CLUSTAL format seed alignment for MF_01857

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMI_AERHH      -------MSASIYLVKGREKSLLRRHPWIFSKGIERVQG-NPIDGDTVEIYTQDGKWLAR
RLMI_AERS4      -------MSVFIYLVKGREKSLLRRHPWIFSKGIERVEG-NPVDGDTVEIYANDGRWLAR
RLMI_ECOLI      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECODH      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOLC      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOHS      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECO24      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECO57      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECO5E      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SHIB3      -------MSVRLVLAKGREKSLLRRHPWVFSGTVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SHIBS      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SHIFL      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SHIF8      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SHIDS      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOK1      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOL6      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOL5      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_ECOUT      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KANLGETIDIVDHQGKWLAR
RLMI_ECOSM      -------MSVRLVLAKGREKSLLRRHPWIFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_CITK8      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_SALCH      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALPB      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALHS      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALTY      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALA4      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALDC      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALEP      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALG2      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALPA      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALPK      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALTI      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALSV      MTESTFSQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALNS      MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANLGETIDIVDHQGKWLAR
RLMI_SALAR      MTESTFPNYPRLVLSKGREKSLLRRHPWVFSGAVSRLEG-KANPGETIDIVDHQGKWLAR
RLMI_ENT38      -------MSVRLVLTKGREKSLLRRHPWVFSGAVARMEG-KASLGETIDIVDHQGKWLAR
RLMI_CROS8      -------MSVRLVLAKGREKSLLRRHPWVFSGAVARMEG-KAAPGETIDIVDHQGKWLAR
RLMI_KLEP3      ---MTDSLFPRLVLAKGREKSLLRRHPWIFSGGVARMEG-KARSGETIDIVDHQGKWLAR
RLMI_KLEP7      ---MTDSLFPRLVLAKGREKSLLRRHPWIFSGGVARMEG-KARSGETIDIVDHQGKWLAR
RLMI_YERPE      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPY      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPP      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPG      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPA      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPN      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPS      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERPB      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERP3      -------MTVRLILAKGREKSLLRRHPWIFSGAVQRLEG-DALSGETIDILDSQGKWLAR
RLMI_YERE8      ---------MRLFLARGREKSLLRRHPWIFSGAVQRLEG-NASAGETIDILDSQGKWLAR
RLMI_SERP5      -------MTVRLFLAKGREKSLLRRHPWVFSGAVQRVEG-KALSGETIDIHDAQGKWLAR
RLMI_ERWT9      -------MTVRLILAKGREKSLLRRHPWVFSGAVARLEG-KAQPGETIDVCDSQGKWLAR
RLMI_ALIF1      -------MTVSIYLAKGRDKALRRRHPWIFSRGIDRIDG-KAELGETVEIYANNGEWLAR
RLMI_ALIFM      -------MTVSIYLAKGRDKALRRRHPWIFSRGIDRIDG-KAELGETVEIYANNGEWLAR
RLMI_ALISL      -------MTVSIYLVKGRDKALRRRHPWIFSRGIEKMDG-KPQLGETVEIYSNSGEWLAR
RLMI_VIBCH      -------MTPAIYLVKGRDKSLRRKHPWVFSRGISKVEG-TPKLGETVDVYSFEGKWLAK
RLMI_VIBC3      -------MTPAIYLVKGRDKSLRRKHPWVFSRGISKVEG-TPKLGETVDVYSFEGKWLAK
RLMI_VIBCB      -------MTAAIYLVKGREKSVKRKHPWIFSRGISKVEG-EPALGETVDVFTHDGKWLAK
RLMI_VIBPA      -------MTAAIYLVKGREKSVKRKHPWIFSRGIGKVEG-EPALGETVDVFTHDGKWLAK
RLMI_VIBVU      -------MSAAIYLVKGREKSVVRRHPWIFSRGIDRVEG-NPQLGETVDVYGHDGKWLAK
RLMI_VIBVY      -------MSAAIYLVKGREKSVVRRHPWIFSRGIDRVEG-NPQLGETVDVYGHDGKWLAK
RLMI_PHOPR      -------MTTSIYLVKGREKSLRRRHPWVFSRGIDRIEGNKPSMGETVEVYDNKGEWLAR
RLMI_ALTMD      -------MSAQVILQPSRDKSLRRKHPWVFESAVAELKG-RARIGDTVDVFDDEGDWLGR
RLMI_PSEA6      -------MSSRVTLHPGREKSLLRRHPWIFASAIESTKG-RMNLGDTVDVYSHEDVWLGR
RLMI_PSET1      -------MTSAVYLQAGRDKSLKRKHPWLFSKAIKKIKG-KPGLGDTVTIHDSEGKFLAT
RLMI_COLP3      -------MSARISLNVGREKSLLRKHPWIFSKAVNKIKG-NPMLGDTVDVFDSKGNWLAK
RLMI_SHEB5      -------MAIRIKLKPGREKSLERRHPWVFSNAIHNIKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHEB9      -------MAIRIKLKPGREKSLERRHPWVFSNAIHNIKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHEB8      -------MAIRIKLKPGREKSLERRHPWVFSNAIHNIKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHEPC      -------MAIRIKLKPGREKSLERRHPWVFSNAIHNIKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHESW      -------MAIRIKLKPGREKSLERRHPWVFSNAIHNIKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHESM      -------MAVRIKLKPGREKSLERRHPWVFSNGIHNVKG-KLEAGDTVDVVAHDGHWLGR
RLMI_SHESR      -------MAVRIKLKPGREKSLERRHPWVFSNGIHNVKG-KLEPGDTVDVVAHDGHWLGR
RLMI_SHESA      -------MAVRIKLKPGREKSLERRHPWVFSNGIHNVKG-KPEAGETVDVVAHDGHWLGR
RLMI_SHEON      -------MAIRIKLKPGREKSLERRHPWVFSNGIHNVKG-KPEPGQTVDVVAHDGHWLGR
RLMI_SHEDO      -------MAIRIKLKPGRERSLERRHPWVFSNGIHNVNGGKPQAGDTVDVVAHDGRWLGR
RLMI_SHEFN      -------MAIRIKLKPGRERSLERRHPWIFSNGIHNVNGGKPQAGDTVEVVAHDGHWLGR
RLMI_SHEAM      -------MSIRIKLKPGREKSLDRRHPWVFSSGVHNIKG-KPLRGETVDVVAHDGRWLGR
                           : *  .*:::: *:***:*   :   .*     *:*: :   .. :*. 

