRKGYT-----HGRLRLLYEAFPV
F16A1_XANP2      KGPREREFNMRWVASMVADAHRIFQRG-GIYLYPGDGRKGYT-----HGRLRLLYEAFPV
F16A2_CERSP      EGPRGKNFNMRWIASLVAETHRILMRG-GVFLYPGDERKGYE-----RGRLRHVYECAPI
F16A2_CERS4      EGPRGKNFNMRWIASLVAETHRILMRG-GVFLYPGDERKGYE-----RGRLRHVYECAPI
F16A2_RHOS1      EGPRGKNFNMRWIASLVAETHRILMRG-GVFLYPGDERKGYE-----RGRLRHVYECAPI
F16A2_CERS5      DGPRGKNFNMRWIASLVAETHRILMRG-GVFLYPGDDRKGYE-----RGRLRHVYECAPI
F16PA_RHOCB      EGPRGRNFNMRWIASLVAETHRILMRG-GVFLYPGDERKGYA-----RGRLRHVYECAPI
F16A1_RHOS1      EGPRGRNFNMRWLASLVAETHRILARG-GVFLYPRDSRKGYE-----QGRLRYLYECAPI
F16A1_CERS4      EGPRGRNFNMRWLASLVAETHRILARG-GVFLYPRDSRKGYE-----QGRLRYLYECAPI
F16A1_CERSP      EGPRGRNFNMRWLASLVAETHRILARG-GVFLYPRDSRKGYE-----QGRLRYLYECAPI
F16A1_CERS5      EGPRGRNFNMRWLASLVAETHRILARG-GVFLYPRDGRKGYE-----QGRLRYLYECAPI
F16PA_PARDP      DGPREQNFNMRWIASLVAETHRILVRG-GVFLYPSDARKGYE-----HGRLRMLYECAPI
F16A1_BRASB      EGPWGENFNMRWVASLVAETHRILTRG-GIFLYPADARRGYG-----QGRLRLVYECAPI
F16PA_METEP      EGPRDRDFNMRWTAALVADAQRVLIRG-GVFLYPGDNRKGYA-----QGRLRLLYETAPI
F16PA_METPB      EGPRDRDFNMRWTAALVADAQRVLIRG-GVFLYPGDNRKGYA-----QGRLRLLYETAPI
F16PA_METRJ      EGPRDKDYNMRWLASLVADIQRVLTRG-GVFLYPGDARKNYA-----RGRLRLLYEVAPV
F16PA_AZOC5      DGPRGKDFNMRWVGSLVADAFRIFTRG-GVYLYPGDSRKGYA-----DGRLRLIYEANPI
F16A2_XANP2      DGPRGKDFNMRWVGSMVADAFRIFTRG-GVYVYPGDKRKGYE-----NGRLRLIYEANPV
F16PA_ACICJ      NGPRGIDFNTRWLASMVGDAFRILGRG-GIYLYPADERQGYE-----AGRLRLVYEANPI
F16PA_BRUC2      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUSU      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUAB      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUO2      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUA2      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUA1      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUSI      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUME      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16PA_BRUA4      DGPRGRNFNMRWLGAAVGDMHRIMQRG-GLFFYVNDSRPGYE-----KGRLRLVYEANPI
F16A3_PSET1      DGIRKKNFNMRWLGAMVGDMHRILCKG-GIFGYPEEKN--FK-----YGKLRLLYEANPI
F16PA_ECOLI      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHIFL      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHIBS      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOK1      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOUT      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOL5      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHIF8      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHIB3      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECODH      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOSM      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOLC      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOL6      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECO24      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECOHS      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHIDS      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECO57      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_ECO5E      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_SHISS      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_CITK8      DKSTNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PEGKLRLLYECNPM
F16PA_SALTY      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALPA      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALCH      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALEP      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALDC      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALA4      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALPK      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALSV      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALHS      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALNS      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALPB      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALTI      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SALG2      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PKGKLRLLYECNPM
F16PA_SALAR      DSSTSRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_ENT38      DTPTQRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_KLEP3      DKETQRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PDGKLRLLYECNPM
F16PA_KLEP7      DKATQRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PEGKLRLLYECNPM
F16PA_CROS8      DKATQRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PEGKLRLLYECNPM
F16PA_ERWT9      DKATRRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASH-------PQGKLRLLYECNPM
F16PA_SODGM      DEATHRPYTSRYIGSLVSDFHRNLLKG-GIYLYPSTATH-------PNGKLRLAYECNPI
F16PA_YERPN      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPA      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPE      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPS      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPB      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPY      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPG      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERP3      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERPP      DEATKRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_YERE8      DEATQRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_SERP5      DEATQRPYTSRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PQGKLRLLYECNPM
F16PA_PHOLL      DEATQRPYTTRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PSGKLRLLYECNPM
F16PA_PROMH      DATTNRPYTTRYIGSLVADFHRNLLKG-GIYIYPSTASH-------PNGKLRLLYECNPM
F16PA_PECAS      DEETQRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTASY-------PKGKLRLLYECNPM
F16PA_VIBCH      VPEEGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PNGKLRLLYECNPM
F16PA_VIBC3      VPEDGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PNGKLRLLYECNPM
F16PA_VIBVU      VPEDGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PQGKLRLLYECNPM
F16PA_VIBVY      VPEDGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PQGKLRLLYECNPM
F16PA_VIBPA      VPEDGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PQGKLRLLYECNPM
F16PA_VIBCB      VPEDGRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQSH-------PQGKLRLLYECNPM
F16PA_ALIFM      KPEDNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQAY-------PNGKLRLLYECNPM
F16PA_ALIF1      KPEDNRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQAY-------PNGKLRLLYECNPM
F16PA_ALISL      KPAENRPYTSRYIGSLVADFHRNLLKG-GIYLYPSTQAY-------PNGKLRLLYECNPM
F16PA_PHOPR      VPADNRPYTSRYIGSLVSDFHRNLLKG-GIYMYPSTAMY-------PNGKLRLLYECNPM
F16PA_AERS4      DEATHRPYTSRYIGSLVSDFHRNLLKG-GIYIYPSGTNS-------PNGKLRLLYECNPM
F16PA_AERHH      DEATHRPYTSRYIGSLVSDFHRNLLKG-GIYIYPSGTNS-------PNGKLRLLYECNPM
F16PA_HAHCH      DDATQRPYTSRYIGSLVSDFHRNLIKG-GIYLYPTSSRY-------PEGKLRLLYECNPM
F16PA_PSYIN      DGPTNRPYTSRYIGSLVSDFHRNLLKG-GIYIYPSTASA-------PKGKLRLLYECNPM
F16PA_HAEIE      DKATHRPYVSRYIGSLVADFHRNLLKG-GIYIYPSATNY-------PNGKLRLLYEGNPI
F16PA_HAEI8      DKATHRPYVSRYIGSLVADFHRNLLKG-GIYIYPSATNY-------PNGKLRLLYEGNPI
F16PA_HAEIN      DKATHRPYVSRYIGSLVADFHRNLLKG-GIYIYPSATNY-------PNGKLRLLYEGNPI
F16PA_HAES1      DKSTDRPYTSRYIGSLVSDFHRNMLKG-GIYIYPSATTY-------PKGKLRLLYEGNPM
F16PA_HISS2      DKSTDRPYTSRYIGSLVSDFHRNMLKG-GIYIYPSATTY-------PKGKLRLLYEGNPM