RLMI_AERHH      GAWSGSSQIRARVWTFDKEETVDLDFFIRRLKYAQESRDGLIKRQGLTGYRLCAAESDGL
RLMI_AERS4      GAWSGSSQIRARVWTFDKEETVDLDFFLRRLKYAQESRDPLIKRQGLTGYRLCAAESDGL
RLMI_ECOLI      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECODH      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOLC      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOHS      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECO24      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECO57      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECO5E      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_SHIB3      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_SHIBS      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_SHIFL      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_SHIF8      GAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_SHIDS      GAYSPASQIRARVWTFDLSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOK1      GAYSPASQIRARVWTFDPSESIDIAFFTRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOL6      GAYSPASQIRARVWTFDPSESIDIAFFTRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOL5      GAYSPASQIRARVWTFDPSESIDIAFFTRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOUT      GAYSPASQIRARVWTFDPSESIDIAFFTRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGL
RLMI_ECOSM      GAYSPASQIRARVWTFDPSESIDIAFFTRRLQQAQKWRDWLAQKDGLNSYRLIAGESDGL
RLMI_CITK8      GAYSPASQIRARVWTFDQAESIDIAFFTRRLHQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALCH      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALPB      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALHS      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALTY      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALA4      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALDC      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALEP      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALG2      GAWSPASQIRARVWTFDKAESIDIAFFTHRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALPA      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALPK      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALTI      GAWSPASQIRARVWTFDKTESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALSV      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALNS      GAWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_SALAR      GAWSPASQIRARVWTFDKTEPVDIAFFTRRLRQAQHWRDWLAKKDGLDSYRLIAGESDGL
RLMI_ENT38      GAYSPASQIRARVWTFDKDETIDIAFFTRRLQQAQQWRDWLAKRDGLDSYRLIAGESDGM
RLMI_CROS8      AALSPASQIRARVWTFDPNETIDIAFFTRRLQQAQQWRDWLAKKDGLDSYRLIAGESDGL
RLMI_KLEP3      GAYSPSSQIRARVWTFDRNEAIDSAFFERRLQQAQTWRAWLAERDGLDSYRLIAGESDGL
RLMI_KLEP7      GAYSPSSQIRARVWTFDRNEAIDSAFFERRLQQAQTWRAWLAERDGLDSYRLIAGESDGL
RLMI_YERPE      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPY      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPP      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPG      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPA      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPN      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPS      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERPB      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERP3      AAYSPESQILARVWTFQQDEVIDCAFFIRRLQQAQNWRDWLAQRDGLNGYRLIAGESDGL
RLMI_YERE8      AAYSPESQIVARVWTFQQDEVIDSEFFVRRLQQAQSWRDWLAQRDGLNGYRLIAGESDGL
RLMI_SERP5      GAYSPESQIRARVWTFLPDEEINIEFFIRRLQQAQNWRDWVAKRDGLDGYRLIAGESDGM
RLMI_ERWT9      AAWSPSSQIRARVWSWQQDESIDIDFFVRRLNAAQQLRDWLALRDNLDSYRLIAGESDGL
RLMI_ALIF1      GAFSPQSQIRARVWTFDKNEAIDKDFFVRKLNQAQALRNVLAERDGLTGYRLIAAESDGL
RLMI_ALIFM      GAFSPQSQIRARVWTFDKNEAIDKDFFVRKLNQAQALRDVLAERDGLTGYRLIAAESDGL
RLMI_ALISL      GAFSPQSQIRARVWTFDKNEAIDKDFFVRKLNQAQGLRDILAEREGLTGYRLIAAESDGL
RLMI_VIBCH      AAYSPHSQITARVWSFEQ-EPIDRDFFIKRIEQAQLLRNDIIERDGLTGYRLIAAESDGL
RLMI_VIBC3      AAYSPHSQITARVWSFEQ-EPIDRDFFIKRIEQAQLLRNDIIERDGLTGYRLIAAESDGL
RLMI_VIBCB      AAYSPASQIRARIWSFEK-EEINKAFFVKRFNNAQLLREDIIERDGLTGYRLIAAESDGM
RLMI_VIBPA      AAYSPESQIRARIWSFEK-EEINKAFFVKRFQNAQLLREDVIERDGLTGYRLIAAESDGL
RLMI_VIBVU      AAYSPESQIRARVWSFEK-QDINRAFFVKRIQDAQLLREDVIERDGLTGYRLIAAESDGM
RLMI_VIBVY      AAYSPESQIRARVWSFEK-QDVNRAFFVKRIQDAQLLREDVIERDGLTGYRLIAAESDGM
RLMI_PHOPR      GAYSPQSQIRIRVWTFDKKEVINVDFFVKRLKAAQALRDVLAARDGLTGYRLIAAESDGL
RLMI_ALTMD      GAYSPHSKIRVRMWTFKKDESIDNGFFLRRLETALALRKRLFDPNKTNAFRWIASESDGL
RLMI_PSEA6      GAYSPHSQIQVRIWTFTQNESVDNGFFQRRIARAQQSREELIERHGLTGYRLIAAESDGL
RLMI_PSET1      AAYSPHSQIRARVWSFDEKEVIDQHFFERRLRRALEARSQVIEEGGLTGFRLCAAESDFL
RLMI_COLP3      GAYSPESQIRIRVWSFDEHEEIDRDFFFAKLQSAQARRDWFISQGKLTGYRLIAGESDGL
RLMI_SHEB5      GAWSPESQIQVRIWTFDREEEIDREFFARRLQRAQIGRNDLIREQGLTGYRLVAAESDGL
RLMI_SHEB9      GAWSPESQIQVRIWTFDREEEIDREFFARRLQRAQIGRNDLIREQGLTGYRLVAAESDGL
RLMI_SHEB8      GAWSPESQIQVRIWTFDREEEIDREFFARRLQRAQIGRNDLIREQGLTGYRLVAAESDGL
RLMI_SHEPC      GAWSPESQIQVRIWTFDREEEIDRAFFARRLQRAQIGRNDLIREQGLTGYRLVAAESDGL
RLMI_SHESW      GAWSPESQIQVRIWTFDREEEIDRAFFARRLQRAQIGRNDLIREQGLTGYRLVAAESDGL
RLMI_SHESM      GAWSPESQIQVRIWTFDREEEIDREFFKRRILRAQAGRDDLIREQGLTGYRLIAAESDGL
RLMI_SHESR      GAWSPESQIQVRIWTFDREEEIDREFFKRRILRAQAGRDDLIREQGLTGYRLIAAESDGL
RLMI_SHESA      GAWSPESQIQVRIWTFDREEEIDREFFKRRILRAQAGRDDLIREQGLTGYRLIAAESDGL
RLMI_SHEON      GAWSGESQIQVRVWTFDREEEIDREFFKRRILRAQAGRDDLIREQGLTGYRLIAAESDGL
RLMI_SHEDO      GAWSPESQIQVRIWTFDKEEAIDADFFARRIQRAQAGREDLIREQGLTGYRLIAAESDGL
RLMI_SHEFN      GAWSPESQIQVRIWTFDKEETIDADFFARRIKRAQAGRDDLIREQGLTGYRLIAAESDGL
RLMI_SHEAM      GAWSDASQIQVRVWTFDKEEAIDRDFFARRIARAQAGREALIREKGLTGYRLVGAESDGL
                .* *  *:*  *:*::   : ::  **  ::  *   *  .       .:*  ..*** :

RLMI_AERHH      PGLTIDRYADFLVCQILSAGAEFQRDLITQALRTLYPECSIYERSDVAVRKKEGLKERTG
RLMI_AERS4      PGLTIDSYADFLVCQILSAGAEFQRELITQALRTLYPECSIYERSDVAVRKKEGLKERTG
RLMI_ECOLI      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQG
RLMI_ECODH      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQG
RLMI_ECOLC      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQG
RLMI_ECOHS      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQG
RLMI_ECO24      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECO57      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECO5E      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_SHIB3      PGITIDRFGNFLVLQLLSAGAEYQRAALVSALQTLYPECAIYDRSDVAVRKKEGMELTLG
RLMI_SHIBS      PGITIDRFGNFLVLQLLSAGAEYQRAALVSALQTLYPECAIYDRSDVAVRKKEGMELTLG
RLMI_SHIFL      PGITIDRFGNFLVLQLLSAGAEYQRAALITALQTLYPECAIYDRSDVAVRKKEGMELTHG
RLMI_SHIF8      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_SHIDS      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECOK1      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECOL6      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECOL5      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECOUT      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_ECOSM      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_CITK8      PGITIDRFGNFLVLQLLSAGAEYQRAALISALQTQYPECAIYDRSDVAVRKKEGMELTQG
RLMI_SALCH      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALPB      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALHS      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALTY      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALA4      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALDC      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALEP      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCDPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALG2      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCDPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALPA      PGVTIDRFGYFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALPK      PGVTIDRFGYFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALTI      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALSV      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALNS      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALTQG
RLMI_SALAR      PGVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCYPDCAIYDRSDVAVRKKEGMALAQG
RLMI_ENT38      PGVTIDRFANFLVLQLLSAGAEYQRAALISALQTLYPECAIYDRSDVAVRKKEGMELTQG
RLMI_CROS8      PGVTIDRFGNFLVLQLLSAGAEYQRPALVSALQALYPECAIYDRSDVAVRKKEGMELAQG
RLMI_KLEP3      PGVTIDRFGNFFVLQLLSAGAEYQRAAIISALQNLFPDCAIYDRSDVAVRKKEGLELAQG
RLMI_KLEP7      PGVTIDRFGNFFVLQLLSAGAEYQRAAIISALQNLFPDCAIYDRSDVAVRKKEGLELAQG
RLMI_YERPE      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPY      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPP      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPG      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPA      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPN      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPS      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERPB      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERP3      PGITIDRFQNFLVLQLLSAGAEYQRETLVSALQHCYPECSIYDRSDVSVRKKEGLPLTQG
RLMI_YERE8      PGITIDRFQNFLVLQLLSAGAEHQRAALVSALQQCYPECSIYDRSDVSVRKKEGLELTQG
RLMI_SERP5      PGITIDRFQNFLVLQLLSAGAEYQRAALITALQHCYPECAIYDRSDVAVRKKEGLPLAQG
RLMI_ERWT9      PGITIDRFGNFLVLQLLSAGAEYQRAALITALQRCYPDCAIYDRSDVSVRKKEGLELTQG
RLMI_ALIF1      PGITIDRYQDYFVCQLLSAGAEATKELLVEALVECYPDCNIYERSDVSVRKKEGLKQRTG
RLMI_ALIFM      PGITIDRYQDYFVCQLLSAGAEATKDLLVEALVECYPDCNIYERSDVSVRKKEGLKQRTG
RLMI_ALISL      PGITIDRYQNYFVCQLLSAGAEANKDQLVEALIECYPDCNIYERSDVSVRKKEGLKQRTG
RLMI_VIBCH      PGITIDKYQDYLVCQLLSAGAEYQKQTLVEALLHCFPECHIYERSDVAVRKKEGLDERVG