F16PA_PASMU      DKATHRPYTSRYIGSLVSDFHRNMLKG-GIYIYPSATNY-------PNGKLRLLYEGNPM
F16PA_MANSM      DAATNRPYTSRYIGSLVADFHRNLLKG-GIYIYPHATNY-------PQGKLRLLYEGNPI
F16PA_ACTSZ      DKATNRPYTSRYIGSLVSDFHRNMLKG-GIYIYPNATNY-------PNGKLRLLYEGNPM
F16PA_ACTP7      DEATKRPYSSRYIGSLVSDFHRNLLKG-GIYIYPTSTVY-------PKGKLRLLYEGNPM
F16PA_ACTPJ      DEATKRPYSSRYIGSLVSDFHRNLLKG-GIYIYPTSTVY-------PKGKLRLLYEGNPM
F16PA_ACTP2      DEATKRPYSSRYIGSLVSDFHRNLLKG-GIYIYPTSTVY-------PKGKLRLLYEGNPM
F16PA_HAEDU      DEASKRPYSSRYIGSLVSDFHRNLLKG-GIYIYPTSTVY-------PQGKLRLLYEGNPM
F16PA_DICNV      APEEHRPYKSRYIGSLVADFHRNMLKG-GVYMYPQASNY-------PNGKLRLSYECNPM
F16PA_FLAJ1      -EEEDRPYTSRYIGSLVADFHRNMIKG-GIYIYPTSSKA-------SKGKLRLLYECNPM
F16PA_FLAPJ      -EEGDRPYTSRYIGSLVSDFHRNMIKG-GIYIYPTSSKA-------PKGKLRLLYECSPM
F16A2_GRAFK      -EEGNRPYTSRYIGSMVSDIHRNMIKG-GIFMYPKSSKA-------SEGKLRLLYECNPF
F16A1_GRAFK      NEEENRPFTSRYTGSLVADFHRNMLLG-GIYLYPQGTTA-------PKGKLRLLYECNPM
F16PA_WIGBR      ----NNNISSRYTGSLVADFHRNLIKG-GIYLYPNTKIY-------KHGKLRLMYECNPI
F16PA_CYTH3      DFETSRPYSSRYIGSMVADFHRNLIKG-GIFMYPATAKY-------PLGKLRLMYECNPL
F16PA_CHLPM      DSATGRPYSTRYIGSLVADFHRNLLTG-GVFVYPPTTNH-------PNGKLRLMYEGNPL
F16PA_CHLL3      DPATGRPYSTRYIGSLVADFHRNLLTG-GVFVYPPTTKH-------PSGKLRLMYEANPL
F16PA_CHLPD      DPATGRPYSTRYIGSLVADFHRNLLTG-GIFVYPPTITH-------PNGKLRLMYEANPL
F16PA_PELPB      DPATNRPYSTRYIGSLVADFHRNLLTG-GVFVYPPTTKH-------LKGKLRLMYEANPL
F16PA_CHLL2      DPATGRPYSTRYIGSLVADFHRNLLTG-GVFVYPPTTTH-------TNGKLRLMYEANPL
F16PA_CHLCH      DKATNRPYSTRYIGSLVADFHRNLLTG-GIFIYPPTGKH-------PNGKLRLMYEANPL
F16PA_PROA2      DEATGRPYSTRYIGSLVADFHRNLMTG-GVFVYPATKGH-------PNGKLRLMYEANPL
F16PA_CHLPB      DAETGRPYSTRYIGSLVADFHRNLLTG-GVFVYPATKQH-------RNGKLRLMYEANPL
F16PA_CHLTE      DKATGRPYSTRYIGSFVADFHRNLLTG-GVFVYPATKKH-------KNGKLRLMYEANPM
F16PA_CHLP8      DKATGRPYSTRYIGSFVADFHRNLLTG-GVFIYPATKKH-------KNGKLRLMYEANPM
F16PA_CHLT3      DKASKRPYSARYIGSCVADFHRNLLYG-GIFIYPRTAKS-------PKGKLRLMYEANPL
F16A2_SALRD      DPETNRPAKTRYIGSFVSDFHRNLLKG-GIYMYPATESS-------PAGKLRLMYEANPM
F16A1_SALRD      DPDTGHRIRARYIGSFVSDFHRNLLTG-GLYMYPATSDH-------PDGKLRLMYEANPM
F16PA_NOSS1      E-----GYTARYSGAMVSDIHRILVQG-GVFLYPGTIQN-------PEGKLRLLYESAPL
F16PA_TRIV2      E-----GYTARYSGAMVSDIHRILVQG-GVFLYPGTVQN-------PEGKLRLLYESAPL
F16PA_NOSP7      E-----GYSARYSGAMVSDIHRILVQG-GVFLYPGTIQN-------PEGKLRLLYETAPL
F16PA_MICAN      D-----GYTARYSGALVGDIHRILMQG-GVFLYPGTVKN-------PQGKLRLIYETAPL
F16PA_CROS5      E-----GYTARYSGALVGDIHRILMQG-GVFLYPGTVKK-------PEGKLRLLYESAPL
F16PA_SYNY3      E-----GYTARYSGALVGDIHRILMQG-GVFLYPGTEKN-------PDGKLRLLYETAPL
F16PA_SYNP2      E-----GYTARYSGALVGDLHRILMQG-GVFLYPGTKKK-------PEGKLRLLYETAPL
F16A1_ACAM1      E-----GHTARYSGALVGDFHRILFQG-GVFIYPGTLKN-------PDGKLRLLYESAPL
F16PA_TRIEI      E-----GYTARYGGALVGDFHRILYQG-GVFLYPGTVKK-------PEGKLRLLYESAPM
F16PA_THEEB      P-----GYSARYSGALVADIHRILMEG-GVFLYPGTQKN-------PAGKLRLLYEAAPI
F16PA_SYNE7      E-----GYSGRYSGALVADFHRILMQG-GVFLYPETVKN-------PTGKLRLLYEAAPM
F16PA_SYNP6      E-----GYSGRYSGALVADFHRILMQG-GVFLYPETVKN-------PTGKLRLLYEAAPM
F16PA_SYNJA      D-----GYTARYSGALVADFHRILLQG-GVYLYPGTRQK-------PEGKLRLMYEANPL
F16PA_SYNJB      D-----GYISRYSGALVADFHRILLQG-GVYLYPGTQKK-------PEGKLRLMYEANPL
F16PA_GLOVI      KSRGEKAYSARYIGSLAADVHRTLLTG-GIFLYPGTVAK-------PKGKLRLLYEAQPL
F16PA_DESVH      HNERGKPYSLRYVGSLVADFHRTLLYG-GIFMYPMDYRHPDK----PQGKLRLMCEASPL
F16PA_DESVV      HNERGKPYSLRYVGSLVADFHRTLLYG-GIFMYPMDYRHPDK----PQGKLRLMCEASPL
F16PA_DESAG      DNPLGKPYSLRYVGSLVADFHRNLFYG-GIFMYPMDYRLPEK----PQGKLRLMCEASPL
F16PA_LAWIP      -SSKEKVRSARYVGSLVADFHRTLLYG-GVFMYPSDNRK-GK----MHGKLRYLCEASPL
F16PA_LEPIN      EG-GRKPQSGRYIGSLVADFHRNLLKG-GIFLYPNDTKSTKY----PNGKLRLLYEAAPM
F16PA_LEPIC      EG-GRKPQSGRYIGSLVADFHRNLLKG-GIFLYPNDTKSTKY----PNGKLRLLYEAAPM
F16PA_LEPBL      EG-GKKPQSGRYIGSLVADFHRNLLKG-GIFLYPNDTKSTKY----PNGKLRLLYEAAPM
F16PA_LEPBJ      EG-GKKPQSGRYIGSLVADFHRNLLKG-GIFLYPNDTKSTKY----PNGKLRLLYEAAPM
F16PA_LEPBP      EG-GKKPKTARYIGSLVADFHRNLLKG-GIFLYPNDTKSSKY----PNGKLRLLYEAAPM
F16PA_LEPBA      EG-GKKPKTARYIGSLVADFHRNLLKG-GIFLYPNDTKSSKY----PNGKLRLLYEAAPM
F16PA_SORC5      SKPEGRPYGARYVGSLVADAHRTLLKG-GIFAYPADRSG--------QGKLRLLYEASPF
F16PA_SULSY      G------YTSRYIGSMVADVHRTLIKG-GIFAYPADVKN-------KNGKLRLLYEASPM
F16A2_ACAM1      K--SHTAHTLRYSGALVADVHRCLLEG-GLYFYPPTADQ-------PEGKLRLLYECAPL
F16PA_AMOA5      E------LTSRYTGALVADFHRHLLEG-GIYLYPPTYKR-------PKGKLRLMFECNVL
F16PA_SYNAS      IQVNISKYKFRYIGALAGDFHRLLTNG-GLFMYPAIVKHPDPKENRPQGKLRLLYEANVV
F16PA_GEOBB      RHLEEKGCKLRYSGGFVPDINQVLMKGKGLFMYPALNGSP-------NGKLRVLFELNPM
F16PA_GEOUR      RYLEAKGCKLRYSGGFVPDINQVLMKGKGLFMYPALNGSP-------NGKLRLLFELNPM
F16PA_GEOMG      RYLEEKGAKLRYSGGFVPDINQVIMKGKGIFMYPALNGSP-------NGKLRLLFELNAM
F16PA_GEOSL      QHLESKGSKLRYSGGFVPDINQVLMKGKGIFMYPALNGSP-------NGKLRVLFELNPM
F16PA_PELPD      RYLEAKGSKLRYSGGFVPDINQVLIKGKGVFMYPALTDSP-------NGKLRLLFELNPM
F16PA_GEOLS      RYLEDKGSKLRYSGGFVPDINQILMKGKGIFMYPALTDSP-------NGKLRLLFELNPM
F16PA_PELCD      RQLETNGVKLRYSGGLVPDINQMLMKGKGIFFYPHLQNAP-------QGKLRLLFELNPM
F16PA_METLZ      NAIECEGGKNRYSGSFVADFHQILEYG-GVYAYPATKKSA-------SGKLRLVFEINPI
F16PA_METHJ      EYFDQNGFKIRYSGSFVADCHQLLVYG-GIYTYPGSEKSP-------NGKFRLLFEANPL
F16PA_METB6      SCLENEGYKLRFSGCFVADVHQILHKG-GVFSYPGYKGKE-------SGKLRLLYEANPM
F16PA_HELPY      ------NYRLRYSGSMVADVHHVLVKKGGMFSYPQK-------------KLRKLFEVFPL
F16PA_HELPS      ------NYRLRYSGSMVADVHHVLIKKGGMFSYPQK-------------KLRKLFEVFPL
F16PA_HELPG      ------NYRLRYSGSMVADVHHVLIKKGGMFSYPQK-------------KLRKLFEVFPL
F16PA_HELPH      ------NYRLRYSGSMVADVHHVLIKKGGMFSYPQK-------------KLRKLFEVFPL
F16PA_HELPJ      ------NYRLRYSGSMVADVHHVLVKKGGMFSYPQK-------------KLRKLFEVFPL
F16PA_HELAH      ------NYRLRYSGSMVADVHHVLIKKGGVFSYPQK-------------KLRKLFEVFPL
F16PA_CAMC5      ------GYRLRYSGAMVSDLHQILLKGGGLFSYPATSDHP-------NGKLRLLFEVLPF
F16PA_CAMC1      ------GYRLRYSGAMVSDLHQILLKGGGLFSYPATSDHP-------NGKLRVVFEVLPF
F16PA_CAMHC      ------GYRLRYSGAMVADLHQILMKKGGIFSYPATSDHP-------NGKLRVSFEVLPF
F16PA_CAMFF      ------GYRLRYSGAMVSDLHQILLKGGGLFSYPATTDAP-------NGKLRVTFEVLPF
F16PA_CAMJJ      ------GYRLRYSGAMVSDINQILLKGGGIFSYPATQDAP-------NGKLRAFFEVFPL
F16PA_CAMJ8      ------GYRLRYSGAMVSDINQILLKGGGIFSYPATQDAP-------NGKLRAFFEVFPL
F16PA_CAMJE      ------GYRLRYSGAMVSDINQILLKGGGIFSYPATQDAP-------NGKLRAFFEVFPL
F16PA_CAMJR      ------GYRLRYSGAMVSDINQILLKGGGIFSYPATQDAP-------NGKLRAFFEVFPL
F16PA_CAMJD      ------GYRLRYSGAMVSDINQILLKGGGIFSYPATQDAP-------NGKLRAFFEVFPL
F16PA_ARCB4      ------GYRLRYSGGMVPDLHQILLKGGGLFSYPGTSDKP-------KGKLRQLFEVFPF
F16PA_SULDN      ------GYRLRYSGGMVPDLHQILLKGGGLFSYPSTSDKP-------DGKLRKLFEVFPF
F16PA_NITSB      ------GYRLRYSGGMVPDLHQILVKKGGLFSYPGTKDKP-------RGKLRKVFEVFPF
F16PA_SULNB      ------GYRLRYSGGMVPDLHQILLKGGGIFSYPGTSDKP-------HGKLRQLFEVIPF
F16PA_WOLSU      ------GYRLRYSGGMVPDLHNILIKGGGLFSYPGASDNP-------KGKLRMLFEALPF
F16PA_HELHP      ------GYRLRYSGGMVPDLHQILIKGGGLFSYPATSDAP-------NGKLRKLFEVFPF
F16PA_HALSA      -------LKLRYGGAMIADVNQVLVY-GGVFGYPGMESAP-------DGKLRAQFEALPI
F16PA_HALS3      -------LKLRYGGAMIADVNQVLVY-GGVFGYPGMESAP-------DGKLRAQFEALPI
F16PA_NATPD      -------LKLRYGGAMIGDVNQVLTY-GGVFGYPGLEDRP-------EGKLRLLFEGHPI
F16PA_HALWD      ------SMKLRYGGAMVGDVNQVLTY-GGIFGYPALTNAP-------SGKLRVQFEGYPI
F16A1_HALMA      -------LKLRYGGAMVADINQVLTY-GGIFSYPALESRP-------EGKLRVQFEGHPM
F16A2_HALMA      -------LKLRYGGATVADLAQVLEY-GGLFGYPVTSGYP-------NGKLRVHFESAPL
                           *: .    :  .      *:: *                ::    *   .