RLMI_VIBC3      PGITIDKYQDYLVCQLLSAGAEYQKQTLVEALLHCFPECHIYERSDVAVRKKEGLDERVG
RLMI_VIBCB      PGVTIDRYQNFFVCQLLSAGAEYNKQAIVDALVECFPDCNVYERSDVAVRKKEGLKETTG
RLMI_VIBPA      PGVTIDRYQNFFVCQLLSAGAEYNKQAIVDALVECFPDCNVYERSDVAVRKKEGLKETTG
RLMI_VIBVU      PGVTIDRYQNFFVCQLLSAGAEHQKQNIVDALIEVFPDCNVYERSDVSVRKKEGLQETTG
RLMI_VIBVY      PGVTIDRYQNFFVCQLLSAGAEHQKQNIVDALIEVFPDCNVYERSDVSVRKKEGLQETTG
RLMI_PHOPR      PGITIDRYQNFLVCQLLSAGAEEQKDALVEALNICYPECSVYERSDVAVRKKEGLKQRTG
RLMI_ALTMD      PGVTIDLYDNVAVVQLLSAGGEKHRDKIVWAITKLMPDVHVYERSDVDVRKKEGLEPVTG
RLMI_PSEA6      PGVTIDVYANVIVCQLLSAGADKHREKIVWALKAQFPEHGIYERSDVAVRKKEGLEEITQ
RLMI_PSET1      PGVTIDKFDNVLVCQLLSAGAERHKGEIVGALMAIFPGMSIYERSDVEVRTKEGLEPIKG
RLMI_COLP3      PGVTIDKYDNFIVCQLLSAGADFHRYTIVNCLTELYPGCHIYERSDVDVRKKEGLEPVTG
RLMI_SHEB5      PGITIDRYANVLVCQLLSTGADLWRDTLVELLAEQYPDCAIYERSDVDSRKKEGLLPVTG
RLMI_SHEB9      PGITIDRYANVLVCQLLSTGADLWRDTLVELLAEQYPDCAIYERSDVDSRKKEGLLPVTG
RLMI_SHEB8      PGITIDRYANVLVCQLLSTGADLWRDTLVELLAEQYPDCAIYERSDVDSRKKEGLLPVTG
RLMI_SHEPC      PGITIDRYANVLVCQLLSTGADLWRDTLVELLAEQYPDCAIYERSDVDSRKKEGLLPVTG
RLMI_SHESW      PGITIDRYANVLVCQLLSTGADLWRDTLVELLAEQYPDCAIYERSDVDSRKKEGLLPVTG
RLMI_SHESM      PGITIDKYANVLVCQLLSMGADVWRDTIVDVLAELYPDCAIYERSDVDSRKKEGLASTMG
RLMI_SHESR      PGITIDKYANVLVCQLLSMGADVWRDTIVDVLAELYPDCAIYERSDVDSRKKEGLASTMG
RLMI_SHESA      PGITIDKYANVLVCQLLSMGADVWRDTIVDVLAELYPDCAIYERSDVDSRKKEGLASTMG
RLMI_SHEON      PGITIDKYANVLVCQLLSMGADVWRDTIVDVLAELYPDCAIYERSDVDSRKKEGLASTMG
RLMI_SHEDO      PGITIDRYADVLVCQLLNTGAEKWRDTLVEQLALQFPGCAIYERSDVDSRKKEGLAPVQG
RLMI_SHEFN      PGITIDRYANVLVCQLLSTGAEKWRDTIVEQLVLQYPDCAVYERSDVDSRKKEGLVPVVG
RLMI_SHEAM      PGITIDRYANVLVCQLLSAGADYWRETLVSVLAEQFPECAIYERSDVDSRKKEGLPLVTG
                **:*** :    * *:*. *.:  :  :   :    *   :*:****  *.***:     

RLMI_AERHH      VIYGETPTEPVVIEENGGVKILVDIRNGHKTGFYLDQRDNRQAAAKYTEGKRVLNCFCYT
RLMI_AERS4      VIHGETPTEPVVIEENG-VKILVDIRNGHKTGFYLDQRDNRQAVSKYTSAKRVLNCFSYT
RLMI_ECOLI      PVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECODH      PVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOLC      PVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOHS      PVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECO24      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECO57      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECO5E      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_SHIB3      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_SHIBS      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_SHIFL      LLTGELPPALLPIEEHG-MNLLVDIHHGHKTAYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_SHIF8      LVTGELPPALLPIEEHG-MKLLVDIHHGHKTAYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_SHIDS      LVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOK1      PITGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOL6      PITGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOL5      PITGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOUT      PITGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_ECOSM      PVTGELPPALLPIEEHG-MKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYT
RLMI_CITK8      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALCH      PVTGELPPALLPIEEYG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALPB      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALHS      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALTY      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALA4      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALDC      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALEP      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALG2      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALPA      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALPK      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALTI      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLVTRRYVENQRVLNCFSYT
RLMI_SALSV      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALNS      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_SALAR      PVTGELPPALLPIEEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYT
RLMI_ENT38      TVTGELPPALLPIEEHG-MKLFVDIQGGHKTGYYLDQRDSRLATRQYVKDKRVLNCFSYT
RLMI_CROS8      PVSGELPPDLLAIEEHG-MKLLVDIKGGHKTGYYLDQRDSRFATRRYVEDKRVLNCFSYT
RLMI_KLEP3      PVVGELPPALLPITEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVADKRVLNCFSYT
RLMI_KLEP7      PVVGELPPALLPITEHG-MKLLVDIQGGHKTGYYLDQRDSRLATRRYVADKRVLNCFSYT