F16A2_CUPNH      AFLMEQAGGR-AS---TGRQTLMSVA--PGALHQRIGVIFGSRNEVERIEGYHTDQTDPD
F16A3_CUPNH      AFLMEQAGGR-AS---TGRQTLMSVA--PGALHQRIGVIFGSRNEVERIEGYHTNQTDPD
F16A2_CUPTR      AFLMEQAGGR-AS---TGRQALMSVA--PNALHQRIGVIFGSRHEVERIERYHNEQTDPD
F16A2_CUPMC      AMLMEQAGGR-AS---TGREPILGVS--PTALHQRIGLIFGSKDEVERIERYHQEPASNE
F16A2_LEPCP      GMLMEQAGGR-AS---TGRQPMLGVK--PTSLHQRIGLVFGSKNEVERIERYHHEPVTRE
F16A2_POLNA      GFIMEQAGGR-AS---TGREPMLGVQ--PTSLHQRIGLIFGSKNEVERIERYHAEPARAE
F16A1_RHOFT      GMLMEQAGGR-AS---TGELPMLDVQ--PTSLHQRIGLVFGSKNEVERIERYHAEPVQAE
F16PA_HYDTE      GMIVEQAGGR-AS---TGYGPVLEVQ--PTELHQRIGFVFGSREEVERIEQYHNDPDASP
F16A3_METPP      SFLIEQAGGM-AS---TGRKRLLEVQ--PEDIHQRIGFVFGSTEEVARIEAYHRDEPPTP
F16PA_RHORT      AFLMEQAGGR-CT---TGTRTMLDLV--PGSLHERVPLIFGSAVEVERVETLYREPQRRE
F16A2_DECAR      AMLIEQAGGA-AS---TGRQRILDVV--PDSLHQRAPVILGSKNEVERLARYHHEYDTGA
F16A2_PARXL      SFLVEQAGGL-SI---TGRERILDVV--PRALHGRVPVILGSKHEVERIGRYHGEYDRGE
F16PA_METI4      GFIVEQAGGM-IS---TGRESILDIV--PRSLHQRIAVILGSKEEVELLNRYHNDYDSGK
F16PA_MAGSA      AFIVEQAGGA-AT---TGRGRMMEVP--PTGLHQRVPVILGSKEEVERIGAYHAEYDAKK
F16PA_METFK      SLLVEQAGGL-AT---TGHRRILDVE--PAGLHQRVAVMMGAREEVERLQDYHSFTDPTA
F16A1_METPP      AWLMEQAGAA-AT---TGTGPLLELV--PDALHHKVPVILGSRDEVERIVTYHEDPSANV
F16PA_NITEC      SFIVEQAGGL-ST---TGYERILDIS--PENLHQRVPVILGSKNEVEVVLGYHKA-----
F16PA_NITEU      SFIVEQAGGL-ST---TGYERILDVV--PQDLHQRVPVILGSKNEVEVVLEYHNA-----
F16PA_THIDA      AFIVEQAGGA-AT---TGYQRILDIA--PEGLHQRVPVILGSKTEVDTVTGYHHEKAA--
F16PA_NITOC      SFIVEQAGGV-SS---TGDQRILEIN--PEGIHQRVPVILGSKNEVERVIAYHQEA----
F16PA_ACIF5      SYLVEQAGGA-AS---TGTTRILDIV--PQGLHQRIPVILGAKNEVERVVAYHQGSFVIP
F16PA_HALHL      SLIVEQAGGG-AT---TGRQRILELD--PSDIHERAPVVLGSRNEVERIARYHQEG----
F16PA_DELAS      AWLVEQAGGA-AT---NGKQRILDIQ--PTQLHERVSVILGSKNEVEKVTQYHSEA----
F16PA_ACISJ      GWLVEQAGGA-AT---NGRQRILDIQ--PAQLHERVSVILGSKNEVDRVTSYHSGI----
F16PA_POLSJ      GWIVEQAGGS-AT---NGKQRILDIQ--PGKLHERVSVILGSKNEVERVTGYHSGL----
F16PA_ACIAC      SWLIEQAGGA-AT---NGKERILDIQ--PKQLHERVSVILGSKNEVERVTRYHSGI----
F16A1_POLNA      SWLIEQAGGA-AT---NGKQRILDIQ--PTKLHERVSVILGSKNEVERLTAYHSGL----
F16PA_VEREI      GWLVEQAGGA-AS---NGRQRILEIQ--PTHLHERVSVILGSKNEVERVALYHGAR----
F16A2_RHOFT      AWLIEQAGGA-AS---TGKQRILDLQ--PGKLHERVSVFLGSKNEVERIARYHGEA----
F16A1_LEPCP      AFLVEQAGGA-AT---NGEQRIMDLM--PGKLHERVSVMMGSKNEVERVSQYHREHREAA
F16A2_METPP      GFIVEQAGGA-AT---NGKQRVLDLQ--PSQLHERVSVILGSKNEVERASAYHREAG---
F16A1_CUPTR      AMLVEQAGGA-AT---NGEQRILDVQ--PEKLHQRVSVILGSKNEVERVTRYHQEAQAKA
F16A1_CUPNH      AMLVEQAGGA-AT---NGHQRIMDVQ--PEKLHQRVSVILGSKNEVERVTRYHLEAEDKA
F16PA_CUPPJ      AMLIEQAGGA-AT---NGHIRILDVQ--PEKLHQRVSVILGSKNEVERVTRYHHEAAGQQ
F16A1_CUPMC      AFLVEQAGGA-AT---NGQQRILDVE--PTKLHQRVSVILGSKNEVERVTRYHQEDAAKA
F16PA_RALSO      AFLVEQAGGA-AT---NGHQRILEIQ--PEKLHQRVAVILGSKNEVDRVTQYHREAQQTA
F16PA_RALPJ      AFLVEQAGGA-AT---NGEQRILDIQ--PEKLHQRVAVVLGSKNEVDRVTQYHLEAKQTP
F16PA_BORBR      GLIVEQAGGA-AI---DGTGRILDIQ--PDKLHQRVSVILGSKNEVERVGRYHAEAHAS-
F16PA_BORPA      GLIVEQAGGA-AI---DGTGRILDIQ--PDKLHQRVSVILGSKNEVERVGRYHAEAHAS-
F16PA_BORPE      GLIVEQAGGA-AI---DGTGRILDIQ--PDKLHQRVSVILGSKNEVERVGRYHAEAHAS-
F16PA_BORPD      SMIIEQAGGA-AI---DGTRRILDIQ--PDKLHQRVSVILGSKNEVERVGRYHAEAAQAP
F16PA_BORA1      SFIVEQAGGA-SI---NGTQRILDIQ--PEQLHQRVSVILGSKNEVERVGRYHSESLT--
F16PA_JANMA      AFIVEQAGGA-AT---DGQQRILDIQ--PEKLHQRVPVFLGSKNEVELVTSYHKAK----
F16PA_HERAR      AFLVEQAGGA-AT---DGQQRILDIQ--PEKLHQRVPVFLGSKNEVDLVTSYHKTK----
F16PA_HERSE      AFIVEQAGGA-AT---DGTRRILDIQ--PEKLHQRVAVFLGSKNEVDLVTSYHQQ-----
F16PA_PARL1      GFLIEQAGGM-AF---DGNHRILDIE--PKALHQRVGVVMGDRDEVKRVVQYHHDANLAK
F16A1_PARXL      AFIVEQAGGA-AT---NGEKRILDIQ--PKSLHERVAVFLGSKNEVDRVTRYHLETKK--
F16PA_PARPJ      AFIVEQAGGA-AT---NGEKRILDIQ--PKSLHERVAVFLGSKNEVDRVTRYHLETKK--
F16A1_PARP8      SFIVEQAGGA-AT---NGEKRILDIQ--PKSLHERVAVFLGSKNEVDRVTRYHLEKKS--
F16PA_BURCA      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVKRVTGYHDEAK---
F16PA_BURCH      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVKRVTGYHDEAK---
F16PA_BURCC      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTGYHDEAK---
F16PA_BURCJ      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTGYHDEAK---
F16PA_BURL3      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVDRVTGYHQEKQ---
F16PA_BURM1      AFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTAYHHESQ---
F16PA_BURA4      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTSYHAEGEGK-
F16PA_BURCM      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTGYHAEGEGK-
F16PA_BURVG      SFIVEQAGGA-AT---TGTQRIMEVQ--PTGLHQRVPVFLGSKNEVERVTAYHNEGK---
F16PA_BURM9      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURMS      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURPS      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURMA      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURP1      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURP0      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURP6      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURM7      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHEQAQS--
F16PA_BURTA      SFIVEQAGGA-AT---TGLKRILDVQ--PTGLHQRVPVILGSKNEVERVARYHQEAQS--
F16PA_PSEP1      SFIIEQAGGA-ST---NGYDRILDIK--PESLHQRVSVILGSKEEVERVTAYHKE-----
F16PA_PSEE4      SFIIEQAGGA-ST---NGYDRILDIK--PESLHQRVSVILGSKEEVERVTAYHKE-----
F16PA_PSEPK      SFIIEQAGGA-ST---NGYDRILDIK--PESLHQRVSVILGSKEEVERVTAYHKE-----
F16PA_PSEPG      SFIIEQAGGA-ST---NGYDRILDIK--PESLHQRVSVILGSKEEVERVTAYHKE-----
F16PA_PSEPW      SFIIEQAGGA-ST---NGYERILDIK--PESLHQRVSVILGSKEEVERVTAYHKE-----
F16PA_PSESM      SFLVEQAGGA-ST---DGHQRILDIQ--PEGLHQRVAVYLGSKEEVERATAYHKE-----
F16PA_PSEU2      SFLVEQAGGA-ST---DGHQRILDIQ--PEGLHQRVAVYLGSKEEVERATAYHKA-----
F16PA_PSE14      SFLVEQAGGA-ST---DGHQRILDIQ--PEGLHQRVAVYLGSKEEVERATAYHKE-----
F16PA_PSEPF      SFLVEQAGGA-ST---DGHQRILDIK--PEGLHQRVAVFLGSKEEVARATAYHKE-----
F16PA_PSEF5      SFLVEQAGGA-ST---DGHKRILDIQ--PEGLHQRVAVFLGSKEEVARVTGYHKE-----
F16PA_PSEA7      SFIIEQAGGA-AT---NGTQRILDIK--PENLHQRVAVFLGSKQEVERITGYHKE-----
F16PA_PSEAE      SFIIEQAGGA-AT---NGTQRILDIK--PENLHQRVAVFLGSKQEVERITGYHAE-----
F16PA_PSEAB      SFIIEQAGGA-AT---NGTQRILDIK--PENLHQRVAVFLGSKQEVERITGYHAE-----
F16PA_PSEMY      SMIIEQAGGA-AT---DGSQRILDIQ--PTSLHQRVPVFLGSKEEVLRVTAYHRG-----
F16PA_PSEU5      SMIIEQAGGA-AT---TGTQRILEIQ--PQSLHQRVPVFLGSKEEVERVTGYHQG-----
F16PA_CHRVO      AFIIEQAGGA-AT---NGHQRILDIV--PTKLHERVAVFLGSKEEVELVTRYHSEQQ---
F16PA_AROAE      AMIVEQAGGS-AT---TGRQRILDVQ--PAKLHQRVPVILGSTHEVERVTAYHREG----
F16PA_AZOSB      AMLVEQAGGA-AT---TGRERILDLM--PTKLHQRVPVILGSRNEVERVTAYHRES----
F16A1_DECAR      AMLIEQAGGA-AT---TGRQRILDIQ--PEKLHQRVPVILGSKNEVERVTGYHSA-----
F16PA_XANAC      SMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAEATRYHLDADKA-
F16PA_XANC5      SMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAEATRYHLDADKA-
F16PA_XANOM      SMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAAATRYHLDADKA-
F16PA_XANOP      SMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAAATRYHLDADKA-