RLMI_YERPE      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPY      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPP      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPG      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPA      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPN      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPS      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERPB      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERP3      LICGEMPPALLPISENG-MQLFVDIQQGHKTGFYLDQRDSRLAARNYANGRRVLNCFSYT
RLMI_YERE8      TVWGEMPPALLPITEHG-MKLLVDIQHGHKTGFYLDQRDSRLAARNYADGRRVLNCFSYT
RLMI_SERP5      QVVGDLPPALLPITEHG-MKLLVDIQQGHKTGFYLDQRDSRLAARNYSAGRRVLNCFSYT
RLMI_ERWT9      VVLGDAPPPLLPITEHG-MKLLVDIQTGHKTGYYLDQRDSRQATRRYAQGRRVLNCFSYT
RLMI_ALIF1      VLHGEEPPESVVIEENG-VKISVDIVNGHKTGFYLDQRDSRERACKYVKNKSVLNCFSYT
RLMI_ALIFM      VLHGEEPPESVVIEENG-VKISVDIVNGHKTGFYLDQRDSRERACKYVKDKSVLNCFSYT
RLMI_ALISL      VLHGEEPPESVIIEENG-VKISVDIVNGHKTGFYLDQRDSRERSCKYVKDKSVLNCFSYT
RLMI_VIBCH      VLHGELPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRFQSMKYVKEKEVLNCFSYT
RLMI_VIBC3      VLHGELPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRFQSMKYVKEKEVLNCFSYT
RLMI_VIBCB      VLHGEEPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRQQAMKYVKDKEVLNCFSYT
RLMI_VIBPA      VLHGEEPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRQQAMKYVKDKEVLNCFSYT
RLMI_VIBVU      VLHGEMPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRQQAMKYVKDKEVLNCFSYT
RLMI_VIBVY      VLHGEMPPKSVVIEENG-VKISVDIVGGHKTGFYLDQRDSRQQAMKYVKDKEVLNCFSYT
RLMI_PHOPR      VLSGEEPPKFVTIEENG-IKINVDIVGGHKTGFYLDQRDSRQAAVKYVNGKRVLNCFCYT
RLMI_ALTMD      VLHG-QPPTQVTVKENG-INIVVDIESGHKTGFYLDQRDSRAAAAHYAKDADVLNCFSYT
RLMI_PSEA6      VLAG-DIPDEVIIEENG-VKIIVNVKQGHKTGFYLDQRDNRAIAAQYAKDRDVLNCFCYT
RLMI_PSET1      ALWGNEPTAPVLIAENG-FKIEVDIIDGHKTGFYLDQRDSRAALERFSKDKTVLNCFSYT
RLMI_COLP3      WLTEPQDSTECIIEEHG-IKIHVDIATGHKTGFYLDQRDSRLAAGKFAKDKTVLNCFSYT
RLMI_SHEB5      LLHGTLPEMPVIIEENG-IKIAVDVIKGHKTGFYLDQRDNRAIAARFVKDKSVLNCFCYT
RLMI_SHEB9      LLHGTLPEMPVIIEENG-IKIAVDVIKGHKTGFYLDQRDNRAIAARFVKDKSVLNCFCYT
RLMI_SHEB8      LLHGTLPEMPVIIEENG-IKIAVDVIKGHKTGFYLDQRDNRAIAARFVKDKSVLNCFCYT
RLMI_SHEPC      LLHGTLPEMPVIIEENG-IKIAVDVIKGHKTGFYLDQRDNRAIAARFVKDKSVLNCFCYT
RLMI_SHESW      LLHGTLPEMPVIIEENG-IKIAVDVIKGHKTGFYLDQRDNRAIAARFVKDKSVLNCFCYT
RLMI_SHESM      LLHGTLPEMPVIIEENG-IKIAVDVTKGHKTGFYLDQRDNRAMAARFVKGKSVLNCFCYT
RLMI_SHESR      LLHGSLPEMPVIIEENG-IKIAVDVTKGHKTGFYLDQRDNRAMAARFVKGKSVLNCFCYT
RLMI_SHESA      LLHGTLPEMPVIIEENG-IKIAVDVTKGHKTGFYLDQRDNRAMAARFVKGKSVLNCFCYT
RLMI_SHEON      LLHGTLPEMPLIIEENG-IKIAVDVTKGHKTGFYLDQRDNRAIAARFVKGKSVLNCFCYT
RLMI_SHEDO      LLHGELPAMPIIIEENG-IKIAVDVVKGHKTGFYLDQRDNRAIAARFVKGKSVLNCFCYT
RLMI_SHEFN      LLHGELPAMPVIIEENG-IKIAVDVVKGHKTGFYLDQRDNRAMAARFVKGKSVLNCFCYT
RLMI_SHEAM      LLHGELPAMPLIIEENG-IKIAVDVEKGHKTGFYLDQRDNRAMAGRFVEGKSVLNCFCYT
                 :          : * * .:: *::  ****.:******.*    .:     *****.**

RLMI_AERHH      GGFGVYALKGGAKEVVNVDLSQNALDIARQNAELNGLDTSN--TQFVRHDVFKLLREYRE
RLMI_AERS4      GGFGIYALKGGAKEVVNVDLSQTALDMARQNAELNGLDISN--TQFIRHDVFKLLREYRE
RLMI_ECOLI      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECODH      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOLC      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOHS      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECO24      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECO57      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECO5E      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_SHIB3      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_SHIBS      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_SHIFL      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_SHIF8      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_SHIDS      GGFAVSALMGGCNQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOK1      GGFAVSALMGGCSQVVSVDTSHEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOL6      GGFAVSALMGGCSQVVSVDTSHEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOL5      GGFAVSALMGGCSQVVSVDTSHEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOUT      GGFAVSALMGGCSQVVSVDTSHEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_ECOSM      GGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSK--AEFVRDDVFKLLRTYRD
RLMI_CITK8      GGFAVSALMGGCRQVVSVDTSQEALDIAKQNVELNKLDLSK--AEFVRDDVFKLLRAYRD
RLMI_SALCH      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALPB      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALHS      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALTY      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALA4      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALDC      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALEP      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALG2      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALPA      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALPK      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALTI      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALSV      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALNS      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_SALAR      GGFAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSK--AEFVRDDVFKLLRAYRE
RLMI_ENT38      GGFAVSALMGGCSQVVSVDTSQEALDVAKQNVELNKLDLSK--AEFVRDDVFKLLRKYRD
RLMI_CROS8      GGFAVSALMGGCRQVISVDTSQDALDVAKQNVELNKLDLSK--AEFVRDDVFKLLRKYRD
RLMI_KLEP3      GGFAVSALMGGCRQVTSVDTSQEALDVARQNVELNGLDLSK--AEFVRDDVFKLLRKYRD
RLMI_KLEP7      GGFAVSALMGGCRQVTSVDTSQEALDVARQNVEINGLDLSK--AEFVRDDVFKLLRKYRD
RLMI_YERPE      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPY      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPP      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPG      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPA      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPN      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPS      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERPB      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERP3      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNIELNQLDLSK--TEFVRDDVFQLLRSYRA
RLMI_YERE8      GAFAVAALMGNCQQVISVDTSQSVLDIAKQNVELNQLDLSK--AEFIRDDVFQLLRNYRA
RLMI_SERP5      GAFAVSALMGGCTQVISVDTSQAALDIAKQNVELNQLDLSK--AEFVRDDVFQLLRAYRT
RLMI_ERWT9      GGFAVSALMGNCKEVISVDTSQAALDVARQNVELNGLDVSK--AHFQRDDVFKLLRRYRD
RLMI_ALIF1      GGFGLYALKGGAKHVINADVSQLALDTAKYNAEINKFDLSK--AEFLNADVFKLLREYRD
RLMI_ALIFM      GGFGLYALKGGAKHVINADVSQLALDTAKYNAEINKFDLSK--AEFLNADVFKLLREYRD
RLMI_ALISL      GGFGLYALKGGAKHVINADVSQLALDNAKNNTEINGFDLSK--AEFLNADVFKLLREYRD
RLMI_VIBCH      GGFGLYALKGGAKRVINADVSQPALDTAKFNAELNGFDISKKRAVFLNADVFKLLREYRD
RLMI_VIBC3      GGFGLYALKGGAKRVINADVSQPALDTAKFNAELNGFDISKKRAVFLNADVFKLLREYRD
RLMI_VIBCB      GGFGLYALKGGAKRVINADVSQPALDTAKFNAELNEFDISKKRAVFLNADVFKLLREYRD
RLMI_VIBPA      GGFGLYALKGGAKRVINADVSQPALDTAKYNAELNEFDISKKRAVFLNADVFKLLREYRD
RLMI_VIBVU      GGFGLYALKGGAKRVINADVSQPALDTAKFNAELNEFDISKKRAVFLNADVFKLLREYRD
RLMI_VIBVY      GGFGLYALKGGAKRVINADVSQPALDTAKFNAELNEFDISKKRAVFLNADVFKLLREYRD
RLMI_PHOPR      GGFGLYALKGGASQVVNVDVSQPALDTARLNTEANGLPVEN--AEFVNADVFKLLREYRE
RLMI_ALTMD      GTFSCYALSGGAKSVTNVDVSQPALDLAKHHVAINGFDDKR--TQYLNKDVFKALREYHE
RLMI_PSEA6      GTFGSYALAAGACSVTSLDVSDLALETAKRNVDINQLDSSK--CEFINHDVFQALRDYKA
RLMI_PSET1      GTFSLYALRGGCKHVTNVDVSQPALDTAKRNVEHNNLDLDK--VDFVKQDVFKLLRQYRE
RLMI_COLP3      STFALHCAANNAKEVINVDVSQDALDMGERNLALNGLSDAN--VSFVKEDVFKLLRRYRE
RLMI_SHEB5      GTFGLYAAKAGAASIENVDVSSLALATARLNMQVNGLSDDN--VHYNEADVFKLLRLYRD
RLMI_SHEB9      GTFGLYAAKAGAASIENVDVSSLALATARLNMQVNGLSDDN--VHYNEADVFKLLRLYRD
RLMI_SHEB8      GTFGLYAAKAGAASIENVDVSSLALATARLNMQVNGLSDDN--VHYNEADVFKLLRQYRD
RLMI_SHEPC      GTFGLYAAKAGAASIENVDVSSLALATARLNMQVNGLSDDN--VHYNEADVFKLLRQYRD
RLMI_SHESW      GTFGLYAAKAGAASIENVDVSSLALATARLNMQVNGLSDDN--VHYNEADVFKLLRQYRD
RLMI_SHESM      GTFGLYAAKAGAASIENVDVSALALDTARLNMRVNGLNDDN--VHYNEADVFKLLRQYRD
RLMI_SHESR      GTFGLYAAKAGAASIENVDVSALALDTARLNMRVNGLNDDN--VHYNEADVFKLLRQYRD
RLMI_SHESA      GTFGLYAANAGAASIENVDVSALALDTARLNMRVNGLNDDN--VHYNEADVFKLLRQYRD
RLMI_SHEON      GTFGLYAAKAGAASIENVDVSSLALDTARLNMRVNGLSDDN--VHYNEADVFKLLRQYRD
RLMI_SHEDO      GTFGLYAAKAGAASIENVDVSALALQTARDNMAINGLDDSH--VNYHEADVFKLLRQYRD
RLMI_SHEFN      GTFGLYAAKAGAASIENVDVSTLALQTARDNMAINNLNDDH--VNYNEADVFKLLRQYRD
RLMI_SHEAM      GTFGLYAAKAGAASIENVDVSTLALDTARHNMAINGLNDDH--VTYSEADVFKLLRQYRD
                . *.  .   ..  : . * *  .*  .. :   * :   .    : . ***: ** *: 

RLMI_AERHH      KGDKFDVIVLDPPKFAESKAQLLGACRGYKDINMLAFQLLAPGGVLLTYSCSGLMEQSLF
RLMI_AERS4      KGEKFDVIVLDPPKFAESKAQLLGACRGYKDINMLAFQLLAPGGVLLTYSCSGLMEQSLF
RLMI_ECOLI      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECODH      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOLC      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOHS      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECO24      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECO57      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECO5E      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_SHIB3      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_SHIBS      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_SHIFL      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_SHIF8      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_SHIDS      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOK1      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOL6      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOL5      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOUT      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLF
RLMI_ECOSM      RGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNEGGVLLTFSCSGLMTSDLF
RLMI_CITK8      RREKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLF
RLMI_SALCH      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALPB      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALHS      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALTY      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALA4      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALDC      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALEP      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALG2      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALPA      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALPK      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALTI      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALSV      HGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALNS      RGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_SALAR      RGEKFDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLF
RLMI_ENT38      QGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTTDLF
RLMI_CROS8      QGETFDVIVMDPPKFVENKSQLQGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTTDLF
RLMI_KLEP3      QGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLF
RLMI_KLEP7      QGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLF
RLMI_YERPE      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPY      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPP      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPG      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPA      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPN      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPS      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERPB      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERP3      QGEKFDLIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPVDLF
RLMI_YERE8      QGEKFDMIIMDPPKFVENKSQLASACRGYKDINMLAIQLLRPGGILLSFSCSGLMPTDLF
RLMI_SERP5      QGEKFDLIIMDPPKFVENKNQLAGACRGYKDINMLALQLLNPGGILLSFSCSGLMPTDLF
RLMI_ERWT9      EGEKFDLIIMDPPKFVENKNQLMGACRGYKDINMLAMQLLNPGGMLMTFSCSGLMATDLF
RLMI_ALIF1      NGTKFDVVIMDPPKFAESKNQLTGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDAGLF
RLMI_ALIFM      NGTKFDVVIMDPPKFAESKNQLTGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDAGLF
RLMI_ALISL      NGTKFDVVIMDPPKFAESKNQLVGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDTGLF
RLMI_VIBCH      QGTRFDVVVMDPPKFAESKAQLDGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDQVLF
RLMI_VIBC3      QGTRFDVVVMDPPKFAESKAQLDGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDQVLF
RLMI_VIBCB      QGTKFDVVIMDPPKFAESKAQLNGACRGYKDINMLAMQILNPGGTLLTYSCSGLMDQVLF
RLMI_VIBPA      QGTQFDVVIMDPPKFAESKAQLNGACRGYKDINMLALQILKPGGTLLTYSCSGLMDQVLF
RLMI_VIBVU      QGTKFDVVIMDPPKFAESKAQLNGACRGYKDINMLAFEILKSGGTLLTYSCSGLMDLALF
RLMI_VIBVY      QGTKFDVVIMDPPKFAESKAQLNGACRGYKDINMLAMQILKPGGTLLTYSCSGLMDQVLF
RLMI_PHOPR      RGEFFDVVIMDPPKFAESKSQLVGACRGYKDINMLAMQILNPGGILLTYSCSGLMDNGLF
RLMI_ALTMD      QNKQFDMVILDPPKFVDNKASLNRAARGYKDINMYGIHAVKSGGLLLTFSCSGLMPADLF
RLMI_PSEA6      QSKQFSQIILDPPKFVDSKASLNRACRGYKDINMLAMQIMAPGGILATFSCSGLMPFDLF
RLMI_PSET1      DGVLFDTIVMDPPKFADNKAQLTGACRGYKDINMIAMQILKPGGTLLTFSCSGLMEQNLF
RLMI_COLP3      EKRTFDMIILDPPKFVESKAQLTGACRGYKDINMIAMQLLNPGGLLLTFSCSGLMEASLF
RLMI_SHEB5      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHEB9      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHEB8      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHEPC      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHESW      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHESM      EGKTFDVIVLDPPKFADNKSQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHESR      EGKTFDVIVLDPPKFADNKSQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHESA      EGKTFDVIVLDPPKFADNKSQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHEON      EGKTFDVIVLDPPKFADNKSQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLF
RLMI_SHEDO      EGKTFDVIVLDPPKFADNKSQLNGACRGYKDINMIAMQLLNPGGILLTFSCSGLMESDLF
RLMI_SHEFN      EGKTFDVIVLDPPKFADNKSQLDGACRGYKDINMIAMQLLNPGGILLTFSCSGLMQSDLF
RLMI_SHEAM      EGKTFDVIVLDPPKFADNKAQLNGACRGYKDINMIAMQLLKPGGTLLTFSCSGLMPADLF
                    *. :::*****.:.* .*  *.******** .:. :  ** * ::******   **

RLMI_AERHH      QKIVADAALDAGRDAQILELLSQASDHPIGTAYPEGFYLKGLVVRAR--
RLMI_AERS4      QKIVADAALDAGRDAQILELLSQASDHPIGTAYPEGFYLKGLVVRAR--