F16PA_XANOR      SMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAAATRYHLDADKA-
F16PA_XANCP      GMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAEATRYHVEFDKAQ
F16PA_XANC8      GMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAEATRYHVEFDKAQ
F16PA_XANCB      GMLVEQAGGA-AT---TGRERILDIQ--PTQLHQRVPVFLGSKNEVAEATRYHVEFDKAQ
F16PA_STRM5      GLLVEQAGGA-AW---TGRERILDIQ--PDQLHQRVPVFLGSREEVAEAVRYHHAHDDAR
F16PA_STRMK      GLLVEQAGGA-AW---TGRERILDIQ--PDQLHQRVPVFLGSREEVAEAVRYHHAHDNAQ
F16PA_SHEB8      AFLVEQAGGK-AS---TGYETILDIT--PTHIHQRVAVILGSSNEVDACLSYHGIDYSEE
F16PA_SHEB5      AFLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSSNEVDACLSYHGIDYSEE
F16PA_SHEB9      AFLVEQAGGK-AS---TGYETILDIT--PTHIHQRVAVILGSANEVDACLSYHGIDSHK-
F16PA_SHESR      ALLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSANEVDACLSYHGIDYSEE
F16PA_SHESM      ALLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSANEVDACLSYHGIDYSEE
F16PA_SHESA      ALLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSANEVDACLSYHGLDYSEE
F16PA_SHEPC      AFLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSSNEVDACLSYHGLDYSEE
F16PA_SHESW      AFLVEQAGGK-AS---TGYETILDIQ--PTHIHQRVAVILGSANEVDACLSYHGLDYSEE
F16PA_SHEON      AFLVEQAGGK-AS---TGYETILDIQ--PTQIHQRVAVILGSANEVDACLSYHGIDSRK-
F16PA_SHEHH      AFLVEQAGGK-AS---TGYETIMDIE--PTAIHQRVAVILGSANEVDACLEYHGIDYSEE
F16PA_SHEPA      AFLVEQAGGK-AS---TGYETIMDIQ--PTEIHQRVAVILGSANEVDACLEYHGIDYSEE
F16PA_SHESH      SFLVEQAGGK-AS---TGYETIMDIQ--PSEIHQRVAVILGSANEVDACLNYHGLDYSEE
F16PA_SHEWM      SFLVEQAGGI-AS---TGYEAIMDIE--PSEIHQRVAVILGSANEVKACLEYHSLDYSEE
F16PA_SHELP      SFLVEQAGGK-AS---TGYETIMDIL--PSEIHQRVAVILGSANEVDACLEYHGQDYSEE
F16PA_SHEDO      AFLVEQAGGK-AS---NGYETILDIT--PSEIHQRVAVILGSANEVDTCLSYHGIDYREE
F16PA_SHEFN      ALLVEQAGGK-AS---TGYETILDIQ--PTEIHQRVAVILGSANEVDTCLSYHGIDYSEE
F16PA_SHEAM      AFLVEQAGGK-AS---TGYETILDIA--PSEIHQRVAVILGSANEVDACLGYHN------
F16PA_MARMS      AMLLEQAGGK-AH---THTQRILDIQ--PEAIHQRVAVILGAANEVDKCLSY--------
F16PA_ALTMD      AFLMEQAGGK-AE---TGTGRILEVM--PEEIHQRVPCIIGSKEEVDMCLSYNDNAK---
F16PA_PSEA6      AFLMEQAGGL-AS---TGQGRILEVM--PTEIHQRVPVILGSKEEVETCLSYYKA-----
F16A1_PSET1      AMLVEQAGGI-AS---TGTERIMDIQ--PNAIHQRVAVILGSKNEVETCLGYHK------
F16PA_COLP3      AFLLEQAGGL-AM---TSEGRIMDIE--PNSIHQRVEVIMGSKNEVEKCLSYYN------
F16PA_IDILO      AMLVEKAGGK-AT---DGYSRLMEIV--PEHIHQRVSVVMGSANEVDVCMDYHKQHPKPY
F16PA_CELJU      AMLTENAGGK-AW---SENQRILNIQ--PDSLHQRVAVILGSANEVDVCMSYLLE-----
F16A2_PSET1      ALLVENAGGK-AT---SKGARILDIA--PTNLHQRVPVVLGSIAPAEYFNSTVYNSNAKY
F16PA_SACD2      ALLIERAGGK-AF---NETQRILDVT--PCALHERIAVILGSEQEVATCLEYLN------
F16PA_HYDCU      SMIVEQAGGA-SS---TGRMDIMDVA--PQGIHDRVPVVLGSKNEVAKVVAYHTK-----
F16PA_ACIBC      SMLIEQAGGA-ST---TGRVRILEIE--PTELHQRVPVIIGSKNEVERVTSYH-------
F16PA_ACIBS      SMLIEQAGGA-ST---TGRVRILEIE--PTELHQRVPVIIGSKNEVERVTSYH-------
F16PA_ACIBT      SMLIEQAGGA-ST---TGRVRILEIE--PTELHQRVPVIIGSKNEVERVTSYH-------
F16PA_ACIBY      SMLIEQAGGA-ST---TGRVRILEIE--PTELHQRVPVIIGSKNEVERVTSYH-------
F16PA_ACIAD      SFLIEQAGGS-AT---TGRVRIMDIQ--PNDLHQRVPVIIGSKNEVDLVTSYH-------
F16PA_PSYA2      SLLIERAGGG-AT---DAVNRILDIE--PTDIHQRVPVVLGSKNEVDYVKNLHLNYAEK-
F16PA_PSYCK      SLLIERASGG-AT---DAVNRILDIE--PIDIHQRVPVVLGSKNEVDYIKELHLNHTDK-
F16PA_PSYWF      SLLIERAGGA-ST---DALNRIMDCE--PTDIHQRVAVVLGAKNEVEYVQKLHQQA----
F16PA_NEIM0      SLILEQAGAS-AS---NAYQAMLDIQ--PENLHQRVAVFMGSSEEVDYLNRLHSK-----
F16PA_NEIMB      SLILEQAGAS-AS---NAYQAMLDIQ--PENLHQRVAVFMGSSEEVAYLDRLHAK-----
F16PA_NEIMF      ALILEQAGAS-AS---NARQDILGIR--PESLHQRVAVIMGSSEEVDYLNRLHSK-----
F16PA_NEIMA      ALILEQAGAS-AS---NARQDILGIR--PESLHQRVAVIMGSSEEVDYLNRLHSK-----
F16PA_NEIG1      ALILEQAGAS-AS---NAYQAMLDIQ--PESLHQRVAVIMGSSEEVDYLNRLHSK-----
F16PA_NEIG2      ALILEQAGAS-AS---NAYQAMLDIQ--PESLHQRVAVIMGSSEEVDYLNRLHSK-----
F16PA_POLAQ      SFLVEQAGGA-ST---NGTQLIMDLQ--PTDLHERVSVMLGSKEEIDRLQHYHSSLA---
F16PA_POLNS      SFLVEQAGGV-ST---NGTDLIMDLQ--PTDLHERVSVMLGSKEEIDRIQHYHS------
F16PA_CAUVC      SLLAERAGGK-SI---EGLNEILDIN--PAKLHQRVPVVLGSANEVEVIRAEMRAG----
F16PA_CAUSK      SLIVERAGGKSTL---DGVTAILDVQ--PTKLHQRVPVVLGSANEVDQVAAG--------
F16PA_ALKEH      SMLMEQAGGE-AF---TGKERALDLQ--PEALHQRSGLMLGSREEVEVLRRYYAEQ----
F16PA_NITVU      AFIVEQAGGG-AS---TGRKRVLDI--VPDSLHQRVPLIMGSIKNVQRLEHMHTVPDV-A
F16PA_NITWN      AFIVEQAGGG-AS---TGRKRVLDL--VPGSLHQRVPLIMGSIKNVQRLEHLHTVPDG-A
F16A2_NITHX      AFIIEQAGGG-AS---TGRKRILDI--VPGSLHQRVPLIMGSIKNVRRLEDMHTGPNV-A
F16A1_NITHX      AFIIEQAGGG-AS---TGRKRILDI--VPGSLHQRVPLIMGSIKNVRRLEDMHTGPNV-A
F16PA_BRADU      AYIIEQAGGS-AS---TGRERILDL--SAQSLHQRVPLIMGSSNEVRRVEELHCDPLL-V
F16PA_RHOPB      AFIIEQAGGG-AS---TGRERVLDL--AAKSIHQRAPLIMGSVDKVQRIELLHNDPA--A
F16PA_RHOP5      AFIMEQAGGG-AS---TGREHVLDL--AARTIHQRAPLIMGSIDKVNRVELLHNDPD--A
F16PA_RHOPA      SFVMEQAGGA-AS---TGRERVLDL--TAKTIHQRSPLIMGSIDKVKRIELLHTDPS--A
F16PA_RHOPT      SFVMEQAGGA-AS---TGRERVLDL--TAKTIHQRSPLIMGSIDKVKRIELLHTDPS--A
F16PA_RHOP2      AFVMEQAGGA-AS---TGRERVLDV--VASTTHQRSPLIMGSSDKVHRIVELHLDPA--A
F16PA_RHOPS      AFVMEQAGGA-AS---TGRERVLDLSAAATSTHQRSPLIMGSSDKVNRIVELHLDPS--A
F16PA_BRASO      ALIMEWAGGS-AS---SGRARILEL--SARSPHQRAPLIMGDVRLVRDVDMLHEGVEPLF
F16A2_BRASB      ALIMEWAGGS-AS---SGRSRILEL--SARSPHQRAPLIMGDVRLVRDVDQLHEGVEPLF
F16PA_RHIME      AFIIENAGGA-AT---TSIDRILDL--VPENLHQRVPLVFGSRREVARITRYHVDPNM--
F16PA_SINMW      AFIVENAGGS-AT---TSVDRILDL--VPESLHQRVPLVFGSRREVARITRYHVDPNM--
F16PA_XANFL      AFLMEQASGS-AT---DGRGAILDL--SATGLHQRVPFIFGSRDEVARVSRYHLEPNG--
F16A1_XANP2      AFLMEQAQGS-AI---DGRSSILDL--SATGVHQRVPFIFGSRDEVARAARYHLEPSG--
F16A2_CERSP      AFLIANVGGG-AT---DGCADILTA--LPDRLHARTPFVFGCASKVARVAAYHDLAC---
F16A2_CERS4      AFLIANVGGG-AT---DGCADILTA--LPDRLHARTPFVFGCASKVARVAAYHDLAC---
F16A2_RHOS1      AFLIANVGGR-AT---DGCADILTA--LPDRLHARTPFVFGCASKVARVAAYHDLAC---
F16A2_CERS5      AFLITQAGGG-AS---DGCDPILTA--LPDRLHARTPFVFGCAGKVACVAAYHDLPG---
F16PA_RHOCB      AFLITQVGGG-AT---DGCEDILSA--LPDKLHARTPFVFGCAAKVARVTAYHDLPG---
F16A1_RHOS1      AFVITQAGGG-AT---DGENPILGQ--TPSRLHARTPFVFGSAEKVARITAYHDLPE---
F16A1_CERS4      AFVITQAGGG-AT---DGENPILGQ--TPSRLHARTPFVFGSAEKVARITAYHDLPE---
F16A1_CERSP      AFVITQAGGG-AT---DGENPILGQ--TPSRLHARTPFVFGSAEKVARITAYHDLPE---
F16A1_CERS5      AFVITQAGGG-AT---DGENPILGQ--TPARLHARTPFIFGSAEKVARITAYHDLPE---
F16PA_PARDP      AFLIEQAGGG-AT---DGRTAILEQ--GAPTLHQRTPFVFGSAEKVARIAAYHELPE---
F16A1_BRASB      AFIVERAGGK-AT---DGIDRILDL--TPSELHQRTPLVFGTAEKVSQVCAYHDLPE---
F16PA_METEP      AFLIEQAGGG-AT---DGQGRILER--VAAKIHERSPLVFGSTEEVECVGKYYDGRQP--
F16PA_METPB      AFLIEQAGGA-AT---DGQARIMER--VATKIHERSPLVFGSTEEVECVAKYYDGRQP--
F16PA_METRJ      AMLVEQAGGA-AT---DGQTRILDI--VANGIHERAPLVCGSTEEVTCVATYYAGGKP--
F16PA_AZOC5      AFVTEQAGGA-AT---DGTTRILDI--QPKQIHQRIPLVFGSREEVAHIASYY-------
F16A2_XANP2      AFLTEQAKGA-AT---DGKTRILDI--QPHHIHQRIPLVFGSKAEVEKIASYY-------
F16PA_ACICJ      AFLMEQAGAS-AT---DGRIPILDL--QPAHIHQRCPLVFGSADEVRRVAQAYERAGQ--
F16PA_BRUC2      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEELDILGEYFVK-----
F16PA_BRUSU      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEELDILGEYFVK-----
F16PA_BRUAB      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUO2      AFLAREAGSK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUA2      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUA1      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUSI      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUME      AFLAREAGGK-AT---DGSRPILDI--VPQTYHERSALVFGVAEEVDILGEYFVK-----
F16PA_BRUA4      AFLAREAGGK-AT---DGSRSILDI--VPQTYHERSALVFGVAEEVDILGEYFAK-----
F16A3_PSET1      AFLVEQANGL-AS---NGTTSILDTV--PSSIHQRIPVFIGSKNEVLLIEKYALGK----
F16PA_ECOLI      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_SHIFL      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_SHIBS      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOK1      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOUT      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOL5      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_SHIF8      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_SHIB3      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECODH      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOSM      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOLC      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOL6      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECO24      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECOHS      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_SHIDS      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_ECO57      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFICEFPDA-
F16PA_ECO5E      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFICEFPDA-
F16PA_SHISS      AFLAEQAGGKASD---GKE-RILDII--PETLHQRRSFFVGNDHMVEDVERFIREFPDA-
F16PA_CITK8      AFLAEQAGGKASD---GKE-RILDIT--PESLHQRRPFFVGTDHMVEDVERFIREFPDA-
F16PA_SALTY      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALPA      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALCH      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALEP      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALDC      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALA4      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALPK      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALSV      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALHS      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALNS      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALPB      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALTI      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALG2      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVDDVERFIREYPDA-
F16PA_SALAR      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNRHMVEDVERFIREYPDA-
F16PA_ENT38      AFLAEQAGGKASD---GKE-RILDIT--PESLHQRRSFFVGNNHMVEDVERLIREYPDA-
F16PA_KLEP3      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNNHMVEDVENFIKAFPDA-
F16PA_KLEP7      AFLAEQAGGKASD---GKE-RILDII--PESLHQRRSFFVGNNHMVEDVENFIKAFPDA-
F16PA_CROS8      AFLAEQAGGKASD---GKQ-RILDIK--PDSLHQRRPFFVGTEQMVNDVERFIREFPDA-
F16PA_ERWT9      AFLAEQAGGKASD---GKN-RILDLV--PETLHQRSPFFVGNDHMVNDTERFLREYPDN-
F16PA_SODGM      AFLAEQAGGKASD---GKN-RILDIQ--PHELHQRSAFFTGTESMVNDVERFIRDYPDNV
F16PA_YERPN      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPA      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPE      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPS      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPB      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPY      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPG      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERP3      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERPP      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_YERE8      AFLAEQAGGKATD---GVN-RILDIV--PEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEE
F16PA_SERP5      AFLAEQAGGKASD---GKN-RILDIT--PVKLHQRAPFFVGTKSMVEDAERFIAENPDE-
F16PA_PHOLL      AFLAEQAGGKASD---GAN-RILDIT--PSKLHQRVPFFVGSKSMVEKAESFMAEFPDE-
F16PA_PROMH      AFLAEQAGGKASN---GKD-RILDIK--PTELHQRMPFFVGTKAMVEQAEAFMAQYPDEE
F16PA_PECAS      AFLAEQAGGKASD---GKH-RILDIT--PEKLHQRSPFFVGTESMVDDVERFIREFPDA-
F16PA_VIBCH      AFLIEQAGGLASD---GAR-RIMDIK--PTELHQRVPFFVGSKNMVHKVETFLETYPD--
F16PA_VIBC3      AFLIEQAGGLASD---GVH-RIMDIK--PTELHQRVPFFVGSKNMVHKVEEFLETYPD--
F16PA_VIBVU      AFLIEQAGGLASD---GVN-RILDLK--PTELHQRVPFFVGSTNMVKKVEEFLEVYRDEA
F16PA_VIBVY      AFLIEQAGGLASD---GVN-RILDLK--PTELHQRVPFFVGSTNMVKKVEEFLEVYRDEA
F16PA_VIBPA      AFLIEQAGGIASD---GVN-RIMDIK--PTELHQRVPFFVGSKNMVRKVEEFLELHRDEE
F16PA_VIBCB      AFLIEQAGGLASD---GVN-RIMDLK--PTELHQRVPFFVGSKNMVNKVEEFLELNREED
F16PA_ALIFM      AMLIEEAGGKATD---GEQ-RILDIK--PSELHQRVPFFVGSTNMVDKVHAFLDEWRD--
F16PA_ALIF1      AMLIEEAGGKATD---GEQ-RILDIK--PSELHQRVPFFVGSTNMVNKVHAFLDEWRD--
F16PA_ALISL      AMLIEEAGGKATS---GEE-RILDIT--PTELHQRVPFFVGSINMVDKVQNFLDEWQD--
F16PA_PHOPR      AFLMEQAGGVASD---GKN-RILDIT--PTELHQRVPFFVGSTNMVKQVESFIEEYPEQH
F16PA_AERS4      AFLVEQAGGKASD---GFG-RIMDIQ--PTALHQRTPYFVGSTKMVERAEAFMREFSAHE
F16PA_AERHH      AFLVEQAGGKASD---GFG-RIMDIQ--PTALHQRTPYFVGSTKMVDRAEAFMREFSSHE
F16PA_HAHCH      AFLIEQAGGKAIA---NPGQRILDIE--PTKLHQRCPLFVGSPKMVDKLEQFISELG---
F16PA_PSYIN      AFIMEQAGGRATD---GFNRRIMELT--PTELHQRVPFFCGSSKMVDKVEAMMEEYSSEE
F16PA_HAEIE      AFLAEQAGGVATD---GYR-RILDIE--PTALHERVPLFVGSEDMVKKAQEMMEEFKE--
F16PA_HAEI8      AFLAEQAGGVATD---GYR-RILDIE--PTALHERVPLFVGSEDMVKKAQEMMEEFKEE-
F16PA_HAEIN      AFLAEQAGGVATD---GYR-RILDIE--PTALHERVPLFVGSEDMVKKAQEMMEEFKE--
F16PA_HAES1      AFLAEQAGGIASD---GKD-RILDIQ--PKELHERVPLFVGSREMVRKAEEFMREFSEE-
F16PA_HISS2      AFLAEQAGGIASD---GKD-RILDIQ--PKELHERVPLFVGSREMVRKAEEFMREFSEE-
F16PA_PASMU      AFLAEQAGGMASD---GYQ-RILDIQ--PTELHQRVPLFLGSKEMVEKAQDFMKTFG---
F16PA_MANSM      AFLAEQAGGIASD---GYN-RVLDIQ--PSQLHQRVPLFVGSKQMVEKAQDFMHQFKED-
F16PA_ACTSZ      AFLAEQAGGLAND---GYN-RILDIE--PLELHQRVPFFVGSKEMVKKANEFMRDYPE--
F16PA_ACTP7      AFLAEQAGGMATD---GFN-PILDIK--PSELHQRVPFFVGSTSMVKQADKFMQECAE--
F16PA_ACTPJ      AFLAEQAGGMATD---GFN-PILDIK--PSELHQRVPFFVGSTSMVKQADKFMQECAE--
F16PA_ACTP2      AFLAEQAGGMATD---GFN-PILDIK--PSELHQRVPFFVGSTSMVKQADKFMQECAE--
F16PA_HAEDU      AFLAEQADGMATD---GFQ-PILDIK--PTELHQRVPFFIGSKTMVKQANTFMQTFTE--
F16PA_DICNV      AFIAEQAGGVATT---GHE-RILDIQ--PQALHQRTPFIVGSEHMVNKIKDFIAQYPDN-
F16PA_FLAJ1      AFIAEQAGGKATD---GFG-RIMEIQ--PTELHQRVPFFCGSKSMVEKAEEFMAAE----
F16PA_FLAPJ      AFIAEQAGGKASD---GYN-RIMEIQ--PTELHQRVPFFCGSYNMVEKAEEFMKNTK---
F16A2_GRAFK      AFITEQAGGKASD---GFQ-RIMDID--PTELHQRVPFFCGSKKMVEKAEEFMANAKANP
F16A1_GRAFK      AFLAEQAGGKATD---GSR-RIMELQ--PQELHERAPFICGNKEMVEKAEEFMQ------
F16PA_WIGBR      ALISSQANGSSSD---GNI-NILDIN--PKILHQCSPFFVGTKSMVKLVNKFILGYYNHN
F16PA_CYTH3      AFIVEQAGGKAID---GEG-RILDIE--PTNIHQRTGIIIGSKNMVEKVEAFIQMNVGLN
F16PA_CHLPM      AYICEQAGGRATD---GRR-RILDID--PSELHQRTPLYIGSEDDVRVAEEFEQGIR---
F16PA_CHLL3      AFICEQAGGRATD---GHR-RILDID--PSELHQRTPLYIGSMADVKVAEEFEQGIR---
F16PA_CHLPD      AFICEQAGGRATN---GKE-RILDLQ--PSELHQRTPLYIGSEADVMIAEEFEQGKR---
F16PA_PELPB      AFICEQAGGRATN---GRD-RILDIQ--PLELHQRTPLYIGSVDDVILAEEFEQGIR---
F16PA_CHLL2      AFICEQAGGRATD---GRN-RILDIQ--PTALHQRTPLYIGSEDDVIVAEEFEQGVR---
F16PA_CHLCH      AFICEQAGGRATN---GKE-RILDIK--PTELHQRTPLYIGSTDDVMVAEEFEQGKR---
F16PA_PROA2      AFICEQAGGRATN---GKE-RILDIN--PTELHQRTPLYIGSKEDVLKAEEFEKEG----
F16PA_CHLPB      AFICEQAGGRATN---GSE-RILDID--PSELHQRTPLYIGSEEDVIIAEEFEQGKR---
F16PA_CHLTE      AFICEQAGGRATD---GYR-RILDIE--PKELHQRTPLYIGSKNDVLIAEEFEQGKR---
F16PA_CHLP8      AFICEQAGGRATD---GHR-RILDIE--PVELHQRTPLYIGSKNDVLIAEEFEQDKR---
F16PA_CHLT3      AFICEQAGGRASN---GRE-RILDIK--PTELHQRTPLFIGSEEDVKIAEEFEQGLRDIE
F16A2_SALRD      GFIAEQAGGAASD---GHR-RILEKE--PDKLHQRTPLFIGSEEMVRRAEAFLQGEPERA
F16A1_SALRD      AFLVEQAGGRAST---GHQ-RILDLQ--PEGLHERTPLFIGSAPLVKAAEAYLQGRGAEA
F16PA_NOSS1      AFLIQQAGGRATT---GL-VDILDVV--PKKLHQRTPLIIGSKEDVAKVESFIQNGH---
F16PA_TRIV2      AFLIQQAGGRATT---GL-VDILDVV--PKKLHQRTPLIIGSKEDVAKVESFIQNGH---
F16PA_NOSP7      AFLIEQAGGRATT---GL-VNILDVV--PKKLHQRTPLIIGSKEDVAKVESFIQNGH---
F16PA_MICAN      AFLIEQAGGKASD---GV-TNLLDIV--PDKLHYRTPLVIGSVEDVKLVESFIADRRHRD
F16PA_CROS5      AFLVEQAGGKASN---GL-KPILDVV--PDKLHARSPLVIGSKEDVSLVESFIQDHQHRN
F16PA_SYNY3      AFLVEQAGGRASD---GQ-KRLLDLI--PSKLHQRTPAIIGSAEDVKLVESFISDHKQRQ
F16PA_SYNP2      AWLIEQAGGKAST---GT-MPLLDFV--PTYLHQRTPTILGSVENVELVESFIQEAERET
F16A1_ACAM1      AYLMEQAGGRASI---GQ-SPLMDVV--PDHLHARTPLIIGSTEDVALVESFIEDRERQA
F16PA_TRIEI      GYLVEQAGGRAST---GT-EEILDVV--ADQLHQRTPLIIGSKEDVALVESFIKEQKRIS
F16PA_THEEB      AFLVEQAGGKAST---GT-QPLLDVV--PDHLHMRTPLIVGSPENVALVESFIQQTPAQP
F16PA_SYNE7      AFLAEQAGGKASD---GQ-KPILLRQ--PQALHERCPLIIGSAADVDFVEACLAESVP--
F16PA_SYNP6      AFLAEQAGGKASD---GQ-KPILLRQ--PQALHERCPLIIGSAADVDFVEACLAESVP--
F16PA_SYNJA      AFLAEQAGGVATT---GT-EAILDIV--PQSLHQRVPLIIGSRKNVEEVLRCLEGSLTP-
F16PA_SYNJB      AFLAEQAGGAATT---GT-EAILDIV--PQSLHQRVPLIIGSRENVEEVLRCLEGSLVP-
F16PA_GLOVI      ALIAEQAGGKAST---GT-ERILDIE--PKTLHQRVPLVIGSPYEVDLAVAFARGEKQTV
F16PA_DESVH      AFLAEQAGGRAID---GS-RRILDVC--PGTLHERIPLFIGSARDVDKVEEIYARHRA--
F16PA_DESVV      AFLAEQAGGRAID---GS-RRILDVC--PGTLHERIPLFIGSARDVDKVEEIYARHRA--
F16PA_DESAG      AFLAEQAGGRATD---GT-KRILDIV--PGELHQRVPLFIGSAGDVDAVEAIYRRHS---
F16PA_LAWIP      AFVAENAGGAATD---GL-YRTLDYV--PLSLHNRVPLVIGSKKDVEAVANIYAKYK---
F16PA_LEPIN      AFIAEQAGGMAVT---VYGERILDLT--PKELHERTTLVVGSKKEVEHFLKFAPKKS---
F16PA_LEPIC      AFIAEQAGGMAVT---VYGERILDLT--PKELHERTTLVVGSKKEVEHFLKFAPKKS---
F16PA_LEPBL      AFIAEQAGGMAVT---VYGERILDLT--PKELHERTTLVVGSKKEVEHFLKFAPKKP---
F16PA_LEPBJ      AFIAEQAGGMAVT---VYGERILDLT--PKELHERTTLVVGSKKEVEHFLKFAPKKP---
F16PA_LEPBP      AFIAEQAGGMAVT---VKGERILDLT--PKDLHERTTLIIGSKKEVEEFLTFVAK-----
F16PA_LEPBA      AFIAEQAGGMAVT---VKGERILDLT--PKDLHERTTLIIGSKKEVEEFLTFVAK-----
F16PA_SORC5      AFIFEAAGGKAST---GA-ERILDRV--PRSLHERVPLVLGSPRDVEDFEQFVRGER---
F16PA_SULSY      AFLTVQAGGIATT---GK-EDILNIK--PTDIHQRVPVFLGGKYEMEKLKSMLKNG----
F16A2_ACAM1      AFLVEQAGGKATS---GLA-RIMDLE--VTSIHQRSPLVIGSQVAVNLYQTFLEQGKAA-
F16PA_AMOA5      AFIAEQAGGLATD---GKQ-PILNII--PRHIHQCVPFYIGSKTMVKNLLNCVG------
F16PA_SYNAS      AFMCREAGGDAID---ETGTRIMEIK--PAGHHQRTTLYVGSKPIIDELASLFKS-----
F16PA_GEOBB      AFIIEHAGGA-AS---NGSIPILDIV--PESLDQRAPIYIGCREDVKTATSFVNGGKQEV
F16PA_GEOUR      AFIIEHAGGA-AT---NGKIPILDIK--PEGLDQRAPIYIGCVEDVNRAMEYVYKS----
F16PA_GEOMG      AYLVENAGGA-AT---DGKQPILDLE--PHSLDQRAPVYIGCKADVVKAMEFVSRN----
F16PA_GEOSL      AYLIENAGGA-AT---DGKTPILDIE--PQSLDQRAPIFIGCSNDVATAMEFMGG-----
F16PA_PELPD      AFLIEQAGGA-AT---NGHMPILDIV--PESLDQRCPIYLGCRDDVVKAAEFLNTPCKTP
F16PA_GEOLS      AYLIEQAGGA-AT---NGCMPILDMQ--PEGLDQRAPIYIGCKEDVAKATEFLNGACA--
F16PA_PELCD      AFLMEQAGGA-AS---NGHQRILDLV--PQQFDERSPFFCGCREDVELAETLIREEKQIR
F16PA_METLZ      GFLAVQAGGA-VS---NGESSTLEIV--PTKVHQRTPVYVGSKGMIAKIEAIR-------
F16PA_METHJ      GFIITQAGGR-IT---DGRRNILNIV--PEKHHQKTPVYIGSKGIIEKIEEIYKNL----
F16PA_METB6      GMIVCEAGGA-AS---NGHTDYREIV--PSAIGQVTPLYIGGKKEIAKIESCMREG----
F16PA_HELPY      ALMVEKAKGEAFYFDKGVKKRLLEQS--VENYHEKSECYLASQHEAHILEKYLKGE----
F16PA_HELPS      ALMVEKAKGEAFYFDKGVKKRLLEQS--VESYHEKSECYLASQHEAHILEKYLKGE----
F16PA_HELPG      ALIIEKAKGEAFYFDKGVKKRLLEQS--VESYHEKSECYLASPHEAQILEKYLKGE----
F16PA_HELPH      ALIIEKAKGEAFYFDKGVKKRLLEQS--VESYHEKSECYLASPHEAQILEKHLKGE----
F16PA_HELPJ      ALMVEKAKGEAFYFDKGVKKRLLDQS--VESYHEKSECYLASPHEAQILEKHLKGE----
F16PA_HELAH      ALIIEKAKGEAFYFDKGVKKRLLDQG--VESYHEKSECYLTSQHEAQILEKYLKGE----
F16PA_CAMC5      AFIYENAGGTTSD---GKSDTLFDVN--ITKTHQTSPCFFGSASEIALLHKFYGKD----
F16PA_CAMC1      AFIYENAKGATTD---GKNQTLFDIK--IEKIHQTTPCFFGSRDEISLLHKFYEQK----
F16PA_CAMHC      AFIYEKAGGATSD---GKSQSLFSIK--ISKIHQTTPCFFGSKYEIERLHEIYG------
F16PA_CAMFF      AFIYERAGGATTN---GENKSLFEIN--LEKIHQTTPCFFGSKYEINRLLEFYND-----
F16PA_CAMJJ      AFIIEKAGGKTTN---GKNHSLLELE--FDKIHATTPCFFGSEYEISKLLKAYNE-----
F16PA_CAMJ8      AFIIEKAGGKTTN---GKNHSLLELE--FDKIHATTPCFFGSEYEISKLLKAYNE-----
F16PA_CAMJE      AFIIEKAGGKTTN---GKNRSLLELE--FDKIHATTPCFFGSEYEISKLLKAYNE-----
F16PA_CAMJR      AFIIEKAGGKTTN---GKNRSLLELE--FDKIHATTPCFFGSEYEISKLLKAYNE-----
F16PA_CAMJD      AFIIEKAGGKTTN---GKNHSLLELE--FDKIHATTPCFFGSKYEISKLLKAYNE-----
F16PA_ARCB4      ALAYEKAGGQAV----DGFKRVLEVQ--TTHIHDTTPCFFGSNSEINRVLEVYKKNV---
F16PA_SULDN      AFIFNRAGGEAI----DGAVDLMNLE--YAHIHDTSPCFFGSKYEIQRVREVYASNQ---
F16PA_NITSB      AHVYEKAGGEAIN---DEGNRLLDLK--AEEIHDTTPCFFGSLYEINKVREFYGK-----
F16PA_SULNB      AFIYEQAGGQAID---AKGKRLMELV--PAHPHDTSPCFFGSNYEIKALKKAYGVNA---
F16PA_WOLSU      AFIFEKAGGAAI----DGKKRLLELE--HSHLHDTTPCFFGSIHEIERVRSVYQEL----
F16PA_HELHP      AFVYEKAGGFATN---GTYR-ILELE--VAHLHDSTPCFFGSQSEMNLVKEVYE------
F16PA_HALSA      AYIVETAGGASSD----GTQSLLDVA--PTRLHERTPTFVGTDDVIAALDAALPDHTN--
F16PA_HALS3      AYIVETAGGASSD----GTQSLLDVA--PTRLHERTPTFVGTDDVIAALDAALPDHTN--
F16PA_NATPD      AAIVEAAGGASSD----GDGSLLKKE--PEQLHERTPLFVGNDEYIERLEAALP------
F16PA_HALWD      GYIIECAGGASSD----GSQSLLAVE--SNDIHDRTPVYVGTPSLVERLEGALAGKADSE
F16A1_HALMA      AYILESAGGRSSD----GDQSLLEIE--PDELHERTPLYLGNDDLIDRLEANID------
F16A2_HALMA      AYLVEAAGGASSD----GSQSLLDVE--PDGIHDRTPTFLGNAELVDELEAALSET----
                 .     . .                                                   

F16A2_CUPNH      ---LPSPLFNERSLFRASA------
F16A3_CUPNH      ---LPSPLFNERSLFRASA------
F16A2_CUPTR      ---LPNPLFNERSLFRASA------
F16A2_CUPMC      ---AAAPLFAERSLFRD--------
F16A2_LEPCP      ---FATPLFAERSLFRD--------
F16A2_POLNA      ---MHNPLFAERSLFRS--------
F16A1_RHOFT      ---PSNPLFAERSLFRS--------
F16PA_HYDTE      ---VDLPLFAERTLFRDETL-----
F16A3_METPP      ---YNSPLFGKRGLFAEAG------
F16PA_RHORT      ---FATPLFNQRGLFRD--------
F16A2_DECAR      DRPFVSPLFSERSLFRDESRA----
F16A2_PARXL      DQPFTSPLFSRRSLFLPGFTA----
F16PA_METI4      QEEFESPLFSTRSLFRNP-------
F16PA_MAGSA      -------------------------
F16PA_METFK      -------------------------
F16A1_METPP      ----SWQLFKTRSLFIQPQA-----
F16PA_NITEC      -------------------------
F16PA_NITEU      -------------------------
F16PA_THIDA      -------------------------
F16PA_NITOC      -------------------------
F16PA_ACIF5      -------------------------
F16PA_HALHL      -------------------------
F16PA_DELAS      -------------------------
F16PA_ACISJ      -------------------------
F16PA_POLSJ      -------------------------
F16PA_ACIAC      -------------------------
F16A1_POLNA      -------------------------
F16PA_VEREI      -------------------------
F16A2_RHOFT      -------------------------
F16A1_LEPCP      GH-----------------------
F16A2_METPP      -------------------------
F16A1_CUPTR      -------------------------
F16A1_CUPNH      -------------------------
F16PA_CUPPJ      G------------------------
F16A1_CUPMC      -------------------------
F16PA_RALSO      -------------------------
F16PA_RALPJ      -------------------------
F16PA_BORBR      -------------------------
F16PA_BORPA      -------------------------
F16PA_BORPE      -------------------------
F16PA_BORPD      A------------------------
F16PA_BORA1      -------------------------
F16PA_JANMA      -------------------------
F16PA_HERAR      -------------------------
F16PA_HERSE      -------------------------
F16PA_PARL1      QTA----------------------
F16A1_PARXL      -------------------------
F16PA_PARPJ      -------------------------
F16A1_PARP8      -------------------------
F16PA_BURCA      -------------------------
F16PA_BURCH      -------------------------
F16PA_BURCC      -------------------------
F16PA_BURCJ      -------------------------
F16PA_BURL3      -------------------------
F16PA_BURM1      -------------------------
F16PA_BURA4      -------------------------
F16PA_BURCM      -------------------------
F16PA_BURVG      -------------------------
F16PA_BURM9      -------------------------
F16PA_BURMS      -------------------------
F16PA_BURPS      -------------------------
F16PA_BURMA      -------------------------
F16PA_BURP1      -------------------------
F16PA_BURP0      -------------------------
F16PA_BURP6      -------------------------
F16PA_BURM7      -------------------------
F16PA_BURTA      -------------------------
F16PA_PSEP1      -------------------------
F16PA_PSEE4      -------------------------
F16PA_PSEPK      -------------------------
F16PA_PSEPG      -------------------------
F16PA_PSEPW      -------------------------
F16PA_PSESM      -------------------------
F16PA_PSEU2      -------------------------
F16PA_PSE14      -------------------------
F16PA_PSEPF      -------------------------
F16PA_PSEF5      -------------------------
F16PA_PSEA7      -------------------------
F16PA_PSEAE      -------------------------
F16PA_PSEAB      -------------------------
F16PA_PSEMY      -------------------------
F16PA_PSEU5      -------------------------
F16PA_CHRVO      -------------------------
F16PA_AROAE      -------------------------
F16PA_AZOSB      -------------------------
F16A1_DECAR      -------------------------
F16PA_XANAC      -------------------------
F16PA_XANC5      -------------------------
F16PA_XANOM      -------------------------
F16PA_XANOP      -------------------------
F16PA_XANOR      -------------------------
F16PA_XANCP      G------------------------
F16PA_XANC8      G------------------------
F16PA_XANCB      G------------------------
F16PA_STRM5      G------------------------
F16PA_STRMK      G------------------------
F16PA_SHEB8      PN-----------IE----------
F16PA_SHEB5      PNPQNSDNNCDTLIEV---------
F16PA_SHEB9      -------------------------
F16PA_SHESR      PTLD---------------------
F16PA_SHESM      PTLD---------------------
F16PA_SHESA      PSLD---------------------
F16PA_SHEPC      PSLD---------------------
F16PA_SHESW      PGLD---------------------
F16PA_SHEON      -------------------------
F16PA_SHEHH      PAL----------------------
F16PA_SHEPA      PVL----------------------
F16PA_SHESH      PQL----------------------
F16PA_SHEWM      PAL----------------------
F16PA_SHELP      PSL----------------------
F16PA_SHEDO      PNID---------------------
F16PA_SHEFN      PSID---------------------
F16PA_SHEAM      -------------------------
F16PA_MARMS      -------------------------
F16PA_ALTMD      -------------------------
F16PA_PSEA6      -------------------------
F16A1_PSET1      -------------------------
F16PA_COLP3      -------------------------
F16PA_IDILO      -------------------------
F16PA_CELJU      -------------------------
F16A2_PSET1      -------------------------
F16PA_SACD2      -------------------------
F16PA_HYDCU      -------------------------
F16PA_ACIBC      -------------------------
F16PA_ACIBS      -------------------------
F16PA_ACIBT      -------------------------
F16PA_ACIBY      -------------------------
F16PA_ACIAD      -------------------------
F16PA_PSYA2      -------------------------
F16PA_PSYCK      -------------------------
F16PA_PSYWF      -------------------------
F16PA_NEIM0      -------------------------
F16PA_NEIMB      -------------------------
F16PA_NEIMF      -------------------------
F16PA_NEIMA      -------------------------
F16PA_NEIG1      -------------------------
F16PA_NEIG2      -------------------------
F16PA_POLAQ      -------------------------
F16PA_POLNS      -------------------------
F16PA_CAUVC      -------------------------
F16PA_CAUSK      -------------------------
F16PA_ALKEH      -------------------------
F16PA_NITVU      LEANAPLFGNRGLFRV---------
F16PA_NITWN      LEANAPLFGNRGLFRV---------
F16A2_NITHX      LEANAPLFGHRGLFRV---------
F16A1_NITHX      LEANAPLFGHRGLFRV---------
F16PA_BRADU      ASISAPLFARRGFFRL---------
F16PA_RHOPB      ATITAPLFGHRGLFRV---------
F16PA_RHOP5      ASRSAPLFARRGLFRV---------
F16PA_RHOPA      ASRSAPLFARRGLFRV---------
F16PA_RHOPT      ASRSAPLFARRGLFRV---------
F16PA_RHOP2      ASRTAPLFGRRGLFRT---------
F16PA_RHOPS      ASRTAPLFGRRGLFRT---------
F16PA_BRASO      ETSDAPLFARRGLFR----------
F16A2_BRASB      ETSDAPLFARRGLFR----------
F16PA_RHIME      IGERAPLFGKRGLFRA---------
F16PA_SINMW      IGERAPLFGKRGLFRA---------
F16PA_XANFL      HGERSPLFARRGLFI----------
F16A1_XANP2      HGERSPLFARRGLFI----------
F16A2_CERSP      -EETSALFGSRGLFRS---------
F16A2_CERS4      -EETSALFGSRGLFRS---------
F16A2_RHOS1      -EETSALFGSRGLFRS---------
F16A2_CERS5      -QETSALFGTRGLFRS---------
F16PA_RHOCB      -EETSALFNTRGLFRS---------
F16A1_RHOS1      -QETSALFGNRGLFRS---------
F16A1_CERS4      -QETSALFGNRGLFRS---------
F16A1_CERSP      -QETSALFGNRGLFRS---------
F16A1_CERS5      -QETSALFGNRGLFRS---------
F16PA_PARDP      -TEVSALFGHRGLFRA---------
F16A1_BRASB      -SEVSPLFGTRGLFRA---------
F16PA_METEP      SAGRSPLFGQRGLMRS---------
F16PA_METPB      SAGRSPLFGQRGLMRS---------
F16PA_METRJ      DAGRSPLFGQRGLMRS---------
F16PA_AZOC5      -------------------------
F16A2_XANP2      -------------------------
F16PA_ACICJ      --PSSPLFRRRSLFRSTSNVAELFA
F16PA_BRUC2      -------------------------
F16PA_BRUSU      -------------------------
F16PA_BRUAB      -------------------------
F16PA_BRUO2      -------------------------
F16PA_BRUA2      -------------------------
F16PA_BRUA1      -------------------------
F16PA_BRUSI      -------------------------
F16PA_BRUME      -------------------------
F16PA_BRUA4      -------------------------
F16A3_PSET1      -------------------------
F16PA_ECOLI      -------------------------
F16PA_SHIFL      -------------------------
F16PA_SHIBS      -------------------------
F16PA_ECOK1      -------------------------
F16PA_ECOUT      -------------------------
F16PA_ECOL5      -------------------------
F16PA_SHIF8      -------------------------
F16PA_SHIB3      -------------------------
F16PA_ECODH      -------------------------
F16PA_ECOSM      -------------------------
F16PA_ECOLC      -------------------------
F16PA_ECOL6      -------------------------
F16PA_ECO24      -------------------------
F16PA_ECOHS      -------------------------
F16PA_SHIDS      -------------------------
F16PA_ECO57      -------------------------
F16PA_ECO5E      -------------------------
F16PA_SHISS      -------------------------
F16PA_CITK8      -------------------------
F16PA_SALTY      -------------------------
F16PA_SALPA      -------------------------
F16PA_SALCH      -------------------------
F16PA_SALEP      -------------------------
F16PA_SALDC      -------------------------
F16PA_SALA4      -------------------------
F16PA_SALPK      -------------------------
F16PA_SALSV      -------------------------
F16PA_SALHS      -------------------------
F16PA_SALNS      -------------------------
F16PA_SALPB      -------------------------
F16PA_SALTI      -------------------------
F16PA_SALG2      -------------------------
F16PA_SALAR      -------------------------
F16PA_ENT38      -------------------------
F16PA_KLEP3      -------------------------
F16PA_KLEP7      -------------------------
F16PA_CROS8      -------------------------
F16PA_ERWT9      -------------------------
F16PA_SODGM      -------------------------
F16PA_YERPN      AK-----------------------
F16PA_YERPA      AK-----------------------
F16PA_YERPE      AK-----------------------
F16PA_YERPS      AK-----------------------
F16PA_YERPB      AK-----------------------
F16PA_YERPY      AK-----------------------
F16PA_YERPG      AK-----------------------
F16PA_YERP3      AK-----------------------
F16PA_YERPP      AK-----------------------
F16PA_YERE8      AK-----------------------
F16PA_SERP5      -------------------------
F16PA_PHOLL      -------------------------
F16PA_PROMH      -------------------------
F16PA_PECAS      -------------------------
F16PA_VIBCH      -------------------------
F16PA_VIBC3      -------------------------
F16PA_VIBVU      -------------------------
F16PA_VIBVY      -------------------------
F16PA_VIBPA      -------------------------
F16PA_VIBCB      -------------------------
F16PA_ALIFM      -------------------------
F16PA_ALIF1      -------------------------
F16PA_ALISL      -------------------------
F16PA_PHOPR      -------------------------
F16PA_AERS4      DPANQG-------------------
F16PA_AERHH      DPANQG-------------------
F16PA_HAHCH      -------------------------
F16PA_PSYIN      K------------------------
F16PA_HAEIE      -------------------------
F16PA_HAEI8      -------------------------
F16PA_HAEIN      -------------------------
F16PA_HAES1      -------------------------
F16PA_HISS2      -------------------------
F16PA_PASMU      -------------------------
F16PA_MANSM      -------------------------
F16PA_ACTSZ      -------------------------
F16PA_ACTP7      -------------------------
F16PA_ACTPJ      -------------------------
F16PA_ACTP2      -------------------------
F16PA_HAEDU      -------------------------
F16PA_DICNV      -------------------------
F16PA_FLAJ1      -------------------------
F16PA_FLAPJ      -------------------------
F16A2_GRAFK      QSQEFSFSSK---------------
F16A1_GRAFK      -------------------------
F16PA_WIGBR      -------------------------
F16PA_CYTH3      VYRLK--------------------
F16PA_CHLPM      -------------------------
F16PA_CHLL3      -------------------------
F16PA_CHLPD      -------------------------
F16PA_PELPB      -------------------------
F16PA_CHLL2      -------------------------
F16PA_CHLCH      -------------------------
F16PA_PROA2      -------------------------
F16PA_CHLPB      -------------------------
F16PA_CHLTE      -------------------------
F16PA_CHLP8      -------------------------
F16PA_CHLT3      HDEALCPKSLTSE------------
F16A2_SALRD      LSA----------------------
F16A1_SALRD      VGGA---------------------
F16PA_NOSS1      -------------------------
F16PA_TRIV2      -------------------------
F16PA_NOSP7      -------------------------
F16PA_MICAN      RV-----------------------
F16PA_CROS5      HG-----------------------
F16PA_SYNY3      GN-----------------------
F16PA_SYNP2      VGV----------------------
F16A1_ACAM1      EEELALKS-----------------
F16PA_TRIEI      NQG----------------------
F16PA_THEEB      TVTQV--------------------
F16PA_SYNE7      -------------------------
F16PA_SYNP6      -------------------------
F16PA_SYNJA      -------------------------
F16PA_SYNJB      -------------------------
F16PA_GLOVI      VAGS---------------------
F16PA_DESVH      -------------------------
F16PA_DESVV      -------------------------
F16PA_DESAG      -------------------------
F16PA_LAWIP      -------------------------
F16PA_LEPIN      -------------------------
F16PA_LEPIC      -------------------------
F16PA_LEPBL      -------------------------
F16PA_LEPBJ      -------------------------
F16PA_LEPBP      -------------------------
F16PA_LEPBA      -------------------------
F16PA_SORC5      -------------------------
F16PA_SULSY      -------------------------
F16A2_ACAM1      -------------------------
F16PA_AMOA5      -------------------------
F16PA_SYNAS      -------------------------
F16PA_GEOBB      KMAGSFVNG----------------
F16PA_GEOUR      -------------------------
F16PA_GEOMG      -------------------------
F16PA_GEOSL      -------------------------
F16PA_PELPD      HEEPQP-------------------
F16PA_GEOLS      -------------------------
F16PA_PELCD      -------------------------
F16PA_METLZ      -------------------------
F16PA_METHJ      -------------------------
F16PA_METB6      -------------------------
F16PA_HELPY      -------------------------
F16PA_HELPS      -------------------------
F16PA_HELPG      -------------------------
F16PA_HELPH      -------------------------
F16PA_HELPJ      -------------------------
F16PA_HELAH      -------------------------
F16PA_CAMC5      -------------------------
F16PA_CAMC1      -------------------------
F16PA_CAMHC      -------------------------
F16PA_CAMFF      -------------------------
F16PA_CAMJJ      -------------------------
F16PA_CAMJ8      -------------------------
F16PA_CAMJE      -------------------------
F16PA_CAMJR      -------------------------
F16PA_CAMJD      -------------------------
F16PA_ARCB4      -------------------------
F16PA_SULDN      -------------------------
F16PA_NITSB      -------------------------
F16PA_SULNB      -------------------------
F16PA_WOLSU      -------------------------
F16PA_HELHP      -------------------------
F16PA_HALSA      -------------------------
F16PA_HALS3      -------------------------
F16PA_NATPD      -------------------------
F16PA_HALWD      -------------------------
F16A1_HALMA      -------------------------
F16A2_HALMA      -------------------------