RLMI_ECOLI      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECODH      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOLC      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOHS      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECO24      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECO57      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECO5E      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SHIB3      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SHIBS      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SHIFL      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SHIF8      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SHIDS      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVIVM
RLMI_ECOK1      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOL6      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOL5      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOUT      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ECOSM      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_CITK8      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALCH      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALPB      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALHS      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALTY      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALA4      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALDC      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALEP      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALG2      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALPA      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALPK      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALTI      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALSV      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALNS      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_SALAR      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ENT38      QKLVADAAVDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_CROS8      QKIVADAATDAGRDVQFIEQFRQAADHPVIASYPEGLYLKGFACHVM--
RLMI_KLEP3      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_KLEP7      QKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_YERPE      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPY      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPP      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPG      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPA      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPN      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPS      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERPB      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRVM--
RLMI_YERP3      QKILADAALDAGHDIQFIEQFRQAADHPVIAAYPEGLYLKGFACRIM--
RLMI_YERE8      QKILADAALDAGHDIQFIEQFRQAADHPVIATYPEGLYLKGFACRIM--
RLMI_SERP5      QKILADAAVDAGRDVQFIEQYRQAADHPVIATYPEGLYLKGFACRVM--
RLMI_ERWT9      QKILADAAVDAQREVQFIEQFRQAADHPVISSYPEGMYLKGFACRVI--
RLMI_ALIF1      QKIVADAALDAHRTVQFIERFEQAADHPLDSAYPEGFYLKGFACRVV--
RLMI_ALIFM      QKIVADAALDAHRTVQFIERFEQAADHPLDSAYPEGFYLKGFACRVV--
RLMI_ALISL      QKIVADAALDAKRTVQFIERFEQAADHPLDSAYPEGFYLKGFACRVI--
RLMI_VIBCH      QKIIADAALDAGRDVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL--
RLMI_VIBC3      QKIIADAALDAGRDVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL--
RLMI_VIBCB      QKIIADAAVDANRQVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL--
RLMI_VIBPA      QKIIADAAVDANRQVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL--
RLMI_VIBVU      QKIIADAAVDAGRTVKFVERFEQAADHPVDTAYPEGFYLKGFACKVI--
RLMI_VIBVY      QKIIADAAVDAGRSVKFVERFEQAADHPTDTAYPEGFYLKGFACKVL--
RLMI_PHOPR      QKIVADAALDAHREVQFIERFGQAADHPLDSAYPEGFYLKGFACYVK--
RLMI_ALTMD      QKVVADAALDAGRTIKIIARLNQASDHPIIGSYPEGYYLKGLVCEVTDD
RLMI_PSEA6      QKVVADAALDAGREVQIIQRLSQAPDHPVSTNYPEGFYLKGLICKVL--
RLMI_PSET1      QKVVADAALDAGKDLLIMERLNQAADHPIAGSYPEGFYLKGLICKVY--
RLMI_COLP3      QKVVADAALDAKRKAYFVERLQQAADHPISSNYPEGYYLKGLVCQVE--
RLMI_SHEB5      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARAW--
RLMI_SHEB9      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARAW--
RLMI_SHEB8      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARAW--
RLMI_SHEPC      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARAW--
RLMI_SHESW      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARAW--
RLMI_SHESM      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARVW--
RLMI_SHESR      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARVW--
RLMI_SHESA      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARVW--
RLMI_SHEON      QKIVADAALDAKREIQFIERLSQASDHPIGSAFPEGFYLKGLVARVW--
RLMI_SHEDO      QKVVADAALDAKREVQFVERMHQASDHPISSAFPEGYYLKGLVARVW--
RLMI_SHEFN      QKVVADAALDAKREVQFIERMHQASDHPISSAFPEGYYLKGLVARVW--
RLMI_SHEAM      QKIVADAALDAGRDAQFIERLSQASDHPIGAAFPEGFYLKGLVARVW--
                **::**** ** :   ::    **.***    :*** ****: