CLUSTAL format seed alignment for MF_01858

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMKL_STRMK       ----------------------------MKFFVSCAKGLEYLLADELSALGLG-KATATI
RLMKL_STRM5       ----------------------------MKFFVSCAKGLEYLLADELSALGLE-KATATI
RLMKL_XANAC       ----------------------------MKFFASCAKGLEYLLADELLALGAS-RATATI
RLMKL_XANC5       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANOM       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANOP       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANOR       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANCP       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANC8       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XANCB       ----------------------------MKFFASCAKGLEYLLADELLALGAS-KATATI
RLMKL_XYLF2       ----------------------------MRFFVSCAKGLEYLLVDEVLALGAA-GATATV
RLMKL_XYLFT       ----------------------------MRFFVSCAKGLEYLLVDEVLALGAA-GATATV
RLMKL_XYLFM       ----------------------------MRFFVSCAKGLEYLLVDEVLALGAA-GATATV
RLMKL_XYLFA       ----------------------------MRFFVSCAKGLEYLLVDEVLALGAV-GATATV
RLMKL_ALKEH       --------------------MNEHHS----LFAACPRGLEPALVEELARLGVA-QPRAQR
RLMKL_CHRSD       --------------------MNDVQSQPLTLYIACPRGLEGLLADELADFGAE-VTGTTV
RLMKL_MARHV       --------------------MSKHVF-----FVTCPKGVEYLLADELKEFGLN-LVRNAP
RLMKL_PSEAE       --------------------MADVYE----LFLTCPKGLESLLLEEAQGLGLD-EARAQV
RLMKL_PSEA7       --------------------MADVYE----LFLTCPKGLESLLLEEAQGLGLS-EARAQV
RLMKL_PSEP1       --------------------MSDRFE----LYLTCPKGLESLLAEEAKGLGLD-EVREHT
RLMKL_PSEPK       --------------------MSDRFE----LYLTCPKGLESLLAEEAKGLGLD-EVREHT
RLMKL_PSEPG       --------------------MSDRFE----LYLTCPKGLEGLLAEEAKGLGLE-EVREHT
RLMKL_PSEPW       --------------------MSDRFE----LYLTCPKGLEGLLAEEAKGLGLD-DVREHT
RLMKL_PSEE4       --------------------MSDRFE----LYLTCPKGLEGLLAEEANQLGLT-EVREHT
RLMKL_PSEF5       --------------------MSDRYE----LFLTCPKGLEGLLIEEAVGLGLE-QAREHT
RLMKL_PSEPF       --------------------MSDRFE----LFLTCPKGLEGLLIEEAVGLGLE-EAREHT
RLMKL_PSE14       --------------------MSDRYE----LFLTCPKGLEGLLAEEATALGLQ-ETREHT
RLMKL_PSEU2       --------------------MSDRYE----LFLTCPKGLEGLLAEEATALGLQ-ETREHT
RLMKL_PSESM       --------------------MSDRYE----LFLTCPKGLEGLLAEEATALGLQ-ETREHT
RLMKL_PSEMY       --------------------MSDRYE----IVLTCPKGLEGLLLEEARALGLE-EAREQT
RLMKL_PSEU5       --------------------MTDRHE----LILTCPKGLEGLLLEEATALGLE-EGREQT
RLMKL_METCA       --------------------MPMTRD----FFATAPKGLEPLLVRELDGLGAE-SIKETR
RLMKL_PELCD       --------------------MDAPIK----FFATAPKGVEPLLADELRALGAL-EVSETR
RLMKL_ALLVD       ---------------------MSDHI----FFASAPKHLGSLLAEELTRLGMA-GAAETR
RLMKL_HYDCU       -----------------------MCR----FFATAPKGLNELLREELTTFGAE-NIKTQP
RLMKL_CELJU       --------------------------MIHQYFAACPKGLEGLLLQELQALGAT-DTRETI
RLMKL_SACD2       -----------------MPTETNQNTTQYDLFVSCSQGWEGLLQTELEQLAVG-DVKPGH
RLMKL_MARMS       --------------MSTILQTTDSASQVYALEITCPLGLENVLEKELHGEGLT-QTRLGE
RLMKL_LEGPC       --------------------------MNYSLFISCSKGLEYLLEDELKGLGLH-VTQVSP
RLMKL_LEGPA       --------------------------MNYSLFISCSKGLEYLLEDELKGLGLH-VTQVSP
RLMKL_LEGPH       --------------------------MNYSLFISCSKGLEYLLEDELKGLGLH-VTQVSP
RLMKL_LEGPL       --------------------------MNYSLFISCAKGLEYLLEDELKGLGLH-VTQVSP
RLMKL_HAHCH       -------------------------MNEFSLFASCPKGLEYVLADELKTLGAE-VLRTNP
RLMKL_DICNV       -----------------------MDEPLFSCVLPCAKGSEQVLQQEAEQLGVQ-TLSIAP
RLMKL_MAGMM       ---------------------------MYRYFATTARGLEPALAAELKRMGAK-SVRPAS
RLMKL_ALTMD       ---------------------------MNTILVTTSRGLDELLKQEVLTLCPDAQIKQGP
RLMKL_PSEA6       ---------------------------MFEFLVTTSKGLDELLAQEITKLCPQLSVKTKP
RLMKL_COLP3       -----------------------MKESTQQFLALTSPGIEVLLFDEIKSLGAFNVIQK-P
RLMKL_PSEHT       ----------------------------MQFIALTSIGIENLLVDELTELGATVSKQT-V
RLMKL_ALIF1       ---------------------------MKKYLAITSKGLENLLADELIALGVT-DPKVVH
RLMKL_ALIFM       ---------------------------MKKYLAITSKGLENLLADELIALGVT-DPKVVH
RLMKL_ALISL       ---------------------------MKKYLAITSKGLENLLADELVALGVT-DPKLVY
RLMKL_PHOPR       ---------------------------MNQYLAITSRGLENLLAEELEQLGAQ-SIQVVH
RLMKL_VIBCH       ---------------------------MNQYLAVTSNGLENLLVEELTQLGIN-DAKPVQ
RLMKL_VIBC3       ---------------------------MNQYLAVTSNGLENLLVEELTQLGIN-DAKPVQ
RLMKL_VIBCB       ---------------------------MNQYLAVTSNGMENLLAEELTKLGIE-NAKPVQ
RLMKL_VIBPA       ---------------------------MNQYLAVTSNGMENLLVEELTKLGIE-NAKPVQ
RLMKL_VIBVY       ---------------------------MNQYLAVTSNGLENLLAEELTKLGIA-DAKPVQ
RLMKL_AERHH       ---------------------------MKEFFATCPKGLENLLAVELTNLGAE-QVRETV
RLMKL_AERS4       ---------------------------MKEFFATCPKGLENLLADELTTLGAE-QVRETV
RLMKL_BUCAI       ---------------------------MNDLFASTNFGTEKLLEKELLSLGVS-DIKIIK
RLMKL_BUCAP       ---------------------------MNYLFASTNFGCEELLEKELRALGAK-NLKVVK
RLMKL_SHIFL       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SHIF8       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOLI       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOHS       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOLC       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECODH       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECO57       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECO5E       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECO24       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SHIDS       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SHIB3       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SHIBS       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SHISS       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOSM       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOL5       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOUT       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOK1       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_ECOL6       ---------------------------MNSLFASTARGLEELLKTELENLGAV-ECQVVQ
RLMKL_SALA4       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALTY       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALDC       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALEP       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALHS       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALNS       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALPA       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALPK       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALPB       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALG2       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALCH       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALSV       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-GCQVVQ
RLMKL_SALTI       ---------------------------MNSLFASTARGLEELLKIELEKLGAV-GCQVVQ
RLMKL_SALAR       ---------------------------MNSLFASTARGLEELLKTELEKLGAV-ECQVVQ
RLMKL_CITK8       ---------------------------MNSLFASTARGLEELLKTELENLGAA-DCQVVQ
RLMKL_KLEP3       ---------------------------MNSLFASTARGLEELLKTELEGLGAT-DCQVVQ
RLMKL_KLEP7       ---------------------------MNSLFASTARGLEELLKTELEGLGAT-DCQVVQ
RLMKL_ENT38       ---------------------------MNSLFASTARGLEELLKTELESLGAR-ECQVVQ
RLMKL_CROS8       ---------------------------MKALFASTARGLEELLKTELENLGAQ-ECQVVQ
RLMKL_ERWT9       ---------------------------MNSLFASTARGLEELLKNELEGLGAE-SCQIVQ
RLMKL_YERPG       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPY       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPA       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPN       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPE       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPP       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPS       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERP3       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERPB       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_YERE8       ---------------------------MNSLFASTARGLEELLKSELEALGAH-DCKIVQ
RLMKL_SERP5       ---------------------------MNSLFASTARGLEELLKSELEALGAH-ACKVVQ
RLMKL_PECAS       ---------------------------MNALFASTARGLEELLKSELESLGAQ-SCAVVQ
RLMKL_PHOLL       ---------------------------MNSLFASTARGLEELLKNELEMLGAQ-SCKIVQ
RLMKL_PROMH       ---------------------------MRSLFASTGRGLEELLKTELEHLGAQ-SCQITQ
RLMKL_SODGM       ---------------------------MNSLFATTAQGLEELLRSELETLGAA-SCKVAL
RLMKL_HAEIE       ---------------------------MKQLFATTSRGFEELLKVELTELGAQ-EAKVVQ
RLMKL_HAEIG       ---------------------------MKQLFATTSRGFEELLKVELTELGAQ-EAKVVQ
RLMKL_HAEIN       ---------------------------MKQLFATTSRGFEELLKVELTELGAQ-EAKVVQ
RLMKL_HAEI8       ---------------------------MKQLFATTSRGFEELLKVELTELGAQ-EAKVVQ
RLMKL_HAES1       ---------------------------MKQLFATTSRGFEELLKVELTDLGAQ-ECRVVQ
RLMKL_HISS2       ---------------------------MKQLFATTSRGFEELLKVELTDLGAQ-ECRVVQ
RLMKL_ACTSZ       ---------------------------MKPLFATCARGFEELLKTELTELGAQ-DVRIAQ
RLMKL_MANSM       ---------------------------MKELFATTARGFEELLKLELSSLGAT-ECQVAQ
RLMKL_PASMU       ---------------------------MKQLFATTARGFEELLKVELTDLGAM-DCQITQ
RLMKL_ACTPJ       ------------------------MTTQITYFATAARGFEEMLKTELEQICQA-ECKVAQ
RLMKL_ACTP2       ------------------------MTTQITYFATAARGFEEMLKTELEQICQA-ECKVTQ
RLMKL_ACTP7       ------------------------MTTQITYFATAARGFEEMLKTELEQICQA-ECKVAQ
RLMKL_HAEDU       ------------------------MSNQITYFATAARGFEEMLKIELEQICGA-DGKVVQ
RLMKL_PSYIN       ---------------------------MLSYFIPTAKGLAPLLEVELKEMGIE-NPQQMN
RLMKL_SHEB5       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EVKESV
RLMKL_SHEB9       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EVKESV
RLMKL_SHEB8       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EVKESV
RLMKL_SHEPC       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHESW       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHESM       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHESR       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHESA       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHEON       ---------------------------MLNFFAAAPKGFEYSLAQELTEFGAT-EIKESV
RLMKL_SHEDO       ---------------------------MFNFFAAAPKGFEYSLANELTEFGAT-DVKESV
RLMKL_SHEFN       ---------------------------MFNFFAAAPKGFEYSLASELKEFGAT-DVKESV
RLMKL_SHEHH       ---------------------------MLNFFAAAPRGYEYALSLELAELGAS-EIKESV
RLMKL_SHEPA       ---------------------------MLNFFAAAPRGYEYALSLELAELGAS-EIKESV
RLMKL_SHESH       ---------------------------MLNFFAAAPRGYEYALSLELADLGAS-EIKESV
RLMKL_SHEWM       ---------------------------MLNFFAAAPRGYEYALSLELADLGAS-DIKESV
RLMKL_SHELP       ---------------------------MLNFFAAAPRGYEYALSLELAEFGAA-EIKESV
RLMKL_SHEAM       ---------------------------MFNFFAAAPKGFEYALAKELETLGAE-NVRESV
RLMKL_IDILO       ---------------------------MYRFFIACSKGLEGLLFDELQEFNLS-HVKQTL
RLMKL_FRATF       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATH       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATO       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATW       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATT       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRAT1       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATM       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRATN       ------------MQ-------------KFTFFVSCAKGIELLLKDELERLGIS-SQ-EKL
RLMKL_FRAP2       ------------MQ-------------NFTFFASCAKGIELLLKDELDALGIS-SS-EKL
D0KZE4_HALNC      -----MTDLASSAL-------------SWPITVVSAPDMQAPLAEEIRSLVDA-KVSDRP
RLMKL_ACIBY       ----MNTSLRLNHY-----------------WITCADGLETLLQEEIEQLGTK-VTERKA
RLMKL_ACIBS       ----MNTSLRLNHY-----------------WITCADGLETLLQEEIEQLGTK-VTERKA
RLMKL_ACIBC       ----MNTSLRLNHY-----------------WITCADGLETLLQEEIEQLGTK-VTERKA
RLMKL_ACIAD       ----MNSPQRLSTY-----------------WVTCADGLETLLQQELQGLGIE-QTERFA
RLMKL_PSYA2       --MTETTALASSTVSSAP--------LSLDLIITCADGLEAPLQTELTSFGIA-SEMKST
RLMKL_PSYCK       --MTETTALASSTASSQPSSQASSQVLSLDLIITCADGLEAPLQTELTSFGIA-SEIKST
RLMKL_PSYWF       MSTPENTLVTPNTSDTIPTASAA---KRYDIVVTCADGLEAPLQTELSHMDIS-HELKST
RLMKL_DESPS       --MCDKKDVSPQKD-------------QYTFLANCALGLEELIEAEIKGFSGV-EVELGK
G8QSR6_SPHPG      ----------------------------MIFFATSALYMNDIVEQEALNAGGT-DIRTVS
F0RUX4_SPHGB      ----------------------------MIFFATSALYMNDIIEEEAKAAGAT-DIKTIS
RLMKL_ALCBS       ----------------------------MEFVATCMPGLADLLSDELGSLGIS-VTETGR
C8WGP0_EGGLE      -----------------------MDNENLELFASCLSGLEAPLAEELKRLGIK-RVRPLG
F7V0X9_EEGSY      -----------------------MENKNLELFASCLAGLEAPLAEELKRLGIK-RVRPLG
E1QZ79_OLSUV      -------MAGTECGTPGTERSTAHAGPATRLFATCPMGFESLLADELSSLGLP-RVRALR
C8W7K3_ATOPD      ------------------------MSQELEFFATCPKGFEKLLSQELESLHIK-KVRPLG
F2N9W7_CORGP      ----------------------------MEFYASCPTGFEDALATEFRDLGLE-RVRRLK
C7N0P8_SLAHD      ---------------------MPERADQLEFFARCASGFEDQLAAELTQIRCR-RVRPLH
                                                            :  *              

RLMKL_STRMK       AGVNAEGELEQALRIVMWSRLASRVLWPIDEFE-------CPDEQALYDGVRALPWHEHI
RLMKL_STRM5       AGVNAEGELEQALRIVMWSRLASRVLWPIDAFE-------CPDEQALYDGVRALPWHEHI
RLMKL_XANAC       SGVNVEGELRDAQRAVLWSRLASRVLWPLTEFD-------CPDEDALYAGVAELPWDAHL
RLMKL_XANC5       SGVNVEGELRDAQRAVLWSRLASRVLWPLTEFD-------CPDEDALYAGVAELPWDAHL
RLMKL_XANOM       SGVNVEGELRDAQRAVLWSRLASRVLWPLSEFD-------CPDEDALYAGVAELPWDAHL
RLMKL_XANOP       SGVNVEGELRDAQRAVLWSRLASRVLWPLSEFD-------CPDEDALYAGVAELPWDAHL
RLMKL_XANOR       SGVNVEGELRDAQRAVLWSRLASRVLWPLSEFD-------CPDEDALYAGVAELPWDAHL
RLMKL_XANCP       SGVNVEGALRDAQRAVLWSRLASRVLWPLTEFD-------CPDEDALYAGVAELPWHEHL
RLMKL_XANC8       SGVNVEGALRDAQRAVLWSRLASRVLWPLTEFD-------CPDEDALYAGVAELPWHEHL
RLMKL_XANCB       SGVNVEGALRDAQRAVLWSRLASRVLWPLTEFD-------CPDEDALYAGVAELPWHEHL
RLMKL_XYLF2       AGVNVEGGLCDAQRLVLWSRLASRVLWPLAAFA-------CADEDALYAGVAALPWVEHV
RLMKL_XYLFT       AGVNVEGGLCDAQRLVLWSRLASRVLWPLAAFA-------CADEDALYAGVAALPWVEHV
RLMKL_XYLFM       AGVNVEGGLCDAQRLVLWSRLASRVLWPLAAFA-------CADEDALYAGVAALPWVEHV
RLMKL_XYLFA       AGVNVEGGLCDAQRLVLWSRLASRVLWPLAAFA-------CADEDALYAGVAALPWVEHV
RLMKL_ALKEH       AGVAWEGDLESALRACLWSRLASRILLGLSTVP-------VEDADGLYQAARDLPWEDHL
RLMKL_CHRSD       AGVHAQADTAMAYRICLWSRLANRVVLCLLREQG------IERPEALVEAARRVDWGAHL
RLMKL_MARHV       AGVWVEGELESGYRACLWSRLANRVILNVADVD-------ARSADELYAGVVDLDWQAHI
RLMKL_PSEAE       SAVRGQGSLEVAYRLCLWSRLANRVLLVLARFP-------VENAESMYMAVHAVNWEDHL
RLMKL_PSEA7       SAVRGQGSLEVAYRLCLWSRLANRVLLVLARFP-------VENAESMYLAVHAVNWEDHL
RLMKL_PSEP1       SAIRGAADMETAYRLCVWSRLANRVLLVLKRFS-------MKNADDLYDGVHAVDWADHL
RLMKL_PSEPK       SAIRGAADMETAYRLCVWSRLANRVLLVLKRFS-------MKNADDLYDGVHAVDWADHL
RLMKL_PSEPG       SAIRGAADMETAYRLCVWSRLANRVLLVLKRFS-------MKNADDLYDGVNAVDWADHL
RLMKL_PSEPW       SAIRGAADMETAYRLCLWSRLANRVLLVLKRFN-------MKNADDLYDGVNAVDWADHL
RLMKL_PSEE4       SAIRGSADMETAYRLCLWSRLANRVLLVLKRFS-------MKNADDLYDGVHAVDWAEHL
RLMKL_PSEF5       SAVRGMADMETAYRLCLWSRLANRVLLVLKRFP-------MKDAEDLYHGVLDVDWQDHM
RLMKL_PSEPF       SAVRGMATMETAYRLCLWSRLANRVLLVLKRFP-------MKNAEDLYHGVLDVDWQDHM
RLMKL_PSE14       SAIRGSADMETAYRLCLWSRLANRVLLVLKRFP-------MKDAEDLYHGVLDVEWQDHL
RLMKL_PSEU2       SAIRGSADMETAYRLCLWSRLANRVLLVLKRFP-------MKDAEDLYHGVLDVEWQDHL
RLMKL_PSESM       SAIRGSADMETAYRLCLWSRLANRVLLVLKRFP-------MKDAEDLYHGVLDVEWHDHL
RLMKL_PSEMY       AAVRGQAELEVAYRLCLWSRLANRVLLVLSRFS-------MNNAEELYEGVKAVDWRDHL
RLMKL_PSEU5       SAVRGYGALEVGYRLCLWSRLANRVLLVISRFP-------TVDAETLYQGVHAVDWAEHL
RLMKL_METCA       AGVEFRGTLETAYRVCLWSRLANRILMSLDRFA-------AATPEALYDGVQRTDWGRHF
RLMKL_PELCD       AGASFQGSLETAYRICLWSRLASRVLMPIAEFS-------AEDPDQLYAAVGAVPWEEHM
RLMKL_ALLVD       GGARFSGRIEDGYRACLWSRIANRILLPLAQVS-------LGGPDEIHDSALEIPWEDHL
RLMKL_HYDCU       TGATFDGDLEVGYRSCLWSRLANRIYLVLLETE-------LPNQEALSSVVQSIDWSKHI
RLMKL_CELJU       AGVYFNGDLNLAYRTCLWSRLANKILLPLANFE-------VNSQEDLYEGVRMLPWQDHL
RLMKL_SACD2       AGVYVSATLEQMYKICLWTRLATKVLLPLDSGP-------IETGDDVHTVASKVDWPSLM
RLMKL_MARMS       AQVKLTTDLEGMYKACLWSRVATRVMLPIANFK-------MESADDLYDGVKAIQWSDHM
RLMKL_LEGPC       QGVYGEASLPVIYNLCLWSRLANRIQLILFSGH-------AAKEQAVHQLCTDFHWQTVF
RLMKL_LEGPA       QGVYGEASLPVIYNLCLWSRLANRIQLILFSGH-------AAKEQAVHQLCTDFHWQTVF
RLMKL_LEGPH       QGVYGEASLPVIYNLCLWSRLANRIQLILFSGH-------ATKEQAVHQLCTDFHWQTVF
RLMKL_LEGPL       QGVYGEASLPVIYNLCLWSRLANRIQLILFSGH-------AAKEQAVHQLCTDFHWQTVF
RLMKL_HAHCH       AGVEAKVDLAGAYRICLGSRLANRVLRLLQSTR-------TATRDGLYQAASEVNWSEHL
RLMKL_DICNV       AVVRGKASLLTFYRLCLWSRTASRVLLVLAHEN-------VDSAEAIYEVARNIAWEDHI
RLMKL_MAGMM       AGVGFEGDLEIGLRACLWSRVATRIILSLKKID-------VSTPEALYASVLEIPWEDHL
RLMKL_ALTMD       GTIQFEGSKEDAYKLCLWSRLANRVIWVLASGK-------AGDAEALYNTAMGIDWQMQM
RLMKL_PSEA6       GQVLFTGEIEQAYKICLWSRLANRVMLKLADGH-------VDSADDVYQITSSVNWTSHF
RLMKL_COLP3       EGVYFQASLALGYKISLWTRLATRIMLKLGEGE-------AKDKDELFKAASSINWPDIF
RLMKL_PSEHT       GSVRFEADSLLAQKVCLSTRFATRVLMLIEEKEG------VDDKNSLYNFARSQPWQEWF
RLMKL_ALIF1       AGVKFEAPIEVVYRCCLWSRIASRFIQILSEFD-------VRDDMDLYLGASSINWPSYF
RLMKL_ALIFM       AGVKFEAPIEVVYRCCLWSRIASRFIQILSEFD-------VRDDMDLYLGASSINWPSYF
RLMKL_ALISL       AGVTFEAPIEVVYRCCLWSRIASRFIQILSEFD-------VRDDMDLYLGASAINWPNYF
RLMKL_PHOPR       AGVRFKADQSTAYRCCLWTRISSRIIQVLSEFT-------VRDDMDLYLGAAAINWTEYF
RLMKL_VIBCH       AGVKFKATNEQIYRCCLWSRLASRFVRIVAEFK-------CQNDLDLYLSTTSVNWVNYF
RLMKL_VIBC3       AGVKFKATNEQIYRCCLWSRLASRFVRIVAEFK-------CQNDLDLYLSTTSVNWVNYF
RLMKL_VIBCB       AGVKFKATNEQIYRCCLWSRLASRFVRVLSEFT-------CNDDMDLYLSTSSINWVNQF
RLMKL_VIBPA       AGVKFKATNEQIYRCCLWSRLASRFVRVLSEFT-------CNDDMDLYLSTSSINWVNQF
RLMKL_VIBVY       AGVRFKASNEQVYRCCLWSRLASRFVRVLSEFT-------CQSDMDLYLATSSINWVNQF
RLMKL_AERHH       AGVHFKGELAIGYKACLWSRFASRIVLVLSEFQ-------MNDDLDLYLGAHTIPWEEHF
RLMKL_AERS4       AGVHFKGELAIGYKACLWSRFASRIVLVLSEFQ-------MNDDLDLYLGAHTIPWEEHF
RLMKL_BUCAI       GGIYYKSNDLLLYKSLMWSRIASRIYLCIKIFT-------INNIDDLYDHVYSINWTEIF
RLMKL_BUCAP       GGIYYEGEDSILYNSLMWSRIASRIFLCIKKFT-------IKNSNDLYKNTYNINWTQIL
RLMKL_SHIFL       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SHIF8       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOLI       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOHS       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOLC       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECODH       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECO57       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECO5E       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECO24       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SHIDS       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SHIB3       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SHIBS       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SHISS       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOSM       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOL5       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOUT       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOK1       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_ECOL6       GGVHFKGDTRLVYQSLMWSRLASRIMLPLGECK-------VYSDLDLYLGVQAINWTEMF
RLMKL_SALA4       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALTY       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALDC       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALEP       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALHS       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALNS       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALPA       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALPK       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALPB       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALG2       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALCH       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALSV       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_SALTI       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYFGVQAINWTEIF
RLMKL_SALAR       GGVHFQGDTRLIYQSLMWSRLASRIILPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_CITK8       GGVHFQGDTRLVYQSLMWSRLASRIMLPMGECK-------VYSDLDLYLGVQAINWTEIF
RLMKL_KLEP3       GGVHFQGDTRLLYQSLMWSRLASRIMLPLGECR-------VYSDLDLYLGVQAIPWTEMF
RLMKL_KLEP7       GGVHFQGDTRLLYQSLMWSRLASRIMLPLGECR-------VYSDLDLYLGVQAIPWTEMF
RLMKL_ENT38       GGVHFEGDTRLIYQSLMWSRLASRIMLPLGACK-------VYSDLDLYLGVQATDWTEIF
RLMKL_CROS8       GGVHFQGDAALVYQSLMWSRLASRILLPLGECA-------VYSDLDLYLGVQAIDWTSIF
RLMKL_ERWT9       GGVHYQVSDRLMYQSLMWSRLASRILLPLTECA-------VYSDLDLYLGVQAIDWPAMF
RLMKL_YERPG       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPY       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPA       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPN       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPE       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPP       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPS       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERP3       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERPB       GGVHFQGDDRLMYQSLLWSRLASRILLPLNEFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_YERE8       GGVHFQGDDRLMYQSLLWSRLASRILLPLNDFK-------VYSDLDLYLGVQAIDWPSIF
RLMKL_SERP5       GGVHFQGDDRLLYQSLLWSRLASRILLPLNEFR-------VHSDLDLYLGVQAIDWTSIF
RLMKL_PECAS       GGVHFEGDNRLLYQSLLWSRLASRILLPLNEFK-------VHSDLDLYLGVQAIDWSTIF
RLMKL_PHOLL       GGVHFQGDGRVMYKSLMWSRLASRILLPLNEFN-------VYSDLDLYLGVQSIDWSQVF
RLMKL_PROMH       GGVYFRADDKTMYQSLLWSRLASRIMLPLNEFN-------VYSDLDLYLGVQAIDWSEVF
RLMKL_SODGM       GGVHFQADSRLLYRALLWSRLASRIVLPLNVFS-------VGSDGDLYRGVQAVDWPSLF
RLMKL_HAEIE       GGVHYQADDETLYRTLLWSRLASRILFPLIETK-------IYSDLDLYAAVSGFNWLAQF
RLMKL_HAEIG       GGVHYQADDETLYRTLLWSRLASRILFPLIETK-------IYSDLDLYAAVSGFNWLAQF
RLMKL_HAEIN       GGVHYQADDETLYRTLLWSRLASRILFPLIETK-------IYSDLDLYAAVSGFNWLAQF
RLMKL_HAEI8       GGVHYQADDETLYRTLLWSRLASRILFPLIETK-------IYSDLDLYAAVSGFNWLGLF
RLMKL_HAES1       GGVHFIANDETQYRILLWSRLSSRILLPLITTK-------IYSDLDLYSAIVGQNWLTHF
RLMKL_HISS2       GGVHFIANDETQYRILLWSRLSSRILLPLITTK-------IYSDLDLYSAIVGQNWLTHF
RLMKL_ACTSZ       GGVHFGADDETQYKTLLWSRLASRILLPIAQSK-------IYSDLDLYSTVVSQAWLEHF
RLMKL_MANSM       GGVHFMADDETQYRALLWSRLSSRILLPIVKTK-------IYSDLDLYSAVVRQNWLAYF
RLMKL_PASMU       GGVHFHADEETQYRVLLWTRLASRILLPIVTCK-------VYSDLDLYSAVVGQNWLDYF
RLMKL_ACTPJ       GGVHFTTTQRGAYQALLHSRLASRILLPLVTTK-------IFSDLDLYATIVGINWAEIF
RLMKL_ACTP2       GGVHFTTTQRGAYQALLHSRLASRILLPLVTTK-------IFSDLDLYATIVGINWAYIF
RLMKL_ACTP7       GGVHFTTTQRGAYQALLHSRLASRILLPLVTTK-------IFSDLDLYATIVGINWAEIF
RLMKL_HAEDU       GGVHFTTNQKGAYQALLHSRLASRILLPLVSTK-------IFSDLDLYATIIAINWADIF
RLMKL_PSYIN       GGVKFEGTLEQGYKVCLWSRFASRVLLKLSEFK-------VLDSMDLYLGCSNIPWETHF
RLMKL_SHEB5       AGVYFTASLTLAYRITLWTRLASRIVLVIYKGS-------CESAEQLYNAAYCVDWPAHF
RLMKL_SHEB9       AGVYFTASLALAYRITLWTRLASRIVLVIYKGS-------CESAEQLYNAAYCVDWPAHF
RLMKL_SHEB8       AGVYFTASLALAYRITLWTRLASRIVLVIYKGS-------CESAEQLYNAAYCVDWPAHF
RLMKL_SHEPC       AGVYFTAPLALAYRITLWTRLASRIVLVIYKGS-------CESAEQLYNAAYCIDWPAHF
RLMKL_SHESW       AGVYFTAPLTLAYRITLWTRLASRIVLVIYKGS-------CESAEQLYNAAYCIDWPAHF
RLMKL_SHESM       AGVYFTAPLALAYRITLWTRLASRIVLVIYKGP-------CESAEQLYNAAYCIDWSSHF
RLMKL_SHESR       AGVYFTAPLALAYRITLWTRLASRIVLVIYKGP-------CESAEQLYNAAYCIDWSAHF
RLMKL_SHESA       AGVYFTAPLALAYRITLWTRLASRIVLVIYKGP-------CESAEQLYNAAYCIDWSAHF
RLMKL_SHEON       AGVYFTAPLTLAYRITLWTRLASRIVLVIYKGP-------CESAEQLYNAAYCIDWSAHF
RLMKL_SHEDO       AGVYFSSSLELAYRITLWTRLASRIVVVIYKGP-------CESPEQLYNAAYCIDWPSHF
RLMKL_SHEFN       AGVYFSASLELAYRITLWTRLASRIVLVIYKGA-------CDSAEQLYNAAYCIDWPSHF
RLMKL_SHEHH       AGVYFSAPLELGYRITLWSRLASRIIFVIYKGP-------CESPEQLYNAAYGIDWQMQF
RLMKL_SHEPA       AGVYFSAPLELGYRITLWSRLASRIIFVIYKGP-------CESPEQLYNAAYGIDWQMQF
RLMKL_SHESH       AGVYFSASLELGYRITLWSRIASRIILVIHKGP-------CESPEQLYNAAYGIDWQMEF
RLMKL_SHEWM       AGVYFSASLELGYRITLWSRIASRIIFVIHKGP-------CESPEQLYNAAYGIDWQMEF
RLMKL_SHELP       AGVYFSAPLNLAYRITLWSRLASRIILVIYKGP-------CENPEQLYNAAYCIDWQTHF
RLMKL_SHEAM       AGVYFSASLAQGYQITLWTRLASRIVLILFTGE-------CQSAEQLYNAAYTIDWPSHF
RLMKL_IDILO       AGCYIEADLQQAYTVAMWSRLASRMLLQLGEKE-------VSSLDEIKLALTQFSWSKVF
RLMKL_FRATF       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATH       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATO       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATW       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATT       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRAT1       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATM       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRATN       AGVEFEGSIKDAYKVCIYSYLASQVMLKVAT-------DKVINQQDLYEFISSINWMDYF
RLMKL_FRAP2       AGVEFEGSFEDAYKVCIYSHLASQVMLKIAT-------QKVTDQQALYDFISSINWLDYF
D0KZE4_HALNC      FGVLLDATPEQAYRIVCDSLIAGHVYLTLIT-------GQAATADELYRLVQQIDWAEHL
RLMKL_ACIBY       GRLIIEGTLEHAYRICMWSRLASRVLLPIHTYELERTHDARDVAEELYEGAISFDWSLIF
RLMKL_ACIBS       GRLIIEGTLEHAYRICMWSRLASRVLLPIHTYELERTHDARDVAEELYEGAISFDWSLIF
RLMKL_ACIBC       GRLIIEGTLEHAYRICMWSRLASRVLLPIHTYELERTHDARDVAEELYEGAISFDWSLIF
RLMKL_ACIAD       GRLIFQGSLEQAYRVCMWSRLASRVLKPIHTFELERTHDARDVAEELYEGALSFDWSLIF
RLMKL_PSYA2       GRLAVTGTLRDLYKICLWSRVASRVLMLIKR---KNINAEYDVAEQLYGLAKSVNWTEQF
RLMKL_PSYCK       GRLAVTGTLRDLYKICLWSRVASRVLMLIKR---KNINAEYDVAEQLYGLAKSVNWTEQF
RLMKL_PSYWF       GRIAVNATLEQIYKICLWSRVASRVLLPIKK---RNINKEYDVAEQLNGLARTVDWTEWF
RLMKL_DESPS       GTVQWQGSLETGYRACLWSRFSSRILLKLSQF-------EVNSEDDLYQNSFTYDWHQHM
G8QSR6_SPHPG      GGVEFATDLAGAYRFCLWSRTSTRLLLGLFED------EDIRSADELYEASVLIPWENWI
F0RUX4_SPHGB      GGVEFSADLASAYRFCLWSRTATRVLLGLFED------EDILDADELYEASKQIPWEDWV
RLMKL_ALCBS       AHVSFSGGVADALKVCLWSRLSERVLLHLAT----------------LGVTPDIAPEKLA
C8WGP0_EGGLE      GGVAFFCDVRHALSACLWSRLASRILVVVGRVN-------AGDANLLYEGVRRIAWEGVI
F7V0X9_EEGSY      GGVAFYGDVRQALSACLWSRLASRILVVVGRVD-------ARDAQSLYQGVRALRWEDVI
E1QZ79_OLSUV      GQVSFGEGLGDAYKACLWSRLASRVILVLGHVD-------ATSSDALYEGLSRIAWEDHL
C8W7K3_ATOPD      GQVAFYGLLADAYRVCLWSRLASRVILVLDRIE-------AATSDTLYEELSHLAWEDHI
F2N9W7_CORGP      GRVTFEGEVSDAYRACLWSRLASRVLVVLARFD-------AADDRQLYRGAYDICWERVL
C7N0P8_SLAHD      GGVAFFGAYEDGLRACLHSRVATRVQLVLGRVS-------ARNADALYDGVRALPWETLV
                                    :  : :.   :                               

RLMKL_STRMK       KPEMTLAVDAHVSGDKIT-HARFAAQRIKDAIVDRMRDEG-LERPSVNTDLPDVRV-NLS
RLMKL_STRM5       KPEMTLAVDAHVSGDKIT-HARFAAQRIKDAIVDRMRDEG-LERPSVNTDLPDVRV-NLS
RLMKL_XANAC       SVGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTMRRQG-LERPSVDVENPDLRL-NLS
RLMKL_XANC5       SVGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTMRRQG-LERPSVDVENPDLRL-NLS
RLMKL_XANOM       SVGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTMRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XANOP       SVGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTMRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XANOR       SVGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTMRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XANCP       STGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTIRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XANC8       STGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTIRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XANCB       STGHTLSVDAHVSGTAIT-HARYAAQRIKDAVVDTIRRQG-LERPSVDVESPDLRL-NLS
RLMKL_XYLF2       LPGQTLAVDAHVSGEAIT-HARYAAQRVKDAVVDTLRDAG-VVRPSVDVEHPDVRL-NLS
RLMKL_XYLFT       LPGQTLAVDAHVSGEAIT-HARYAAQRVKDAVVDTLRDAG-VVRPSVDVEHPDVRL-NLS
RLMKL_XYLFM       LPGQTLAVDAHVSGEAIT-HARYAAQRVKDAVVDTLRDAG-VVRPSVDVEHPDVRL-NLS
RLMKL_XYLFA       LPGQTLAVDAHVSGEAIT-HARYAAQRVKDAVVDTLRDAG-VVRPSVDVEHPDVRL-NLS
RLMKL_ALKEH       LPGDTLAVDFHGSNAAIR-HTRFGAQRVKDGVVDRMRAVG-HPRPSVDTAAPDLRI-NAV
RLMKL_CHRSD       RAGSSLAVDFHGQSEHIR-HTRFGAQSVKDGIVDAMRAAG-RERPAVDLKTPDARI-YAH
RLMKL_MARHV       PAGGSFRVTFLGQNEAIR-NTQFGAQKVKDGIVDSIRGAG-APRPSVAPKDPDVTV-SAR
RLMKL_PSEAE       DAGGTLAVEFSGKGSGID-NTHFGALKVKDAIVDNLRERS-GRRPSVDKVNPDVRV-HLH
RLMKL_PSEA7       DAGGTLAVEFSGKGSGID-NTHFGALKVKDAIVDNLRERS-GRRPSVDKVNPDVRV-HLH
RLMKL_PSEP1       AADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRNRE-GLRPSVEKIDPDVRV-HLR
RLMKL_PSEPK       AADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRNRE-GLRPSVEKIDPDVRV-HLR
RLMKL_PSEPG       AADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRNRE-GLRPSVEKIDPDVRV-HLR
RLMKL_PSEPW       AADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRNRE-GLRPSVEKVDPDVRV-HLR
RLMKL_PSEE4       EADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRSRE-GLRPSVDKLDPDLRV-HLR
RLMKL_PSEF5       LADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRTPT-GERPSVDKLNPDLRI-HLR
RLMKL_PSEPF       LADGTLAVEFSGHGSGID-NTHFGALKVKDAIVDKLRTPQ-GDRPSIDKLNPDLRI-HLR
RLMKL_PSE14       ESDGTIAVEFSGHGSGID-NTHFGALKVKDAIVDKLRTPD-GERPSVDKINPDLRV-HLR
RLMKL_PSEU2       ESDGTIAVEFSGHGSGID-NTHFGALKVKDAIVDKLRTPD-GERPSVDKINPDLRV-HLR
RLMKL_PSESM       EPEGTIAVEFSGHGSGID-NTHFGALKVKDAIVDKLRTPE-GERPSVDKINPDLRV-HLR
RLMKL_PSEMY       EPAGSLAVEFSGHGSGID-NSHFGALKVKDAIVDRLRTAG-GERPSIDKINPDLRV-HLR
RLMKL_PSEU5       LPSGSLAVEFSGRGSGID-NTHFGALKVKDAIVDRLRSAS-GERPSIDKLDPDLRV-HLR
RLMKL_METCA       GPGATLAVDFSSRRSAIT-HTLFGAQKVKDAIADQFLEHC-GRRPSVRLERPDIRI-NVH
RLMKL_PELCD       TAAGTLAVDAQLRRSKIN-HSRFAALRVKDAVVDRFRERF-DQRPSIDLERPDIRL-NLH
RLMKL_ALLVD       TPDRTFAIQFDGQLQGVT-NPHFAILQVKDAIADRFNRLY-GRRPSVDPDDPDLRI-HLY
RLMKL_HYDCU       DKEGTFAVSFSGQGLGIT-HSHYGALKIKDGIVDYFREHY-QVRPSIDTEVPDIRV-HGH
RLMKL_CELJU       SPSGSLLVDFVGTNDAIR-NTQFGALKVKDAIVDCLRDFS-GVRPNIAKRDPDLLV-NAR
RLMKL_SACD2       KPGASLKVDFIGTNDAVR-NTQFGAQRVKDAVVDSIRHAG-GERPNVEKMQPDVRI-HAR
RLMKL_MARMS       NASNTIAIDCHGTNHHIR-NTQFGAVRAKDAIADYFVALS-GERPSVEKEQPEVRI-ALR
RLMKL_LEGPC       THDKTIAIEFHGASEQIR-NTMFGAQIVKDGIVDHFRRLN-GSRPSVDKEKPQILI-HAH
RLMKL_LEGPA       THDKTIAIEFHGASEQIR-NTMFGAQIVKDGIVDHFRRLN-GSRPSVDKEKPQILI-HAH
RLMKL_LEGPH       THDKTIAIEFHGASEQIR-NTMFGAQIVKDGIVDHFRRLN-GSRPSVDKEKPQILI-HAH
RLMKL_LEGPL       THDKTIAIEFHGASEQIR-NTMFGAQIVKDGIVDHFRRLN-GSRPSVDKEKPQILI-HAH
RLMKL_HAHCH       RPGESYWIAAFGSSGDIR-HSRFGAQVVKDAINDHFRDRD-LELPVIDKRSGVQTV-QLN
RLMKL_DICNV       APDDTFAVRFNGLGCGIR-NTQFGALKIKDAVVDRLRDIV-KRRPDVDAKTPDILL-DAH
RLMKL_MAGMM       DAEGTLSVDCIGTNDTIR-HTNFGGQKLKDAVVDRIRDKK-GSRPSVARERPDLRI-NLG
RLMKL_ALTMD       DSRHTLSVQFIGTNFAIK-NTQFGAVRVKDAIVDSFVEQG-LPRPSVERKTPDISV-YAR
RLMKL_PSEA6       SVNSTFVVDFVGASHCIN-NSQFGALKIKDAVVDQFNELF-ESRPSVSKIEPDIRI-QGR
RLMKL_COLP3       KSTTTFAVDFVGYSEEIR-NSQFGGLTIKDAIVDQFRDQG-FERPNVDKKAPQISF-QAR
RLMKL_PSEHT       GPTQTFAVDFNGTNDSLK-NTQFSGLVIKDAIVDYFNDLF-EQRPNVDKQDANVRV-VAR
RLMKL_ALIF1       SADKTLVVDFNGTNREIR-NSQYGALKVKDAIVDRFTKAD-LARPNISKVEPDLRV-HMR
RLMKL_ALIFM       SADKTLVVDFNGTNREIR-NSQYGALKVKDAIVDRFTKAD-LPRPNISKVEPDLRV-HMR
RLMKL_ALISL       TADKTLVVDFNGTNREIR-NSQYGALKVKDAIVDRFTKAD-LERPNIDKAEPDLRV-HMR
RLMKL_PHOPR       SNATRIVVDFNGTNREIR-NSQYGAMKVKDAIVDRFTKAD-LRRPNIDREQPDLRI-HMR
RLMKL_VIBCH       HSSKKLVVDFNGTNREIR-NSQYGAMKVKDAIVDCFTKKN-LPRPSISKDLADLHI-HVR
RLMKL_VIBC3       HSSKKLVVDFNGTNREIR-NSQYGAMKVKDAIVDCFTKKN-LPRPSISKDLADLHI-HVR
RLMKL_VIBCB       HSSKRFVVDFNGTNREIR-NSQYGAMKVKDGIVDCFEKKG-LPRPNISKERPDIRV-HVR
RLMKL_VIBPA       HSSKRFVVDFNGTNREIR-NSQYGAMKVKDGIVDCFEKKG-LPRPNISKERPDIRV-HVR
RLMKL_VIBVY       HSTKKFVVDFNGTNREIR-NSQYGAMKVKDGIVDCFEKKN-LPRPNISKERPDVRI-HVR
RLMKL_AERHH       SGTSTIAVDFTGTNPAIR-NTQYGALKIKDAIVDRFTKRG-HVRPDVDKKSPDIRI-MAH
RLMKL_AERS4       SGTSTIAVDFTGTNPAIR-NTQYGALKIKDAIVDRFTKRG-HVRPDVDKKAPDIRI-MAH
RLMKL_BUCAI       HIHNTFLVNFKGTNNFIR-NSLFGALVTKDAIIDQFQNKY-ASRPNVNLIEPDIRIKLVL
RLMKL_BUCAP       YLEKTFLVKFRGTNNIIR-NSLFGALKIKDAIVDTFYQKY-SARPNINLLTPDVRI-ISY
RLMKL_SHIFL       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SHIF8       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOLI       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOHS       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOLC       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECODH       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECO57       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECO5E       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECO24       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SHIDS       TPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SHIB3       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SHIBS       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SHISS       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOSM       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOL5       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOUT       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOK1       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_ECOL6       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRDAPDIRV-NVW
RLMKL_SALA4       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALTY       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALDC       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALEP       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALHS       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALNS       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALPA       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALPK       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALPB       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALG2       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALCH       NLGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALSV       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALTI       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_SALAR       NPGATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_CITK8       NPDATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPNVDRESPDIRV-NVW
RLMKL_KLEP3       NPGATFAVHFSGLNDEIR-NSQYGALKVKDAIVDSFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_KLEP7       NPGATFAVHFSGLNDEIR-NSQYGALKVKDAIVDSFTRKN-LPRPNVDRESPDLRI-NVW
RLMKL_ENT38       APGATFAVHFSGLNDEIR-NSQYGALKVKDAIVDSFTRKN-LERPNVDRENPDLRI-NVW
RLMKL_CROS8       APDATFAVHFSGLNDTIR-NSQYGAMKVKDAIVDAFTRKN-LPRPSVDRELPDLRI-NVW
RLMKL_ERWT9       SSDKTFAVHFSGLNEVIR-NSQYGALKVKDAIVDSFTRKN-LPRPNVDREQPDIRV-NVW
RLMKL_YERPG       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPY       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPA       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPN       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPE       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPP       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPS       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERP3       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERPB       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKM-DQRPTVAKQQPDIRV-NVF
RLMKL_YERE8       GVDKTFAVHFSGVNDEIR-NSQYGALKVKDAIVDSFTRKL-DQRPTVAKQQPDIRV-NVF
RLMKL_SERP5       GVDKTFAVHFSGVNEEIR-NSQYGALKVKDAIVDSFTRKI-EQRPTVAKQQPDIRV-NVF
RLMKL_PECAS       SIDKTFAVHFTGTNEDIR-NSQYGALKVKDAIVDSFTRKT-GQRPDVAKQQPDIRV-NVF
RLMKL_PHOLL       SVHSTFSVHFSGTNEEIR-NTQYGALKVKDAIVDSFTRKL-DQRPNVAKQQPDVRI-NVF
RLMKL_PROMH       TVNHTFAIHFNGTNDVIR-NSQYGALKAKDAIVDSFQRKI-GQRPDVAKQSPDIRL-TIH
RLMKL_SODGM       TVDKRFAVYFSGTNAAIR-NSQYGALKVKDAIVDSFTRHG-ARRPDVDRQQPDIRI-QAY
RLMKL_HAEIE       DERVTFFVDFNGTNQEIR-HTQFGAMRVKDGIVDYFERQG-KTRPDVDKIQPDVRI-HAY
RLMKL_HAEIG       DERVTFFVDFNGTNQEIR-HTQFGAMRVKDGIVDYFERQG-KARPDVDKIQPDVRI-HAY
RLMKL_HAEIN       DERVTFFVDFNGTNQEIR-HTQFGAMRVKDGIVDYFERQG-KTRPDVDKIQPDVRI-HAY
RLMKL_HAEI8       DERVTFFVDFNGTNQEIR-HTQFGAMRVKDGIVDYFERQG-KARPDVDKIQPDVRI-HAY
RLMKL_HAES1       DERVTFLVDFNGTNREIR-HTQFGAMRVKDGIVDYFERHG-KTRPNVDKEYPDIRI-HAY
RLMKL_HISS2       DERVTFLVDFNGTNREIR-HTQFGAMRVKDGIVDYFERHG-KTRPNVDKEYPDIRI-HAY
RLMKL_ACTSZ       DERTHFFVDFNGTNREIR-HSQFGAMRVKDGIVDYFERHG-KARPNVDKENPDVRI-HAY
RLMKL_MANSM       DERVRFLVDFNGTNREIR-HTQFGAMRVKDGIVDYFERNG-KARPNVDKDYPDIRI-HAY
RLMKL_PASMU       DEKAHFMVDFNGTNREIR-HTQFGAMRVKDGIVDYFERVG-KPRPNVDKSQPDIRI-HAY
RLMKL_ACTPJ       DPRDTFFVDFNGTNREIR-NTQFGAMRVKDGVVDYFERKG-FARPTVDKDHADIRI-HVY
RLMKL_ACTP2       DPRDTFFVDFNGTNREIR-NTQFGAMRVKDGVVDYFERKG-FTRPTVDKDHADIRI-HVY
RLMKL_ACTP7       DPRDTFFVDFNGTNREIR-NTQFGAMRVKDGVVDYFERKG-FARPTVDKDHADIRI-HVY
RLMKL_HAEDU       DPRDTFYVDFNGTNREIR-NTQFGAMRVKDGIVDYFERKR-FARPIVDKDRPDIRI-HVY
RLMKL_PSYIN       DVDKTFSIDFSGTNDEIR-NTQFGALKIKDAIVDRFRKHF-DERPNVQKRDADIRF-NGR
RLMKL_SHEB5       SNKSTFSIDFHGTGGFLN-NTQFGALKIKDAIVDRFRDDD-IERPNVSRVDAEFKV-DAH
RLMKL_SHEB9       SNKSTFSIDFHGTGGFLN-NTQFGALKIKDAIVDRFRDDD-IERPNVSRVDAEFKV-DAH
RLMKL_SHEB8       SNKSTFSIDFHGTGGFLN-NTQFGALKIKDAIVDRFRDDD-IERPNVSRVDAEFKV-DAH
RLMKL_SHEPC       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DERPNVSRTDADFKV-DAH
RLMKL_SHESW       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DERPNVSRTDADFKV-DAH
RLMKL_SHESM       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DARPNVARIDADIKI-DAH
RLMKL_SHESR       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DARPNVARIDADIKI-DAH
RLMKL_SHESA       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DARPNVARIDADIKI-DAH
RLMKL_SHEON       SNRNTFSIDFHGTGGFIN-NTQFGALKIKDAIVDRFRDDG-DARPNVARIDADIKV-DAH
RLMKL_SHEDO       SNKKTFSIDFHGTGGFIN-NTQFGALKIKDAVVDRFRDDG-DARPNVERVDAEFRV-DAH
RLMKL_SHEFN       SHKKTFSIDFHGTGGFIN-NTQFGALKIKDAVVDRFRDDG-TPRPDVERVNPDFKI-DAH
RLMKL_SHEHH       SNRSTFSIDFHGLGGFIK-NTQFGALKIKDAIVDRFRDDD-FSRPNVERVDADFRI-DAH
RLMKL_SHEPA       SNRSTFSIDFHGLGGFIK-NTQFGALKIKDAIVDRFRDDD-FSRPNVERVDADFRI-DAH
RLMKL_SHESH       NHRSTFSIDFHGMGGFIN-NTMFGALKIKDAIVDRFRDDD-CPRPDVARVDADFRI-DAH
RLMKL_SHEWM       NHRSTFSIDFHGMGGFIN-NTMFGALKIKDAIVDRFRDDD-CPRPDVARVDADFRI-DAH
RLMKL_SHELP       SNKSSFSIDFHGVGGFIK-NSQFGALKIKDAVVDRFRDDG-CPRPDVARVDADFKI-DAH
RLMKL_SHEAM       SNRSTFSIDFHGTGGFIN-NSQFGALKIKDAVVDRFRDDD-LSRPDVVKGHPDMRI-DAH
RLMKL_IDILO       DANRTFVVDFSGGNDDIR-HTQFGAQLVKDCIVDNFRNSG-FERPSIDKQDPDIRI-AVR
RLMKL_FRATF       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVI-NQRPNIDTENPDNVIKLHL
RLMKL_FRATH       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVI-NQRPNIDTENPDNVIKLHL
RLMKL_FRATO       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVI-NQRPNIDTENPDNVIKLHL
RLMKL_FRATW       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVT-NQRPNIDTENPDNVIKLHL
RLMKL_FRATT       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVT-NQRPNIDTENPDNVIKLHL
RLMKL_FRAT1       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVT-NQRPNIDTENPDNVIKLHL
RLMKL_FRATM       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVT-NQRPNIDTENPDNVIKLHL
RLMKL_FRATN       AVDKTFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRNVT-NQRPNIDTENPDNVIKLHL
RLMKL_FRAP2       DVNTAFKIIISGKHYDFN-NTMFVSQKTKDAIVDQFRRET-NERPNIDTDNPDNIIKLHL
D0KZE4_HALNC      AAEGYFTISATGSTDALR-HTGFVATRIKDAIVDQFRERT-GTRPTIDSEQPDIRLHCHL
RLMKL_ACIBY       APQSTFAIRLHAEREIKV-NTQFATLRVKDGVVDSFMEAV-GRRPSIDTKQPEITLYVLA
RLMKL_ACIBS       APQSTFAIRLHAEREIKV-NTQFATLRVKDGVVDSFMEAV-GRRPSIDTKQPEITLYVLA
RLMKL_ACIBC       APQSTFAIRLHAEREIKV-NTQFATLRVKDGVVDSFMEAV-GRRPSIDTKQPEITLYVLA
RLMKL_ACIAD       APQSTFAIRLHVEREIKV-NSQFATLRVKDGVVDSFMEAV-GRRPSIDTKQPEITLFVLA
RLMKL_PSYA2       SLEQTFAIRLSVDKRVAV-SQQFAMLRIKDAIADTFNEVY-ESRPNVDSKNPDFSIFATV
RLMKL_PSYCK       SLEQTFAIRLSVDKRVAV-SQQFAMLRIKDAIADTFNEVY-ESRPNVDSKNPDFSVFATV
RLMKL_PSYWF       ELDNTFAIRMSVDKRVQV-SQQFAMLRIKDAIADTFSEKL-DARPDVDSNNPDFPIYATV
RLMKL_DESPS       SWKTTFAIDCTLSADATVGHSQFAALRIKDGIVDRFKEDG-DERPSVKTTQPDVRFHIHV
G8QSR6_SPHPG      TPEQTFAVSETVKNCSYLRNSHFGAIRLKDAIVDRIREKFDDQRPQVDKENCDVMFHLHV
F0RUX4_SPHGB      NPDITFSVTETVKNCPYMKNSHFAAIRLKDAIVDRIREKFEGERPLVDTENSDVVFHLHI
RLMKL_ALCBS       ASQDWLSLVGNNAPVHLHIEHGAEVRGDNRISAKRFIHALPEQFAISREPKGSCCIRARL
C8WGP0_EGGLE      VPGASMSVQAHGMNDELR-NTRFTALKVKDAVCDRLREMR-GERPDVDADHADVSV-DVR
F7V0X9_EEGSY      VAGASIALRAHGMNNELR-NTKFTALKVKDAVCDQLLETR-GVRPDVDTATPDALI-DVR
E1QZ79_OLSUV      PPSATMAIDAHGTNAALR-NSQFVALRSKDAVVDRLMSRR-GGRPVVDTSRPDVTI-AVR
C8W7K3_ATOPD      GPRATIAVNAHGTNDQLR-NTNFIAVRTKDAIVDRLAAKR-GSRPMVNTLAPDVTI-VVR
F2N9W7_CORGP      APRATISVSARGFNERLR-DTRFSALRVKDALCDRMVDAT-GARPSVDTSSPDARI-VLT
C7N0P8_SLAHD      APGATIAMRATGQNSNLR-NTQFTALKVKDAVCDRLAAER-GARPDVDGSDPDFSV-DIL
                         :                    :    . :        .          .    

RLMKL_STRMK       LRKGRASLSIDLGGGPLHRRGWRGA----AHEAPLKENLAAALLLRAQWPRLHAAGG---
RLMKL_STRM5       LRKGRASLSIDLGGGSLHRRGWRGA----AHEAPLKENLAAALLLRAQWPRLHAAGG---
RLMKL_XANAC       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLMRGGWPRAYADGG---
RLMKL_XANC5       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLMRGGWPRAYADGG---
RLMKL_XANOM       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLMRGGWPRAYADGG---
RLMKL_XANOP       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLMRGGWPRAYADGG---
RLMKL_XANOR       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLMRGGWPRAYADGG---
RLMKL_XANCP       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLLRAGWPRAYADGG---
RLMKL_XANC8       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLLRAGWPRAYADGG---
RLMKL_XANCB       LRKGRATISVDLGGGPLHRRGWRMA----QNEAPLKENLAAAVLLRAGWPRAYADGG---
RLMKL_XYLF2       LRKGRATLSVDLGGRALHHRGWRQA----PHAASLKEHLAAAVLLRAGWAKVYAEGG---
RLMKL_XYLFT       LRKGRATLSVDLGGRALHHRGWRQA----PHAASLKEHLAAAVLLRAGWAKVYAEGG---
RLMKL_XYLFM       LRKGRATLSVDLGGRALHHRGWRQA----PHAASLKEHLAAAVLLRAGWAKVYAEGG---
RLMKL_XYLFA       LRKGRATLSVDLGGRALHHRGWRQA----PHAASLKEHLAAAVLLRAGWAKVYAEGG---
RLMKL_ALKEH       LAGGRLRLGIDLSGESLHRRGYRQG----GGRAPLKENLAAGLLWLAGWPRIAEDGG---
RLMKL_CHRSD       LHRGRLLLGLDLVGGSLHQRGYRRD----AGHAPLKENLAAALLMRADWPARARRGE---
RLMKL_MARHV       LNRGRLSLGIDLSGHSLHMRGYRTE----KGIAPLKENLAAALLLRAGWPEIAANGG---
RLMKL_PSEAE       LDRGQATLSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPKIAAEGG---
RLMKL_PSEA7       LDRGQATLSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPKIAAEGG---
RLMKL_PSEP1       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPRIAAEGG---
RLMKL_PSEPK       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPRIAAEGG---
RLMKL_PSEPG       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRSGWPRIAAEGG---
RLMKL_PSEPW       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPRIAAEGG---
RLMKL_PSEE4       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPRIAAEGG---
RLMKL_PSEF5       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRSGWPRIAAEGG---
RLMKL_PSEPF       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRSGWPRIAAEGG---
RLMKL_PSE14       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRAGWPRIAAEGG---
RLMKL_PSEU2       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRAGWPRIAAEGG---
RLMKL_PSESM       LDRGEAILSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRAGWPRIAAEGG---
RLMKL_PSEMY       LDRGEAVLSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAVLIRAGWPRIAAEGG---
RLMKL_PSEU5       LDKGQAVLSLDLSGHSLHQRGYRLQ----QGAAPLKENLAAAILIRAGWPRIAAAGG---
RLMKL_METCA       LDADQAVIGLDLSGDSLHRRGYRTE----AGPAPLKENLAAAVLIRAGWPDIAARGG---
RLMKL_PELCD       IDRDQATLSLDLSGDSLHRRGYRAE----GVLAPLKENLAAAILLRAGWPDVGARGG---
RLMKL_ALLVD       GNRDSLSFSLDLSGESLHQRGYRDA----GSAAPLKENLAAALLLRAGWPEIAAEGG---
RLMKL_HYDCU       LNRNQLTLSLDLSGYSLHQRGYREGI---QVEAPLKENVAAAILMRANWPEIAQQGG---
RLMKL_CELJU       LSKNKLVLSIDLSGESLHRRGYRLK----QGSAPLKENLAAGILIRAGWPEVAAQGG---
RLMKL_SACD2       LHRDELHISIDLSGDSLHRRGYRQK----QGGAPLKENLAAALLLRAGWPTIAEQGG---
RLMKL_MARMS       IKREVVTVSIDLSGESMHRRGYRQQ----GGMAPLKENLAAGLLLRAGWGTDCGLT----
RLMKL_LEGPC       LKNDILTVSFDLVGYSLHQRGYRKK----AGKAPLKENVAAAMLLRAKWPELAAQGY---
RLMKL_LEGPA       LKNDILTVSFDLVGYSLHQRGYRKK----AGKAPLKENVAAAMLLRAKWPELAAQGY---
RLMKL_LEGPH       LKNDILTVSFDLVGYSLHQRGYRKK----AGKAPLKENVAAAMLLRAKWPELAAQGY---
RLMKL_LEGPL       LKNDILTVSFDLVGYSLHQRGYRKK----AGKAPLKENVAAAMLLRAKWPELAAQGY---
RLMKL_HAHCH       LAKTI-TLGLDLAGRSLHQRGYRQE----GAAAPLKENLAAAILYRAGWPEICGEDG---
RLMKL_DICNV       LHKNELTLALDLSGGSLHERGYRQA----HGAAPMKETLAATLLYRARWHEFCAQPA---
RLMKL_MAGMM       IRGNEGRVGIDLSGEGLHRRGYRLR----TGDAPLKENLAAALLYFAGWEEQARLGA---
RLMKL_ALTMD       LHRDNVILGIDLAGASLHQRAYRQE----TGDAPLKEHIASAMLMRSGWTENTDAP----
RLMKL_PSEA6       MWSDKLTVYLDLSGSSLHQRHYRTK----TGLAPVKEHIACAMLVRSGWANDQQAP----
RLMKL_COLP3       LLRDNVTIFLDFSGRGLFQRGYREH----SGAAPLKENLAAALIIRSGWLNDTSKP----
RLMKL_PSEHT       LNRYGVSMYIDYSGPRLSERGYRQG----QGKAPIKEHLAAALIKRSGWLENVNQP----
RLMKL_ALIF1       LSGEKGILGFDLVGSGLHQRGYRTE----AGRAPLRETLAAALVMRSTWDESKP------
RLMKL_ALIFM       LSGEKGILGFDLVGSGLHQRGYRTE----AGRAPLRETLAAALVMRSTWDESKP------
RLMKL_ALISL       LSGEKGILGFDLIGSGLHQRGYRTE----AGRAPLRETLAAALVLRSTWDESKP------
RLMKL_PHOPR       LSGEKGVLGLDMAGSGLHQRGYRTE----AGRAPLRETHAAALVLKSGWTPGQP------
RLMKL_VIBCH       LHKENALLGIDMVGSGLHARGYRTE----AGKAPLRETLAAAIILRSGWDASKP------
RLMKL_VIBC3       LHKENALLGIDMVGSGLHARGYRTE----AGKAPLRETLAAAIILRSGWDASKP------
RLMKL_VIBCB       LHKDKAILGVDMVGSGLHQRGYRPE----SGRAPLRETLAAAIVMRCGWDGSQP------
RLMKL_VIBPA       LHKDKAILGVDMVGSGLHQRGYRPE----SGRAPLRETLAAAIIMRCGWDGHQP------
RLMKL_VIBVY       LHKDKAILGVDMVGNGLHQRGYRPA----SGKAPLRETLAAAIILRSGWTEEQP------
RLMKL_AERHH       LGKGKANITLDLSGPALHQRFYRQG----TGEAPLKENLAAAMIARSGW-AGEP------
RLMKL_AERS4       LGKGKANITLDLSGPALHQRFYRQG----TGEAPLKENLACAMIARSGW-AGEP------
RLMKL_BUCAI       LNNNILHIMLDLSGEPLNKRGYRQF----YNTTPIKENLATAIVLSSGWNENTP------
RLMKL_BUCAP       LCQNLVHIMLDLSGEALNKRGYRKF----FNISPIKENLSAAIILSSGWKKNTP------
RLMKL_SHIFL       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQSGTP------
RLMKL_SHIF8       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQSGTP------
RLMKL_ECOLI       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOHS       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOLC       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECODH       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECO57       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECO5E       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECO24       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SHIDS       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SHIB3       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SHIBS       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SHISS       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRTGWQPGTP------
RLMKL_ECOSM       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOL5       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOUT       LHKETASIALDLSGDGLHLRGYRDR----AGMAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOK1       LHKETASIALDLSGDGLHLRGYRDR----AGMAPIKETLAAAIVMRSGWQPGTP------
RLMKL_ECOL6       LHKETASIALDLSGDGLHLRGYRDR----AGIAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALA4       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALTY       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALDC       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALEP       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALHS       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALNS       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALPA       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALPK       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALPB       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALG2       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALCH       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALSV       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALTI       LNKETASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_SALAR       LNKETASIALDLSGDGLHLRGYRDR----AGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_CITK8       LNKDTASIALDLSGDGLHLRGYRDR----TGLAPIKETLAAAIVMRSGWQPGTP------
RLMKL_KLEP3       LNKETAHISLDLSGEGLHLRGYRDG----TGMAPIKENLAAAIVMRSGWVPGTP------
RLMKL_KLEP7       LNKETAHISLDLSGEGLHLRGYRDG----TGMAPIKENLAAAIVMRSGWVPGTP------
RLMKL_ENT38       LNKETAHISLDLCGEGLHQRGYRDR----AGIAPIKENLAAAIVMRSGWQPGTP------
RLMKL_CROS8       LNKDTASIAIDLSGEGLHQRGYRDR----TGQAPIKENLAAAIVMRSGWQPGTP------
RLMKL_ERWT9       LNKDTASIALDLSGEGLHQRGYRQQ----TGQAPLKENLAAAIVLRSGWQSGTP------
RLMKL_YERPG       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPY       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPA       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPN       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPE       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPP       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPS       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERP3       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERPB       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQPGTP------
RLMKL_YERE8       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKENLAAAIIQRSGWQLGTP------
RLMKL_SERP5       LQRDMASVALDLSGEGLHQRGYRDL----TGQAPLKESLAAAIVQRSGWQPGTP------
RLMKL_PECAS       LQRDTASVALDLSGEGLHQRGYRDL----AGLAPLKENLAAAIVSRSGWQNGTP------
RLMKL_PHOLL       LNKEKASVALDLSGDGLHIRGYRDL----AGQAPLKENLAAAIVQRSGWQIGTP------
RLMKL_PROMH       LHKEKASLSLDLSGDGLHQRGYRDL----TGQAPLKENLAAAIIMRSGWKTDTP------
RLMKL_SODGM       LHRDQVMLSLDLSGSSLHQRGYRGA----AGQAPLKENLAVAIVLRSGWKPGTP------
RLMKL_HAEIE       LNRENLVISLDLSGEALHLRGYRED----AGQAPLRETLAAAIVMRSGWQVGSP------
RLMKL_HAEIG       LNRENLVISLDLSGEALHLRGYRED----AGQAPLRETLAAAIVMRSGWQAGSP------
RLMKL_HAEIN       LNRENLVISLDLSGEALHLRGYRED----AGQAPLRETLAAAIVMRSGWQVGSP------
RLMKL_HAEI8       LNRENLVISLDLSGEALHLRGYRED----AGQAPLRETLAAAIVLRSGWQVGSP------
RLMKL_HAES1       LNQDELVVSLDLSGEALHLRGYRED----TGKAPLRETLAAAIVLRSSWEKGTP------
RLMKL_HISS2       LNQDELVVSLDLSGEALHLRGYRED----TGKAPLRETLAAAIVLRSSWEKGTP------
RLMKL_ACTSZ       LNRDDLILSLDLSGEALHMRGYRED----SGQAPLRETLAAALVLRSGWQKGTP------
RLMKL_MANSM       LNRDDLVLSLDLSGEALHLRGYRED----SGAAPLRETLAAAIVLRSGWKQGTP------
RLMKL_PASMU       LNREELVISLDLSGDALHMRGYRED----TGKAPLRETLAAAIVLRSGWQLGTP------
RLMKL_ACTPJ       LDRENMVVSLDLSGDALHMRGYRED----TGKAPLRETLAAAIVLRSGWQKGTP------
RLMKL_ACTP2       LDRENMVVSLDLSGDALHMRGYRED----TGKAPLRETLAAAIVLRSGWQKGTP------
RLMKL_ACTP7       LDRENMVVSLDLSGDALHMRGYRED----TGKAPLRETLAAAIILRSGWQKGTP------
RLMKL_HAEDU       LDREKLIVSLDLSGEALHMRGYRED----TGKAPLRETLAAIIVLRSGWQKGTP------
RLMKL_PSYIN       LWKDKATIYLDLSGSPLHLRGYRTI----AGEAPLRETLAAGIIKRSGW-QGEA------
RLMKL_SHEB5       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQASPST-----
RLMKL_SHEB9       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQASPST-----
RLMKL_SHEB8       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQAAPST-----
RLMKL_SHEPC       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQAAPTT-----
RLMKL_SHESW       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQAAPTT-----
RLMKL_SHESM       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWKAAPTT-----
RLMKL_SHESR       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWKAAPTT-----
RLMKL_SHESA       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWKAAPTT-----
RLMKL_SHEON       FRNGVITIAMNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWKAAPTT-----
RLMKL_SHEDO       YRNGQLTISVNFSGPSLHQRGYRST----TGEAPLKENLAANMLVRSGWQAEQVD-----
RLMKL_SHEFN       YRNGQLTISMNFSGASLHQRGYRST----TGEAPLKENLAANMLVRSGWQANPIT-----
RLMKL_SHEHH       FRRGEITIGFNFSGPALHKRGYRST----TGEAPLKENLAANMLVRSGWQAAQVD-----
RLMKL_SHEPA       FRRGEITIGINFSGPALHKRGYRST----TGEAPLKENLAANMLVRSGWQADKVD-----
RLMKL_SHESH       YRRGQITIGLNFSGPALHKRGYRST----TGEAPLKENLAANMLVRSGWQKTPVT-----
RLMKL_SHEWM       YRRGQITIGLNFSGPALHKRGYRDI----TGEAPLKENLAANMLMRSGWQKNPVS-----
RLMKL_SHELP       YRRGQITLGINFSGPALHQRGYRST----TGEAPLKENLAANMLVRSGWQQSPKD-----
RLMKL_SHEAM       YGRGKITIGINFSGAALHQRGYRGN----TGEAPLKENLAANMLYRSGWADNPVT-----
RLMKL_IDILO       VHKDKLTWSLDFTGDGMHKRGYRLQ----QGEAPLRETLAAAILVRAGIKNELEKDEP--
RLMKL_FRATF       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATH       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATO       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATW       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATT       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRAT1       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATM       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRATN       HKQ-FVNVFLCLNIDSLHKRSYRQF----QGQAPLKESLAAAILIKAGWLEELKKHQ---
RLMKL_FRAP2       HKQ-YVNVFLCLNIESLHKRSYRQF----QGQAPLKESLAAAILIKAGWLDELKKEQ---
D0KZE4_HALNC      TASGHTTLSLELSNGSLHRRGYRTD----GGLAPLRETLAAGMLWRARWPQLVASETET-
RLMKL_ACIBY       GKT-EHTYCLDLSGDSLHKRGYRRF----MTDAPIKENLAAAILQKAKLQERNPE-----
RLMKL_ACIBS       GKT-EHTYCLDLSGDSLHKRGYRRF----MTDAPIKENLAAAILQKAKLQERNPE-----
RLMKL_ACIBC       GKT-EHTYCLDLSGDSLHKRGYRRF----MTDAPIKENLAAAILQKAKLKERNPE-----
RLMKL_ACIAD       GKT-EHTYCLDLSGDSLHKRGYRHY----MTDAPIKENLAAAILQKAKLTELKPD-----
RLMKL_PSYA2       NDK-QAELYLDLSGTSLHRRGYRVA----MTEAPLKENLAAALLYSAGWHQKNEAGDAPF
RLMKL_PSYCK       NDK-QAELYLDLSGTSLHRRGYRVA----MTEAPLKENLAAALLYSAGWHKKNEAGDTPF
RLMKL_PSYWF       NEK-QAEIFLDLSGTSLHRRGYRVA----MTDAPLKENLAAGLLYTVGWHKTKNS-----
RLMKL_DESPS       SGN-EGTLYLDLSGESLHKRGYRVA----GGMAPLKENLAAGIVALSGWPEKQEA-----
G8QSR6_SPHPG      DGD-HVSWYVDFSGKGLYKRGYRLE----QTDAVLSEYLAASVLFRSDWRKAMEREE--Q
F0RUX4_SPHGB      DGD-KVAWYVDFSGRGLHRRGYRVA----QTDAVLSEYLTCSVIYRSEWRKELEKGE--E
RLMKL_ALCBS       DLN-EAHLWLDLAGEPLHRRGYRLA----GGRAPLRETLAAAILWAVGWGKEG------R
C8WGP0_EGGLE      VREGRATISLDLSGESLYHRSYLTPDDGPD--APLSCALAAGLLALAGWRTRGSR-----
F7V0X9_EEGSY      VHEGKATVSLDLAGESLYRRSYLSDDDTQD--ASLSCALAAGVLALADWRDRFAG-----
E1QZ79_OLSUV      VQRERAVVGIDLTGEPLFRRGYESARKGRAPIAPLRSDYAAALLAYGGWFRNCRH----E
C8W7K3_ATOPD      ISRNRATVGIDLAGEALFKRSLTGGRGPAREFAPLRLDYAAALLYLQAQTATSASGFSPD
F2N9W7_CORGP      LRGERASLNLDLCSEPLFDRLPRACANGRM----MRPDYAALMLAQLPMRAGSAE-----
C7N0P8_SLAHD      LHRDKATISLNLAGPVLHKRGYR--EPGVQTEAPLKETLAAGMLLAAGWDSMVAD-----
                           .      :  *              :    :  ::                

RLMKL_STRMK       --GLLDPMCGSGTLLIEGALMAADVAPGLMRHGS--------------LPPSRWLGFD--
RLMKL_STRM5       --GLLDPMCGSGTLLIEGALMAADVAPGLMRHGS--------------LPPSRWLGFD--
RLMKL_XANAC       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DVPSRWRGFD--
RLMKL_XANC5       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DVPSRWRGFD--
RLMKL_XANOM       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DLPSRWRGFD--
RLMKL_XANOP       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DLPSRWRGFD--
RLMKL_XANOR       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DLPSRWRGFD--
RLMKL_XANCP       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DIPSRWRGFD--
RLMKL_XANC8       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DIPSRWRGFD--
RLMKL_XANCB       --GLLDPMCGSGTLLIEGALMAADVAPGLQRYGS--------------DIPSRWRGFD--
RLMKL_XYLF2       --GLLDPMCGSGTLLIEGALMVADVAPGLSRYADPDAMSHVSVAERPVLLPSRWRGFD--
RLMKL_XYLFT       --GLLDPMCGSGTLLIEGALMVADVAPGLSRYADPDAMSHVSVAERPVLLPSRWRGFD--
RLMKL_XYLFM       --GLLDPMCGSGTLLIEGALMVADVAPGLSRYADPDAMSHVSVAERPVLLPSRWRGFD--
RLMKL_XYLFA       --GLLDPMCGSGTLLIEGALMVADVAPGLSRYADPDAISHVSVAERPVLLPSRWRGFD--
RLMKL_ALKEH       --GLLDPMCGSGTLVLEGALMALDRAPGLGRE---------------RWGFSRWAGHV--
RLMKL_CHRSD       --PLVDPLCGAGTLLIEAALMAADIAPQLSRD---------------YFAFEAWVGHD--
RLMKL_MARHV       --DFVDLMCGSGTLVVEAALMALDIAPGRKQE---------------RFGFEKWPGHQ--
RLMKL_PSEAE       --ALADPMCGVGTFLVEAALMAADIAPNLKRE---------------RWGFSSWLGHV--
RLMKL_PSEA7       --ALADPMCGVGTFLVEAALMAADIAPNLRRE---------------RWGFSNWLGHV--
RLMKL_PSEP1       --ALADPMCGVGTFLVEAAMIAADIAPNLKRE---------------RWGFSAWLGHV--
RLMKL_PSEPK       --ALADPMCGVGTFLVEAAMIAADIAPNLKRE---------------RWGFSAWLGHV--
RLMKL_PSEPG       --ALADPMCGVGTFLVEAAMIAADIAPNLKRE---------------RWGFSAWLGHV--
RLMKL_PSEPW       --ALADPMCGVGTFLVEAAMIAADMAPNLKRE---------------RWGFSAWLGHV--
RLMKL_PSEE4       --ALADPMCGVGTFLVEAAMIAADIAPNLKRE---------------RWGFSAWLGHV--
RLMKL_PSEF5       --ALADPMCGVGTFLVEAAMIAADIAPNLKRE---------------QWGFTAWLGHV--
RLMKL_PSEPF       --ALADPMCGVGTFLVEAGMIAADMAPNLRRE---------------QWGFTAWLGHV--
RLMKL_PSE14       --ALADPMCGVGTFLVEAGMIAADIAPNIKRE---------------RWGFSAWLGHV--
RLMKL_PSEU2       --ALADPMCGVGTFLVEAGMIAADIAPNIKRE---------------RWGFSAWLGHV--
RLMKL_PSESM       --ALADPMCGVGTFLVEAGMIAADIAPNIKRE---------------RWGFSAWLGHV--
RLMKL_PSEMY       --ALADPMCGVGTFLIEAALMAADVAPNLKRE---------------RWGFSNWLGHV--
RLMKL_PSEU5       --ALTDPMCGVGTFLVEGAMMAADIAPNLKRE---------------RWGFSAWLGHV--
RLMKL_METCA       --SLIDPMCGSATLLIEGALLAADIAPGSFRE---------------YFGFLAWKGHD--
RLMKL_PELCD       --ALVDPMCGSGTLVIEAALITADCAPGLTRP---------------YWGFAGWLQHR--
RLMKL_ALLVD       --ALLDPMCGSGTLIIEGALIAADIAPGLLRE---------------RFGFHGWTQHD--
RLMKL_HYDCU       --AFYDPMCGSGTFLVEAALMASDTAPGVAKS--G------------EMLLNYWLGHD--
RLMKL_CELJU       --ALLDPMCGSGTFLVEAALMAADIAPGLGRA---------------SFGFERWLNHR--
RLMKL_SACD2       --ALLDPMCGSGTLLIEGALIAYSIAPGLSRD---------------KFGFECWTGHN--
RLMKL_MARMS       --QLIDPMCGSGTFLVEAAMMSLDMAPGLRRP---------------YWGFKGWKQHD--
RLMKL_LEGPC       --GLHDPFCGSGTLVIEAAMMAAHIAPGLLRQ---------------DQSLQYWARHQ--
RLMKL_LEGPA       --GLHDPFCGSGTLVIEAAMMAAHIAPGLLRQ---------------DQSLQYWARHQ--
RLMKL_LEGPH       --SLHDPFCGSGTLVIEAAMMAAHIAPGLLRQ---------------DQSLQYWARHQ--
RLMKL_LEGPL       --GLHDPFCGSGTLVIEAAMMAAHIAPGLLRQ---------------DQSLQYWARHQ--
RLMKL_HAHCH       --CFVDPMCGSGTLVVEAAMIAMNIAPGLLNP---------------HFLFEKAPWHD--
RLMKL_DICNV       --TLIDPTCGAGTLVLEAAMMAADYAPNLQRQ---------------HWGFTRWQNHR--
RLMKL_MAGMM       --PFVDPMCGSGTLPIEAAMMAGDIAPGSLRR---------------YFGFRRWRGASGI
RLMKL_ALTMD       ---LVDLMCGSGTIAIEAAYIARNIAPGIKRS---------------YWGFTKWLGHE--
RLMKL_PSEA6       ---LVDPMCGAGTIAIEAALMAANIAPALKRE---------------RWGFTRWLQHD--
RLMKL_COLP3       ---LVDPMCGSGTILIEAVSMAAKQAPAINRQ---------------SWGFEAWLSHD--
RLMKL_PSEHT       ---LFDPCCGAGTILIEAAGMARNEAPGLFRE---------------GFAFERLPSFR--
RLMKL_ALIF1       ---LLDPMCGSGTLLIEAALMACEMAPGVKRE---------------KWCFEALNDFD--
RLMKL_ALIFM       ---LLDPMCGSGTLLIEAALMACEMAPGVKRE---------------KWCFEALNDFD--
RLMKL_ALISL       ---LLDPMCGSGTLLIEAALMACEMAPGVKRE---------------KWCFEALSDFD--
RLMKL_PHOPR       ---LLDPMCGSGTLLIEAAMMAADIAPGLKRK---------------RWGFESIKDFD--
RLMKL_VIBCH       ---LLDPMCGSGTLLIEAAMMAANIAPGLQRK---------------KWGFEALEDFE--
RLMKL_VIBC3       ---LLDPMCGSGTLLIEAAMMAANIAPGLQRK---------------KWGFEALEDFE--
RLMKL_VIBCB       ---LLDPMCGSGTLLIEAAMMAANMAPGVKRK---------------QWGFEALEDFE--
RLMKL_VIBPA       ---LLDPMCGSGTLLIEAAMMAANMAPGVKRK---------------QWCFESLEDFE--
RLMKL_VIBVY       ---LLDPMCGSGTLLIEAAMMAANMAPGVKRE---------------KWVFESLEDFE--
RLMKL_AERHH       ---MMDPMCGSGTLLVEAAFIAADMAPALRRE---------------RFGFDRWLQHD--
RLMKL_AERS4       ---MMDPMCGSGTLLIEAAFIAADMAPALRRE---------------RFGFDRWLQHD--
RLMKL_BUCAI       ---MIDPMCGSGTFLIEAAMISSDRAPGLKRL---------------KWGFQFWKKYN--
RLMKL_BUCAP       ---LIDPMCGSGTLLIEAAMISSDRAPGLKRT---------------EWGFKSWKGHK--
RLMKL_SHIFL       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_SHIF8       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECOLI       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECOHS       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECOLC       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECODH       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECO57       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECO5E       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECO24       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_SHIDS       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_SHIB3       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_SHIBS       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_SHISS       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWVQHD--
RLMKL_ECOSM       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWAQHD--
RLMKL_ECOL5       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWTQHD--
RLMKL_ECOUT       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWTQHD--
RLMKL_ECOK1       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWTQHD--
RLMKL_ECOL6       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------RWGFSGWTQHD--
RLMKL_SALA4       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALTY       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALDC       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALEP       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALHS       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALNS       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALPA       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALPK       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALPB       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALG2       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALCH       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALSV       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALTI       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_SALAR       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_CITK8       ---LLDPMCGSGTLLIEAAMWATDRAPGLHRG---------------HWGFSGWAQHD--
RLMKL_KLEP3       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------HWGFGGWAQHD--
RLMKL_KLEP7       ---LLDPMCGSGTLLIEAAMLATDRAPGLHRG---------------HWGFGGWAQHD--
RLMKL_ENT38       ---LLDPMCGSGTLLIEAAMMATDRAPGLHRG---------------QWGFNGWAQHD--
RLMKL_CROS8       ---LLDPMCGSGTLLIEAAMIATDRAPGLHRT---------------HWGFNGWAQHD--
RLMKL_ERWT9       ---LVDPMCGSGTLLIEAAMIASDRAPGLQRK---------------HWGFTGWSKFD--
RLMKL_YERPG       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPY       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPA       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPN       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPE       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPP       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPS       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERP3       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWNAFN--
RLMKL_YERPB       ---MVDPMCGSGTLLIEAAMMASDRAPGLHRG---------------HWGFTAWSAFN--
RLMKL_YERE8       ---MADPMCGSGTLLIEAAMMASDRAPGLHRE---------------HWGFTAWNAFN--
RLMKL_SERP5       ---MLDPMCGSGTLLIEAAMIASDRAPGLHRQ---------------HWGFTAWNGHN--
RLMKL_PECAS       ---MVDPMCGSGTLLIEAAMIASDRAPGLHRT---------------HWGFNAWLKHD--
RLMKL_PHOLL       ---MVDPMCGSGTLLIEAAMMAADRAPGLHRD---------------HWGFTAWLKHD--
RLMKL_PROMH       ---LIDPMCGSGTLLIEAAMMATDCAPALNRV---------------HWGFRHWLGHN--
RLMKL_SODGM       ---LLDPMCGSGTLLIEAAMIAADCAPGLTRP---------------YWGFSAWSGHD--
RLMKL_HAEIE       ---LVDPMCGSGTLLIEAAQIEAKIAPQLYRL---------------HWGFDFWKAHN--
RLMKL_HAEIG       ---LVDPMCGSGTLLIEAAQIEAKIAPQLYRL---------------HWGFDFWKAHN--
RLMKL_HAEIN       ---LVDPMCGSGTLLIEAAQMEAKIAPQLYRL---------------HWGFDFWKAHN--
RLMKL_HAEI8       ---LVDPMCGSGTLLIEAAQMEAKIAPQLYRL---------------HWGFDFWKAHN--
RLMKL_HAES1       ---LVDPMCGSGTLLIEAAQMEAQIAPQLHRL---------------HWGFDFWKGHN--
RLMKL_HISS2       ---LVDPMCGSGTLLIEAAQMEAQIAPQLHRL---------------HWGFDFWKGHN--
RLMKL_ACTSZ       ---LVDPMCGSGTLLIEAAQMEAQIAPQLHRS---------------HWGFDFWKGHN--
RLMKL_MANSM       ---LVDPMCGSGTLLIEAAQMEAKIAPQLHRM---------------HWGFDFWRGHN--
RLMKL_PASMU       ---LMDPMCGSGTLLIEAAQMQANIAPQLHRL---------------HWGFDFWKGHN--
RLMKL_ACTPJ       ---LVDPMCGSGTLLIEAAQMQAGIAPQLHRK---------------HWGFNAWKGHQ--
RLMKL_ACTP2       ---LVDPMCGSGTLLIEAAQMQAGIAPQLHRK---------------HWGFNAWKGHQ--
RLMKL_ACTP7       ---LVDPMCGSGTLLIEAAQMQAGIAPQLHRK---------------HWGFNAWKGHQ--
RLMKL_HAEDU       ---LVDPMCGSGTLLIEAAQMQAGIVPQLQRK---------------YWGFNAWKGHQ--
RLMKL_PSYIN       ---LLDPMCGSGTLVIEAAMMALNIAPGSLRE---------------TFGFEKWKKHD--
RLMKL_SHEB5       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHEB9       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHEB8       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHEPC       ---LLDPFCGSGTVLIEAALMAADIAPGLQRN---------------RFGFEHWRRHD--
RLMKL_SHESW       ---LLDPFCGSGTVLIEAALMAADIAPGLQRN---------------RFGFEHWRRHD--
RLMKL_SHESM       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHESR       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHESA       ---LLDPFCGSGTVLIEAALMAADIAPGLQRS---------------RFGFEHWRRHD--
RLMKL_SHEON       ---LLDPFCGSGTVLIEAALMAADIAPGLQRN---------------RFGFEHWRRHD--
RLMKL_SHEDO       ---LLDPFCGSGTVLIEAALMACDIAPGLKRQ---------------RFGFESWRQHN--
RLMKL_SHEFN       ---VLDPFCGSGTVLIEAALMAADIAPGLKRE---------------KFGFENWQSHN--
RLMKL_SHEHH       ---LLDPFCGSGTILIEAAMMACDIAPGIHRE---------------RFGFDHWLPHN--
RLMKL_SHEPA       ---LLDPFCGSGTILIEAAMMACDIAPGIHRE---------------RFGFDHWLPHN--
RLMKL_SHESH       ---LMDPFCGSGTILIEAAMIACDMAPGLHRE---------------RFGFEHWHRHN--
RLMKL_SHEWM       ---LLDPFCGSGTILIEAAMMACDMAPGLHRE---------------RFGFEHWLRHN--
RLMKL_SHELP       ---LLDPFCGSGTILIEAAMMACDIAPALQRR---------------RFGFEHWLRHQ--
RLMKL_SHEAM       ---LLDPFCGSGTVLIEAALMACDIAPGLMRE---------------RFGFEHWRRHD--
RLMKL_IDILO       --VIFDPFCGSGTLVIEAAMMAMDHAPGLSRA---------------HWGFLFWHEHS--
RLMKL_FRATF       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATH       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATO       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATW       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATT       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRAT1       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATM       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRATN       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKIFNSKFHN--
RLMKL_FRAP2       -PILIDPMCGSGTILIEAALMAKNIAPVLLN--K-------------EFKLFNSKLHD--
D0KZE4_HALNC      GAALFDPMCGSGTLLIEAALRLTGLPQDLRV--K-------------RIGSTGWLGHR--
RLMKL_ACIBY       --IVLDPMCGSGTFIIEALMILTDRAPGLVR----------------RFGFNGWHGHD--
RLMKL_ACIBS       --IVLDPMCGSGTFIIEALMILTDRAPGLVR----------------RFGFNGWHGHD--
RLMKL_ACIBC       --IVLDPMCGSGTFIIEALMILTDRAPGLVR----------------RFGFNGWHGHD--
RLMKL_ACIAD       --LILDPMCGSGTFIIESLMIFTDRAPGLVR----------------RFGFNGWHGHD--
RLMKL_PSYA2       YNALIDPMCGSGTFIIEALLMHCDYAVGIDKAAN-------------QFGFYEWQHHD--
RLMKL_PSYCK       YNALIDPMCGSGTFIIEALLMHCDYAVGIDKAAN-------------QFGFYEWQHHD--
RLMKL_PSYWF       YSALIDPMCGSGTFIIEALLMHCDYPVGIDKAES-------------QFGFYNWQEHD--
RLMKL_DESPS       LPSLIDPMCGTGTLLIEAAMMFGDVAPGLAR--N-------------YFGFLHWHQHD--
G8QSR6_SPHPG      VPVLLDPFCGAGTLAIEAALWATDQAPGLVTA-R-------------RFAFFDLPIHD--
F0RUX4_SPHGB      VPMLLDPFCGSGTIPIEAALWAADRAPGLVTA-R-------------RFNFFNLPIHD--
RLMKL_ALCBS       HSALIDPFCGSGTLVIEAALIAAGRAAG-AQR-Q-------------HYGFQQWRGCR--
C8WGP0_EGGLE      GEALVDPACGDGFLVVEAASAACDLAPGLTRE---------------RWGFFGWVPSD--
F7V0X9_EEGSY      GAALVDPACGDGMLVVEAASMACDQAPGLVRD---------------HWGFFGWALSE--
E1QZ79_OLSUV      GAAVAVVHSGAGTVLVEAASQALGRAPGLLRA---------------HWGFDGWMGHD--
C8W7K3_ATOPD      ALLPALLFPGAGALAQEAAGMALDVAPGILRA---------------RWGMTGWAGHN--
F2N9W7_CORGP      APALIDLACGGGAIVLEAAGLLLDRAAGRTRR---------------RWGFKGWAAHE--
C7N0P8_SLAHD      GMGFADPMCGSGTLAIEAALIATRAAPGLLRN---------------RWGFTAYMPHD--
                           * . .  *.                                          

RLMKL_STRMK       KSAWKTIQSEARDREAAGLAALKP-----------------VIHGSDIDPTAIQAARENA
RLMKL_STRM5       KAAWKAIQSEARDREAAGLAALKP-----------------VIHGSDIDPTAIQAARENA
RLMKL_XANAC       RDGWQQLVGEARERDRVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANC5       RESWQQLVSEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANOM       RNGWQQLVSEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANOP       RNGWQQLVSEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANOR       RNGWQQLVSEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANCP       RDSWQQLVTEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANC8       RDSWQQLVTEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XANCB       RDSWQQLVTEARERDSVGRAALKQ-----------------VIHGSDMDPHAIRAAKENA
RLMKL_XYLF2       VVAWEALVVDAQQRARRGLAELRP-----------------VLHGSDIDPRALGAAFANA
RLMKL_XYLFT       VVAWEALVVDAQQRARRGLAELRP-----------------VLHGSDIDPRALGAAFANA
RLMKL_XYLFM       VVAWEALVVDAQQRARRGLAELRP-----------------VLHGSDIDPRALGAASANA
RLMKL_XYLFA       VVAWEALVVDAQQRARRGLAELRP-----------------VLHGSDIDPRALGAAFANA
RLMKL_ALKEH       PVYWKRLRDEAEERAAAG-GRR-R----------------LALVGYDQDPQAIRAALDNR
RLMKL_CHRSD       PDAWRELQREAQARANVG-RRRVK----------------SKLYGRDQSPPAIAAAKANA
RLMKL_MARHV       PELWLSLRQEAERRAHEG-KQGRI----------------PTFYGFDRDGRVIATAEKNI
RLMKL_PSEAE       PALWRKLHEEAQQRAAAG-LARPP----------------LWIRGYEADPRLIQPACNNI
RLMKL_PSEA7       PALWRKLHEEAQQRAAAG-LARAP----------------LWIRGYEADPRLIQPARNNI
RLMKL_PSEP1       PALWRKVHDEAQARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEPK       PALWRKVHDEAQARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEPG       PALWRKVHDEAQARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEPW       PATWRKVHEEAQARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEE4       PALWRKLHDEAQARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEF5       PALWRKLHDEALARAQAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEPF       PALWKKLHEEAVERAAAG-LAKPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSE14       PALWRKLHDEALARAEAG-LAKTP----------------SWIRGYEADPRLIQPGRNNI
RLMKL_PSEU2       PALWRKLHDEALARAEAG-LAKTP----------------SWIRGYEADPRLIQPGRNNI
RLMKL_PSESM       PTLWRKLHDEALARAEAG-LAKTP----------------SWIRGYEADPRLIQPGRNNI
RLMKL_PSEMY       PAIWKKLHAEAEQRAAAG-LARPP----------------LWIRGYEADPRLIQPGRNNV
RLMKL_PSEU5       PALWNRLHADAQARAEAG-LARPP----------------LWIRGYEADPRLIQPGRNNI
RLMKL_METCA       LELWRKLLTEARERAEAG-LAR-L----------------PPILGYDLDRRAIHLALDNI
RLMKL_PELCD       AEVWDTLLEEARQRREAG-LQQ-L----------------PCMIGYDRDRKAIRAARENA
RLMKL_ALLVD       EPAWQRLLAEARLRRTAG-LKR-L----------------GSLRGYDVNPNAIRTSLHHL
RLMKL_HYDCU       ESLWQKLVEEAEQREQVG-LKH-L----------------PNIYGSDISHKSLDVARNSI
RLMKL_CELJU       NDLWLTLREEAHHRRKLGLAKVNL----------------PEIRGYDADVRVVRAAEENI
RLMKL_SACD2       ADTWAQVVNDAKAIRDKNLQEKSF-----------------DIFGYDSDYYVTKAAEMNC
RLMKL_MARMS       HRMWQQLMDFAKNRKK-DPATLGI-----------------RFQGTDREQKAIAAARENI
RLMKL_LEGPC       SSLWEKLRTQALQQV----KPLAV----------------KLV-GTDADGKIITLARSNA
RLMKL_LEGPA       SSLWEKLRTQALQQV----KPLAV----------------KLV-GTDADGKIITLARSNA
RLMKL_LEGPH       SSLWEKLRTQALQQV----KPLAV----------------KLI-GTDADSKIITLARSNA
RLMKL_LEGPL       SSLWEKLRTQALQQV----KPLAV----------------KLV-GTDTDSKVVALARSNA
RLMKL_HAHCH       PEVWRGVYEEAMEKAVLGKRRWRG----------------AIF-GCDLNPAAIRTAKRNL
RLMKL_DICNV       PALWNKVIDEAQTRKNAGIAALSD----------------YVFYGYDQNPVVIAAARANA
RLMKL_MAGMM       AELWQRLADESIERQN----QAKM----------------PIIEAGDSDANMVHIAQANI
RLMKL_ALTMD       ATLWDSLLEDAISVQ----KPSCG----------------GGIYAGDFSRKMVAIAKANA
RLMKL_PSEA6       ATLWQSLLDDA-NAQ----IITPN----------------CVISASDIDHGVVSIAKENA
RLMKL_COLP3       NAVWQKQLTLAIDSSEEN-MSNLK----------------VKVFGIDIDERVLRTAQQNA
RLMKL_PSEHT       AAKFKELKEELLG----N-IIDPK----------------LWLIGHDYDAQVLGKAIDNA
RLMKL_ALIF1       AELWAEIRSEARVKSRRG-VKKVD----------------ARFYGFDRDYRVIQTARENA
RLMKL_ALIFM       AELWAEIRSEARVKSRRG-VKKVD----------------ARFYGFDRDYRVIQTARENA
RLMKL_ALISL       PEVWTEIRSEARVKSRRG-VKKVD----------------THFYGFDRDYRVIQTARDNA
RLMKL_PHOPR       KDAWLEIHAEASVKARRG-PAKVQ----------------TKFFGFELEHRILAIARDNA
RLMKL_VIBCH       PELWASVKSEASVQGKRG-VKKVE----------------THFYGVDNDNRVLQTAKDNA
RLMKL_VIBC3       PELWASVKSEASVQGKRG-VKKVE----------------THFYGVDNDNRVLQTAKDNA
RLMKL_VIBCB       PELWAEIKSEANVQARRG-VKKVD----------------AKFFGFDNDPNVLKVAQDNA
RLMKL_VIBPA       PDTWAEIKSEANVQARRG-VKKVD----------------AKFFGFDNDPKVLKVAQENA
RLMKL_VIBVY       PEVWAEIKSEANVIARRG-VKKVG----------------ARFYGFDNDEKVLKIAQDNA
RLMKL_AERHH       SELWQSLLMEAQVRAKRG-MQRCE----------------VKLFGCDADSRVLLKARDNA
RLMKL_AERS4       SELWQSLMMEAQVRAKRG-MQRCE----------------VKLFGCDADPRVLMKARDNA
RLMKL_BUCAI       KNLWKKVLEEAEEKFKIGIKKCFQ----------------NYFIGYDYDPEIIKKAKKNA
RLMKL_BUCAP       EKVWKETLKKAKERFKIGIKKCLK----------------NYFIGYDCNPDVIKKAQKNV
RLMKL_SHIFL       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SHIF8       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOLI       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOHS       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOLC       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECODH       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECO57       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECO5E       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECO24       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SHIDS       EAIWQEVKAEAQTRSRKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SHIB3       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SHIBS       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SHISS       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOSM       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOL5       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_ECOUT       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFFGSDSDARVIQRARTNA
RLMKL_ECOK1       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFFGSDSDARVIQRARTNA
RLMKL_ECOL6       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIQRARTNA
RLMKL_SALA4       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALTY       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALDC       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALEP       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALHS       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALNS       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALPA       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALPK       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALPB       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALG2       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALCH       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALSV       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALTI       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_SALAR       ETIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_CITK8       EAIWQEVKAEAQTRARKG-LAEYS----------------SHFYGSDSDARVIERARSNA
RLMKL_KLEP3       DAIWKEVKAEAQTRARQG-LAAYG----------------SRFYGSDVDERVIERARRNA
RLMKL_KLEP7       DAIWKEVKAEAQTRARQG-LAAYE----------------SRFYGSDVDARVIERARRNA
RLMKL_ENT38       DAIWKEVKAEAQVRARKG-LADYG----------------SRFYGSDSDARVIERAASNA
RLMKL_CROS8       ESLWKEVKTEAQVRARRG-LSEYA----------------SRFYGSDNDARVIERARTNA
RLMKL_ERWT9       PSLWSDVTREAHERARQG-IAQTS----------------SRFFGYDNDARVIDRARINA
RLMKL_YERPG       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPY       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPA       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPN       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPE       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPP       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPS       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERP3       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERPB       EALWRELTTEAQVRARRG-LLETS----------------SRFFGSDIDRRVIEMARANA
RLMKL_YERE8       QELWRELTTEAQVRARRG-LQETT----------------SRFFGSDIDRRVIEMARANA
RLMKL_SERP5       VDLWREVITEAQVRARRG-LQETT----------------SRFFGSDIDRRVIEMARGNA
RLMKL_PECAS       AELWHELTSEAQQRASQG-LQATT----------------SRFFGSDNDRRVIEIAKANA
RLMKL_PHOLL       EAIWREVITEAQIRFRKG-LQETT----------------CRFVGSDIDRRVLDMARSNA
RLMKL_PROMH       EALWKEVTHEAFARFREG-KKNTQ----------------ARFYGFDVDKRVLDMARANA
RLMKL_SODGM       EAQWQESLDEARARTQTG-LAQTS----------------SRFYGFDIDGRVLEKARHNA
RLMKL_HAEIE       QSAWEKVKNEAIELAEEK-QSEIQ----------------PHFYGFDLDHRVLKKAQKNA
RLMKL_HAEIG       QSAWEKVKNEAIELAEEK-QREIQ----------------PHFYGFDLDHRVLKKAQKNA
RLMKL_HAEIN       QSAWEKVKNEAIELAEEK-QREIQ----------------PHFYGFDLDHRVLKKAQKNA
RLMKL_HAEI8       QSAWEKVKNEAIELAEEK-QREIQ----------------PHFYGFDLDHRVLKKAQKNA
RLMKL_HAES1       QVVWEKVKQEAVELAEQAFNRKLT----------------PHFWGFDLDHRVLKKAQKNA
RLMKL_HISS2       QVVWEKVKQEAVELAEQAFNRKLT----------------PHFWGFDLDHRVLKKAQKNA
RLMKL_ACTSZ       QAVWEKVKAEAVALAEAQMEKNP-------------------------------------
RLMKL_MANSM       QAAWEKVKREAVAMAEAEFNKNPN----------------PHFYGFDLDHRVLQKAQRNA
RLMKL_PASMU       QQAWDKVKGEAIELAEQTFNQNQK----------------ANFYGCDLDHRVLQKAKRNA
RLMKL_ACTPJ       QAVWKEVLEQAYLQQNEE----IQ----------------PLFFGFDLDHRVLAKAKQNA
RLMKL_ACTP2       QAVWKEVLEQAYLQQNEE----IQ----------------PLFFGFDLDHRVLAKAKQNA
RLMKL_ACTP7       QAVWKEVLEQAYLQQNEE----IQ----------------PLFFGFDLDHRVLAKAKQNA
RLMKL_HAEDU       QAIWQQVLEEAHSQKNTQ----ID----------------PLFYGFDLDHRVLAKAKQNA
RLMKL_PSYIN       QECWQTLKTSAQVYGRRA-VNQCE----------------TRFYGSDLSKDMIEIARKNA
RLMKL_SHEB5       KAVWQEIVEEAKARASLG-VKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHEB9       KAVWQEIVEEAKARASLG-VKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHEB8       KAVWQEIVEEAKARASLG-VKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHEPC       KAVWQDIVAEAKARASLG-VKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHESW       KAVWQDIVAEAKARASLG-VKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHESM       KATWHEILEEAKARASLG-VKRCD----------------VKFYGSDIDSRLVALAKRNA
RLMKL_SHESR       KATWHEILEEAKARASLG-VKRCD----------------VKFYGSDIDSRLVALAKRNA
RLMKL_SHESA       KATWHEILEEAKARASLG-VKRCD----------------VKFYGSDIDSRLVALAKRNA
RLMKL_SHEON       KATWHEIVEEAKARASLG-VKRCE----------------VKFYGSDIDSRLVALAKRNA
RLMKL_SHEDO       ATMWNKVLEEAHARASLG-RTRCK----------------VKFYGSDIDPRMVSLAKRNA
RLMKL_SHEFN       KAMWQVIFDEAQARATLG-KTRCK----------------LKFYGSDIEPHLISIAKRNA
RLMKL_SHEHH       KKVWEELLNEARARASIG-KTRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHEPA       KKVWQELLNEAQARASIG-KTRCE----------------IKFFGSDIDSRLVALAKRNA
RLMKL_SHESH       DKVWQGLLDEAKARASIG-KTRCT----------------TKFYGSDIDSRLVALAKRNA
RLMKL_SHEWM       DKYWQELLDEAKARASIG-ITRCK----------------TKFYGSDIDSRIVALAKKNA
RLMKL_SHELP       EADWQELLAEAKARASIG-TKRCE----------------IKFYGSDIDSRLVALAKRNA
RLMKL_SHEAM       QALWQQVIEEAKARASLG-KTRCQ----------------LKFYGSDIDSRVVALAKRNA
RLMKL_IDILO       PQLWHDVLEQAEQRFKEG-KKNFK----------------GHLKGSDNNPHLVAKAKDNA
RLMKL_FRATF       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATH       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATO       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATW       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATT       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRAT1       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATM       QELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRATN       KELWDNLLEIAK-NSQKVTNAI--------------------ICGFDIDNNVLDKAQRNI
RLMKL_FRAP2       EDLWNNLLEIAK-KAQKPTNAI--------------------IQGYDIDNNVLDKADRNI
D0KZE4_HALNC      EQAQKRVLDNPPELAKGVDKLT--------------------LIGQDIDIEQITAARANA
RLMKL_ACIBY       RELWLSLKAEAAERHEKALEQP-----------------LPKFYAYDADWEAVKATRENI
RLMKL_ACIBS       RELWLSLKAEAAERHEKALEQP-----------------LPKFYAYDADWEAVKATRENI
RLMKL_ACIBC       RELWLSLKAEAAERHEKALEQP-----------------LPKFYAYDADWEAVKATRENI
RLMKL_ACIAD       RELWLELKAEAAERHEIALQNT-----------------LPKFYAFDADWEAVKATRQNI
RLMKL_PSYA2       AALWQEMIDDAQTRFRAALEIANEQPDT-----------LPLIFGFDADNGAIIATEKNL
RLMKL_PSYCK       AALWQEMIDDAQTRFRAALEIANEQPDT-----------LPLIFGFDADNGAIIATEKNL
RLMKL_PSYWF       SELWQQCVVQAQERFHNGLQKA--AAGK-----------LPTILGFDADAGAIKAVHKNL
RLMKL_DESPS       SQLWQALLDEAVAREDAGLDKT-----------------WPSFQGYDADPVVVSSARKNI
G8QSR6_SPHPG      PDLWEDLVDETLAKGVLGRQKNVK------------------IHAWDIDPRAIEMAKDNA
F0RUX4_SPHGB      PDIYEEIVDEATERAEKAKSRKIV------------------IHAWDSDPKAVAISKRHA
RLMKL_ALCBS       RQLWLDAQKEAGESGKRP-VPAVS------------------LKGFDSEASTLQLALQNA
C8WGP0_EGGLE      PDVWNELIDEADERFERGLASATAPGALDGPASAPPDPAHVRFAGASTSSPAIARARVHA
F7V0X9_EEGSY      PEVFNELISEADERFERGLLRVVGEEALEPAASTPPDIARVRIAGASTSSPAIARARMHA
E1QZ79_OLSUV      AGAWQDLLDDACGR------ADAIPGR------------GVRLLACDGRRGAQEAAVRAL
C8W7K3_ATOPD      DDVWQDLLAEADER------AEKGQER------------QITLYAADSRPKAKEAVLYTL
F2N9W7_CORGP      DRTWAALIEEADDRSATAAAAVAMGSR------------RISIVATDTDANAVSLAERTV
C7N0P8_SLAHD      PAAWERLVAEAEAA------RVPAWES------------GVRILAGDMNEEAVAVARANA
                                                                              

RLMKL_STRMK       EVAGVAHAIRFTRADVADLAAPEQEI---------------GAVVCNPPYDERLA-----
RLMKL_STRM5       EVAGVAHAIRFTRADVADLAAPEQEI---------------GAVVCNPPYDERLA-----
RLMKL_XANAC       QVAGVAEAIWFGVREVGELQTPPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANC5       QVAGVAEAIWFGVREVGELQTPPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANOM       QVAGVAEAIWFGVCEVGELQTPPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANOP       QVAGVAEAIWFGVCEVGELQTPPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANOR       QVAGVAEAIWFGVCEVGELQTPPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANCP       QVAGVAEAIWFGVREVGDLQTRPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANC8       QVAGVAEAIWFGVREVGDLQTRPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XANCB       QVAGVAEAIWFGVREVGDLQTRPQAT---------------GVVVCNPPYDERLA-----
RLMKL_XYLF2       RAAGVQDAIEFVVAGIDVLPAVSEPH---------------GVVVCNAPYDVRLA-----
RLMKL_XYLFT       RAAGVQDAIEFVVAGIDVLPAVSEPH---------------GVVVCNAPYDVRLA-----
RLMKL_XYLFM       RAAGVQDAIEFVVAGIDVLPAVSEPH---------------GVVVCNAPYDVRLA-----
RLMKL_XYLFA       RAAGVQDAIEFVVAGIDVLPAVFEPH---------------GVVVCNAPYDVRLA-----
RLMKL_ALKEH       ERAGLRDRVHFERRSLEAAEPVG--ERP-------------GLVVVNPPYGERLG--QRQ
RLMKL_CHRSD       MRAGIPALIDLQGAEVAQLTRPEGVDGP-------------GLVITNPPYGERLG--ELP
RLMKL_MARHV       LRAGLEGIVRVEARPISEFTRKNDWSDT-------------GLVLTNPPYGERLS--ERK
RLMKL_PSEAE       ERAGVADWVKIYQGELATFEPRPDKGQT-------------GLVICNPPYGERLG--DEA
RLMKL_PSEA7       ERAGVADWVKIYQGELATFEPRPDKGQA-------------GLVICNPPYGERLG--DEA
RLMKL_PSEP1       ERAGLGDWVKIYQGEVSTFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEPK       ERAGLGDWVKIYQGEVSTFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEPG       ERAGLGDWVKIYQGEVSTFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEPW       ERAGLSEWVKIYQGEVASFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEE4       ERAGLGDWVKIYQGEVASFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEF5       ERAGLSEWIKIYQGEVGTFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_PSEPF       ERAGLSEWIKIYQGEVATFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_PSE14       ERAGLSDWIKVYQGEVATFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_PSEU2       ERAGLSDWIKVYQGEVATFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_PSESM       ERAGLSDWIKVYQGEVATFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_PSEMY       ERAGLSDWVKIYQGELGSFEPRPDQNQK-------------GLVISNPPYGERLG--DEA
RLMKL_PSEU5       ERAGLSSWIRIYQGDVGSFEPRPDQNQK-------------GLVICNPPYGERLG--DEA
RLMKL_METCA       DRAGLRGRIHVERKVAADVRPKGRPG----------------LVVVNPPYGERLG--DVE
RLMKL_PELCD       RLAGLDAHLRFERCELEDLQAVPDAGESG------------GLLVTNPPYGERLG--EVD
RLMKL_ALLVD       ERAGLAGLAHFERRELSDCHPGREDDE--------------GLVIVNPPYGERLG--ADE
RLMKL_HYDCU       QAAGYDDVIEIKQMAVEQGRKWGDWSP--------------GLIVCNPPYGERLG--EEE
RLMKL_CELJU       ISAELDHWLRVSRKELAEFKKPTHRAMDY------------GLVLSNPPYGERLG--EIE
RLMKL_SACD2       EALGLQNVIHIANKPVEELKQPTHKVLVP------------GLVIVNPPYGERLG--EVN
RLMKL_MARMS       KRAGLTDVIDVTMSSFQEHEFDINPD-AP------------GLLITNPPYGERIG--DEM
RLMKL_LEGPC       ERAGVLPLVEFNTLPLNACRPGTK----K------------GLVVCNPPYGERLG--EVT
RLMKL_LEGPA       ERAGVLPLVEFNTLPLNACRPGTK----R------------GLVVCNPPYGERLG--EVT
RLMKL_LEGPH       ERAGVLPLVEFNTLSLNACRPGTK----R------------GLVVCNPPYGERLG--EVT
RLMKL_LEGPL       ERAGVLPLVEFNTLSLNACRPGTK----R------------GLVVCNPPYGERLG--EVT
RLMKL_HAHCH       SRAGLDRWVKLETASAMDFTPDTEGC-GQ------------RLLVCNPPYGERLG--QEL
RLMKL_DICNV       KRLGLEDFVHFAPKRLEDLTADFGA---R------------GFVVANPPYGERLG--EVQ
RLMKL_MAGMM       EEAELEGHIRLHQRDVAAWQKGADWPDRP------------GVLVTNPPYGERLG--EVV
RLMKL_ALTMD       DFAGVFNDISFSQQDATKSSPP-VAT--------------PGYVVSNPPYGERLG--ELT
RLMKL_PSEA6       DAAGVFSGIKFNTIDACKVIPPKGHT--------------KGYIVSNPPYGERLS--EIT
RLMKL_COLP3       RNAQLHQYIEFTCKNTNDMDNT-FGQ--------------PGTILFNPPYGERIG--ELP
RLMKL_PSEHT       KRAELDDIIKFKQSDATKLTAV-AKL--------------PGVVISNLPYGERIG--SMA
RLMKL_ALIF1       RRAGVEDLITFDVGDATKVECPEGFE--------------NGVILCNPPYGERLS--TEP
RLMKL_ALIFM       RRAGVEDLITFDVGDATKVERPEGFE--------------NGVILCNPPYGERLS--TEP
RLMKL_ALISL       RRAGVEDLITFDVGDATKIERPEGFE--------------NGVVICNPPYGERLS--TEP
RLMKL_PHOPR       GRAGVKELINFQQGDATELKAPEGFD--------------AGIVICNPPYGERLG--TTP
RLMKL_VIBCH       RRAGVEELISFTLGDAAKVKRPENFA--------------EGIVICNPPYGERLG--THP
RLMKL_VIBC3       RRAGVEELISFTLGDAAKVKRPENFA--------------EGIVICNPPYGERLG--THP
RLMKL_VIBCB       RRAGVEELITFAQGDAATITRPAGFE--------------AGVIVSNPPYGERLG--TEP
RLMKL_VIBPA       RRAGVEELIEFAQGDVATITRLSGFE--------------NGVIVSNPPYGERLG--TEP
RLMKL_VIBVY       RRAGVADLIEFKLGDAATVSRPQEFE--------------NGVIVCNPPYGERLG--TEP
RLMKL_AERHH       KAAGVAHLITFKQADVTALENPLPMPAPVEGEEGQGEARQVGMLISNPPYGERLG--EFP
RLMKL_AERS4       KAAGVAHLITFKQADVTQLENPLPMPAVVEGEVSQEEARQVGMLISNPPYGERLG--EFP
RLMKL_BUCAI       SNAGVLKIIQFLTKDVNNLKNVYHKE-------------QEGIILSNPPYGERYQ--TEN
RLMKL_BUCAP       INANLENIISFFACNLSHLKNPYQKE-------------EIGTLISNPPYGERCK--TEN
RLMKL_SHIFL       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SHIF8       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOLI       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOHS       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOLC       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECODH       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECO57       RLAGIGELITFEVKDVAQLTNPLPKE-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECO5E       RLAGIGELITFEVKDVAQLTNPLPKE-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECO24       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SHIDS       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SHIB3       RLAGIAELITFEVKDVAQLTNPLLKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SHIBS       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SHISS       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOSM       RLAGIGELITFEVKDVAQLANPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOL5       RLAGIGELITFEVKDVAQLTNPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOUT       RLAGIGELITFEVNDVAQLANPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOK1       RLAGIGELITFEVNDVAQLANPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_ECOL6       RLAGIGELITFEVNDVAQLANPLPKG-------------PYGTVLSNPPYGERLD--SEP
RLMKL_SALA4       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALTY       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALDC       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALEP       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALHS       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALNS       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALPA       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALPK       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALPB       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALG2       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALCH       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALSV       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_SALTI       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SDP
RLMKL_SALAR       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_CITK8       RRAGIGELITFEVKDVAQLSNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_KLEP3       RRAGIGELIDFAVKDVAQLNNPLPKG-------------PYGTVISNPPYGERLE--SEP
RLMKL_KLEP7       RRAGIGELIDFDVKDVAQLNNPLPKG-------------PYGTVISNPPYGERLE--SEP
RLMKL_ENT38       RRAGIGELISFEVKDVAQLTNPLPKG-------------PYGTVISNPPYGERLD--SEP
RLMKL_CROS8       RRAGLADIITFAAQDVTNLTNPLPEG-------------PTGTVISNPPYGERLE--SEP
RLMKL_ERWT9       RNAGLAELIGFTTQDVLKLTNPLAQG-------------PVGTVLSNPPYGERLD--SEP
RLMKL_YERPG       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPY       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPA       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPN       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPE       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPP       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPS       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERP3       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERPB       RRAGVAELITFNANDISKLVNPLPEG-------------PVGTVISNPPYGERLE--SEP
RLMKL_YERE8       RRAGVAELITFNANDVSKLVNPLPEG-------------PVGTVISNPPYGERLD--SEP
RLMKL_SERP5       RRAGVAELITFNVNDVAKLTNPLPEG-------------PTGTVVCNPPYGERLE--SEP
RLMKL_PECAS       RRAGVAELISFGVKDAAQLQNPLPEG-------------PKGTVISNPPYGERLE--SEP
RLMKL_PHOLL       RRAGVAQLITFQQGDASRLENPLPEG-------------PAGTVLSNPPYGERLE--SEP
RLMKL_PROMH       RRADVADLITFTQGDAAKLTNPVSTG-------------VKGTIISNPPYGERLE--SEP
RLMKL_SODGM       RRAGVAALITFQTGEVAQLINPLPEG-------------QRGTVVSNPPYGERLE--SEP
RLMKL_HAEIE       QNGGVSHLIKWQQADVAALKNPRLN--------------EVGTVICNPPYGERLG--TTP
RLMKL_HAEIG       QNAGVSHLIKWQQADVAALKNPRLN--------------EVGTVICNPPYGERLG--TTP
RLMKL_HAEIN       QNAGVSHLIKWQQADVAALKNPRLN--------------EVGTVICNPPYGERLG--TTP
RLMKL_HAEI8       QNAGVSHLIKWQQGDVAALKNPRLN--------------EVGTVICNPPYGERLG--TTP
RLMKL_HAES1       QNAGVSHLIKWQQGDVAGLKNPTEQ--------------EIGTVICNPPYGERLG--TTP
RLMKL_HISS2       QNAGVSHLIKWQQGDVAGLKNPTEQ--------------EIGTVICNPPYGERLG--TTP
RLMKL_ACTSZ       ------------------LRNGE-----------------KGTVLCNPPYGERLG--TTP
RLMKL_MANSM       QNAGVAHLIKWKQGDVAALKNPTPE--------------DKGTVICNPPYGERLG--TTP
RLMKL_PASMU       QNAGVAHLIQWQQGDVAALKNPFVE--------------AKGTVICNPPYGERLG--TTP
RLMKL_ACTPJ       KNAGVAHLIQWQQGDIAALKNPCPN--------------QVGTVICNPPYGERLG--TTP
RLMKL_ACTP2       KNAGVAHLIQWQQGDIAALKNPCPE--------------QVGTVICNPPYGERLG--TTP
RLMKL_ACTP7       RNAGVAHLIQWQQGDVAALKNPCPE--------------QVGTVICNPPYGERLG--TTP
RLMKL_HAEDU       QNAGVAHLIHWQQADIAALKNPCLD--------------QKGTLVSNPPYGERLG--TTP
RLMKL_PSYIN       QRAGVGEVIEFSVTDAKKVLPPEELE--------------TGMLITNPPYGERLG--SFS
RLMKL_SHEB5       ENAGVLELIEFNVADALTIAPPAESG----------------YLITNPPYGERLG--NVS
RLMKL_SHEB9       ENAGVLELIEFKVADALTIAPPAESG----------------YLITNPPYGERLG--NVS
RLMKL_SHEB8       ENAGVLELIEFKVADALTITPPAESG----------------YLITNPPYGERLG--NVS
RLMKL_SHEPC       ENAGVLELIEFKVANALNIEPPAAEG----------------YLITNPPYGERLG--NVS
RLMKL_SHESW       ENAGVLELIEFKVANALNIEPPAAEG----------------YLITNPPYGERLG--NVS
RLMKL_SHESM       QNAGVLELIDFKVANALNVEPPAGEG----------------YLITNPPYGERLG--SVS
RLMKL_SHESR       QNAGVLELIDFKVANALNVEPPAGEG----------------YLITNPPYGERLG--SVS
RLMKL_SHESA       QNAGVFELIDFKVANALNVEPPAAEG----------------YLITNPPYGERLG--SVS
RLMKL_SHEON       QNAGVLELIEFNVANALNVEPPAAEG----------------YLITNPPYGERLG--SVS
RLMKL_SHEDO       ENAGVDELIEFSEMDALNVKVPCETG----------------FMISNPPYGERLG--NIT
RLMKL_SHEFN       ENAGVAELIEFSVSDALDVTPPVSEG----------------FLISNPPYGERLG--NVT
RLMKL_SHEHH       ENAGVLELIDFNVCNALDVKAPAGSG----------------YLISNPPYGERLG--NVT
RLMKL_SHEPA       ENAGVLELIDFSVGNALTIDVPVESG----------------FLISNPPYGERLG--NVT
RLMKL_SHESH       ENAGVLDLIEFDVSNALNVKVPGESG----------------YLISNPPYGERLG--TVT
RLMKL_SHEWM       ANAGVLELIDFSVTNALNVKVPEETG----------------YLITNPPYGERLG--TVT
RLMKL_SHELP       QNAGVAELIELSVSNALNVTPPVEQG----------------YLITNPPYGERLG--NVT
RLMKL_SHEAM       NSAGVFDFIDFKVANALNLEPPVAEG----------------MVLTNPPYGERLG--NVT
RLMKL_IDILO       KRVLLHEVIEFEVADATNCEAPAESG----------------LLVCNPPYGERLG--EAV
RLMKL_FRATF       YQAGVEDVVTVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATH       YQAGVEDVVTVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATO       YQAGVEDVVTVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATW       YQAGVEDVVTVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATT       YQAGVEDVITVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRAT1       YQAGVEDVITVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATM       YQAGVEDVVTVKCQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRATN       YQAGVEDVVTVKRQDIRDLENEFESEG---------------LIVTNPPYGERLYGDQLD
RLMKL_FRAP2       YQAGVEDVVNIKRQDIRDLENELESEG---------------LIVTNPPYGERLYGDQLD
D0KZE4_HALNC      ERAGVDHLMVFREADAWKAPCPPEFEGK-----------SHGLVVSNLPYGHRLDVGGDH
RLMKL_ACIBY       IAAGFEKLLGDIQIEERTLADWPDF----------GAENKTAFIVTNPPYGERLGDKASN
RLMKL_ACIBS       IAAGFEKLLGDIQIEERTLADWPDF----------GAENKTAFIVTNPPYGERLGDKASN
RLMKL_ACIBC       IAAGFEKLLGDIQIEERTLADWPDF----------GAENKTAFIVTNPPYGERLGDKASN
RLMKL_ACIAD       IAAGFEKLLDQIQIEERTLADWPSF----------ENTYNTAFVVTNPPYGERLGDKASN
RLMKL_PSYA2       IAAGLQDLLPLLDIETRALDQLSTLLKPLVA----DGRLSNPLIITNPPYGERLGDEEMI
RLMKL_PSYCK       IAAGLQDLLPLLDIETRALDQLSTLLKPLVA----DGRLSNPLIITNPPYGERLGDEEMI
RLMKL_PSYWF       IAAGLIELIPHLTLEQRPLSQLKIALAKPLL----DRKLKRPLVITNPPYGERLGESDFI
RLMKL_DESPS       IRAGLDEF---IQVKCSPLVHLGAP-------------TDRGMLICNPPYGERLSETEKV
G8QSR6_SPHPG      KTAQVDQFIDFQVKDFTKITKEDVPEGI-------------GYVVTDPPYGVRMA-SEER
F0RUX4_SPHGB      ELAQVDHLIDFQIKDFRTIKKEDVPQGI-------------GYIITDPPYGLRME-SDT-
RLMKL_ALCBS       ERAGVRNAIHFERRELGALRRRDFVDN--------------GIVVGNPPWGERLE-EKP-
C8WGP0_EGGLE      KRAGLRQAVSIELADAQSVDELVSRVCA----------AAGRERGGEAASCTVASVLPTG
F7V0X9_EEGSY      KRAGLRQVVSVEQADAQSVGELVERVSS----------VAEQAAPDGTPRCVVACELPGA
E1QZ79_OLSUV      RAAGMDVAPAFGSAAEVGALLSAEKNAL----------AVC-DLSWVPEDEVALEAMALA
C8W7K3_ATOPD      RAGSLKADVQFLAASEL--LKHAEHFTG----------VVA-DLSWTKEE----------
F2N9W7_CORGP      RAAGLGHLVEFVRPEANAVLAAMSPSPR----------DPE-AARASDRIDTGIIIADMA
C7N0P8_SLAHD      ERAGVAELIEFYVDDAANLGTHLKRGRR----------LSGGLVACNPPYGHRLLSGEDL
                                                                              

RLMKL_STRMK       ADPALYRALGNALQKAVPQWR------ASLLCGNDELAFATGLRAG----KKYQMFNGAL
RLMKL_STRM5       ADPALYRALGNALQKAVPQWR------ASLLCGNDELAFATGLRAG----KKYQMFNGAL
RLMKL_XANAC       ADAALYRRLGDTLQRVAPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANC5       ADAALYRRLGDTLQRVVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANOM       ADAALYRRLGDTLQCAVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANOP       ADAALYRRLGDTLQCAVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANOR       ADAALYRRLGDTLQCAVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANCP       ADAALYRKLGDTLQRVVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANC8       ADAALYRKLGDTLQRVVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XANCB       ADAALYRKLGDTLQRVVPQWR------ASLLCGNAELAYATGLRAG----KKYQLFNGAI
RLMKL_XYLF2       ADPGLYRHLGDALRRVVPRWR------AALVCGSSTLAFATGLRAD----KKYQFFNGAL
RLMKL_XYLFT       ADPGLYRHLGDALRRVVPRWR------AALVCGSSTLAFATGLRAD----KKYQFFNGAL
RLMKL_XYLFM       ADPGLYRHLGDALRRVVPRWR------AALVCGSNTLAFATGLRAG----KRYQFFNGAL
RLMKL_XYLFA       ANPGLYRHLGDALRRVVPRWR------AALVCGSSPLAFATGLRAG----KKYQFFNGAL
RLMKL_ALKEH       ALVTLYASLGARLRGAFGGWQ------GAVFSGAPELLDYLGLSIA----RRHALYNGAL
RLMKL_CHRSD       EVVPIYTALGERLRAEFEGWQ------LALFTGNPDLGHRTGLRAE----KQYAFKNGPL
RLMKL_MARHV       ELAALYQSLGEVVARELIGWR------LGVFTGAPEFGKSLGLRSF----KQYKLFNGKL
RLMKL_PSEAE       SLLYLYQNLGERLRQSCIGWS------AGVFTGAPELGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEA7       SLLYLYQNLGERLRQSCIGWS------AGVFTGAPELGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEP1       SLLYLYQNLGERLRQACMGWE------AAVFTGAPQLGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEPK       SLLYLYQNLGERLRQACMGWE------AAVFTGAPQLGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEPG       SLLYLYQNLGERLRQACMGWE------AAVFTGAPQLGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEPW       SLLYLYQNLGERLRQACMGWE------AAVFTGAPELGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEE4       SLLYLYQNLGERLRQACMGWE------AAVFTGAPELGKRMGIRSH----KQYAFWNGAL
RLMKL_PSEF5       SLLYLYQNLGGRLRQACLNWE------AAVFTGAPDLGKRMGIRSH----KQYSFWNGAL
RLMKL_PSEPF       SLLYLYQNLGERLRQACLNWE------AAVFTGAPDLGKRMGIRSH----KQYSFWNGAL
RLMKL_PSE14       SLLYLYQNLGERLRQACLNWE------AAVFTGAPDLGKRMGIRSH----KQYSFWNGAL
RLMKL_PSEU2       SLLYLYQNLGERLRQACLNWE------AAVFTGAPDLGKRMGIRSH----KQYSFWNGAL
RLMKL_PSESM       SLLYLYQNLGERLRQACLNWE------AAVFTGAPDLGKRMGIRSH----KQYSFWNGAL
RLMKL_PSEMY       SLLYLYQNLGERLRQACLGWE------AAVFTGAPELGKRMGLRSH----KQYSFWNGAL
RLMKL_PSEU5       SLLYLYQNLGERLRQACLGWE------AAVFTAAPDLGKRMGIRSH----KQYAFWNGAL
RLMKL_METCA       SLIPVYREFGETLQRHFRGWN------AALLTGNFELAFQIGIRAG----RYHTLYNGAL
RLMKL_PELCD       ELRSLYASLGEKLRTHFSGWQ------AAVFTGNPELAKHIGIRAH----KLYKLYNGAL
RLMKL_ALLVD       DLTQLYARLGSVLKERFVGWR------AAVFTSSPELGKSLGLRAT----RIHSLYNGPI
RLMKL_HYDCU       TVKQIYLKLGEYLKAEFIHWK------AAILTCHTELGMFLGIKAK----RSHDFFNGAM
RLMKL_CELJU       SLKLLYAHLGERLRNEFPGWR------AGVFTGNPELGKQMGLRAD----KKYKFFNGTI
RLMKL_SACD2       ELRTTYQILAHQVKQQFEGWT------FAVFTSNPELAKETRLRAN----KKNKFKNGAL
RLMKL_MARMS       ALIALYRQLGEWVVTHVRGWQ------FMMLTSNDHLARQIPVRPE----KSTRVINGGI
RLMKL_LEGPC       QLVPLYQQLGTTLHTCYQGWQ------AAILTSSPVLAKALGLRAD----KQYTLYNGPL
RLMKL_LEGPA       QLVPLYQQLGTTLHTCYQGWQ------AAILTSSPVLAKALGLRAD----KQYTLYNGPL
RLMKL_LEGPH       QLVPLYQELGTTLHTCYQGWQ------AAILTSSPVLAKALGLRAD----KQYTLYNGPL
RLMKL_LEGPL       QLVPLYQQLGTTLHTCYQGWQ------AAILTSSPVLAKALGLRAD----KQYTLYNGPL
RLMKL_HAHCH       ELRSLYRALGRRLKTAYGEWK------AGIFTSSVNLAKEIGLRAD----KQYHLYNGPL
RLMKL_DICNV       ELIPTYAALGHWFKTLPADWE------MAVIASNDALLKRMRLRAH----KYYQAFNGTI
RLMKL_MAGMM       ELKGLFAKLGMLLNGPLLGWR------SGVLMGDVLWQSAMGLPQQG---QRMDLNNGPI
RLMKL_ALTMD       SLIPLFSDWGKRFKEAWKGWH------VSLLSSNRDLLRVLKLRAT----KDYAMNNGKL
RLMKL_PSEA6       ALLPLFQAWGTSLKEHFKGWN------LSLLTSNRDLLRSMKMFAH----KEYKLMNGKL
RLMKL_COLP3       ELVENFVLFGQKLKMQFKDWR------IAILTANVDLLSMLKLSSF----KRYKFKNGPL
RLMKL_PSEHT       ELVDLHRNLGVGFKKHFNHWK------LALLGMDESLFKLLKLVRL----KRYKFKNGPL
RLMKL_ALIF1       ALIALYSEFGRQLKEVFGGCT------ASIYSSNDDLLACLRMRAD----KQFKLNNGAL
RLMKL_ALIFM       ALIALYSEFGRQLKEVFGGCT------ASIYSSNDDLLACLRMRAD----KQFKLNNGAL
RLMKL_ALISL       ALIALYSEFGRQLKEQFGGCT------ASIYSSNDDLLACIRMRAD----KQFKLNNGAL
RLMKL_PHOPR       ELISLYTELGNRLKLAFAGSS------ASIYSGSNELLSCLRMRAD----KQFKLPNGAL
RLMKL_VIBCH       GLIALYTAFGAQLKAEFGGCH------ASIFSSSDELLSCLRMRAD----KQFKLNNGAL
RLMKL_VIBC3       GLIALYTAFGAQLKAEFGGCH------ASIFSSSDELLSCLRMRAD----KQFKLNNGAL
RLMKL_VIBCB       GLIALYTAFGGQLKAEFGGCK------ASIFSSSDELLSCLRMRAD----KQFKLNNGAL
RLMKL_VIBPA       GLIALYTAFGGQLKAEFGGCK------ASIFSSSDELLSCLRMRAD----KQFKLNNGAL
RLMKL_VIBVY       GLIALYTAFGGQLKAQFGGCT------ASIFSSSDELLSCLRMRAE----KQFKLNNGAL
RLMKL_AERHH       ALLEVHQALGDALRRSFQGWK------VSILSASPELLSCLRLRAD----KQYRLFNGAL
RLMKL_AERS4       ALLEVHQALGDALRRGFQGWR------VSILSASPELLSCLRLRAD----KQYRLFNGAL
RLMKL_BUCAI       KLVGLYVQLGITAKKYFKNWK------LSIFSASTFLLDFLQMQSH----EKYFFKNGPL
RLMKL_BUCAP       NLIALYIELGIMSKKYFEKWN------LSVFSSSEFLLNFLQMKSY----KNFCLKNGPL
RLMKL_SHIFL       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SHIF8       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOLI       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOHS       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOLC       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECODH       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECO57       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECO5E       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECO24       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SHIDS       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SHIB3       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SHIBS       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SHISS       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOSM       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOL5       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOUT       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOK1       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_ECOL6       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLSCLQLRAD----KQYKAKNGPL
RLMKL_SALA4       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALTY       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALDC       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALEP       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALHS       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALNS       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALPA       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALPK       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALPB       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALG2       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALCH       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALSV       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALTI       ALIALHSLLGRTMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_SALAR       ALIALHSLLGRIMKNQFGGWN------LSLFSASPDLLGSLQLRAD----KQFKAKNGPL
RLMKL_CITK8       ALIALHSLLGRTMKNQFGGWS------LSLFSASPDLLNCLQLRAD----KQFKAKNGPL
RLMKL_KLEP3       ALIALHSLLGRIMKSQFGGWN------LSVFSASPELLSCLQLRAD----KQFKAKNGPL
RLMKL_KLEP7       ALIALHSLLGRIMKSQFGGWN------LSVFSASPELLSCLQLRAD----KQFKAKNGPL
RLMKL_ENT38       ALIALHSLLGRSMKDYFGGWN------LSLFSGSPELLSCLQLRAE----RQFKAKNGPL
RLMKL_CROS8       ALIALHSLLGRIMKNQFGGWN------LSLFSASPELLSCLQLRAD----RQFKAKNGPL
RLMKL_ERWT9       ALIALHGQLGRIMKTHFGGWN------LSLFSASPELLSCLQLRAE----RQFKAKNGPL
RLMKL_YERPG       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPY       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPA       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPN       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPE       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPP       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPS       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERP3       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERPB       ALIALHNMFGRMMKTAFGGWR------LSLFSASPELLSCLQLRAD----REFKAKNGPL
RLMKL_YERE8       ALIALHNMLGRIMKASFGGWR------LSLFSASPELLSCLQLRAE----REFKAKNGPL
RLMKL_SERP5       ALIALHNMLGRIMKSAFGGWQ------LSLFSASPELLSCLQLRAE----RQFKAKNGPL
RLMKL_PECAS       ALIALHNMLGRKMKSDFGGWQ------LSLFSASPELLSCLQLRAE----RQFKAKNGPL
RLMKL_PHOLL       ALIALHSLFGRIMKSRFPSWR------LSLFSASPELLSCLQLRAE----REFKAKNGPL
RLMKL_PROMH       ALIALHSQLGRAVKAHFPGWR------LSLFSASPELLSCIQLRAE----REFKAKNGPL
RLMKL_SODGM       ALIALHNQLGRVMKSQFGGWR------LSLFSASPALLGALMLRAE----RSFSAKNGPL
RLMKL_HAEIE       ALIALYSVFGQRLKKEFCGWN------VSVFSSESTLLDCLRMRAS----RQFKAKNGPL
RLMKL_HAEIG       ALIALYSVFGQRLKKEFCGWN------VSVFSSESTLLDCLRMRAS----RQFKAKNGPL
RLMKL_HAEIN       ALIALYSVFGQRLKKEFCGWN------VSVFSSESTLLDCLRMRAS----RQFKAKNGPL
RLMKL_HAEI8       ALIALYSVFGQRLKKEFCGWN------VSVFSSESTLLDCLRMRAS----RQFKAKNGPL
RLMKL_HAES1       ALIALYSVFGRQLKTEFADWN------VSIFSGEPALLDCLRLRAY----RQFKAKNGPL
RLMKL_HISS2       ALIALYSVFGRQLKTEFADWN------VSIFSGEPALLDCLRLRAY----RQFKAKNGPL
RLMKL_ACTSZ       ALIALYSVFGQRLKQQFGGWN------VSVFSSEQGLLDCLRMRSF----RQFKAKNGPL
RLMKL_MANSM       ALIALYSVFGQRLKEQFPGWN------ASIFSSEQGLLDCLRMRSH----RQFKAKNGPL
RLMKL_PASMU       ALIALYSVFGQRLKQQFADWN------VSIFSGEPALLDCLRLRSH----RQFKAKNGPL
RLMKL_ACTPJ       ALIALYSVFGQRLKQQFSGWN------ASIFSGEPELLNCLRLRSH----RQFKAKNGPL
RLMKL_ACTP2       ALIALYSVFGQRLKQQFSGWN------ASIFSGEPELLNCLRLRSH----RQFKAKNGPL
RLMKL_ACTP7       ALIALYSVFGQRLKHQFSGWN------ASIFSGEPELLNCLRLRSH----RQFKAKNGPL
RLMKL_HAEDU       ALIALYSVFGQRLKQQFAGWN------VSIFSGEPSLLNCLRLRST----RQFKAKNGPL
RLMKL_PSYIN       DTITLYTELGYHFKDAFAGWN------LSMFAMDTELLSCLGMRAG----KSFKFFNGPI
RLMKL_SHEB5       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELVSSLKLKAD----KQMKMFNGAL
RLMKL_SHEB9       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELVSSLKLKAD----KQMKMFNGAL
RLMKL_SHEB8       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELVSSLKLKAD----KQMKMFNGAL
RLMKL_SHEPC       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISSLKLKAD----KQMKMFNGAL
RLMKL_SHESW       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISSLKLKAD----KQMKMFNGAL
RLMKL_SHESM       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISALKLKAD----KQMKMFNGAL
RLMKL_SHESR       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISALKLKAD----KQMKMFNGAL
RLMKL_SHESA       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISALKLKAD----KQMKMFNGAL
RLMKL_SHEON       ELLQLYYQLGDKFKKEFGGWK------VAMLCSDIELISALKLKAD----KQMKMFNGAL
RLMKL_SHEDO       ELLQLYYQFGDKLKQDFGGWK------VAMLCSDVELISSLKLKAD----KQMKMFNGAL
RLMKL_SHEFN       ELLQLYYQLGDKFKKEFGGWK------IAMLCSDVELISSLKLKAD----KQMKMFNGAL
RLMKL_SHEHH       SLLQLYYQLGDKFKADFGGWS------IAILNSDVELLSALKLKAD----KQMKMNNGAL
RLMKL_SHEPA       SLLQLYYQLGDKFKAEFGGWS------IAILNSDIELLSALKLKAD----KQMKMNNGAL
RLMKL_SHESH       ALLQLYYQLGDKFKAEFGGWN------LAILNSDVELLSALKLKAD----KQMKMNNGAL
RLMKL_SHEWM       ALLQLYYQLGDKFKAEFGGWN------LAVLNSDVELLSALKLKAD----KQMKMNNGAL
RLMKL_SHELP       SLLQLYYQLGDKLKAEFGGWQ------VAVLNSDIELLSALKLKAD----KQMKMYNGAL
RLMKL_SHEAM       SLLQLYFQLGEKFKQSYGGWK------LGLLCSDMELVSSLKLKAD----KQMKMYNGAL
RLMKL_IDILO       ETLLLYRRFGRQLKDTFQNWH------IAVLAGDEQLLKRLKLRSH----KKYPLLNGAI
RLMKL_FRATF       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRATH       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRATO       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRATW       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRATT       ELLDIFNGFGNRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRAT1       ELLDIFNGFGNRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTERNKFYNGAIETI
RLMKL_FRATM       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KELQLRTTERNKFYNGAIETI
RLMKL_FRATN       ELLDIFNGFGDRLSQDFYGWK------VAVLTSFADSI-KEMQLRTTKRNKFYNGAIETI
RLMKL_FRAP2       ELLDIFNGFGDRLSQDFYGWK------VAILTSFDESI-KEMQLRTTKKNKFYNGAIETV
D0KZE4_HALNC      EGEPDWSALTDQWQRCFNGWH------WAFLLPEGEGQNWPLRYERVFPMDQSGIAIDMI
RLMKL_ACIBY       R--SLYLGLSALLQKNFPNQ----------YAAIIAAQIEQADVLAFEAPETLRLMNGKL
RLMKL_ACIBS       R--SLYLGLSALLQKNFPNQ----------YAAIIAAQIEQADVLAFEAPETLRLMNGKL
RLMKL_ACIBC       R--SLYLGLSALLQKNFPNQ----------YAAIIAAQIEQADVLAFEAPETLRLMNGKL
RLMKL_ACIAD       R--ALYLGLSALLQQYFPKQ----------HAAVIAAQIEQADVLAFSEPETLRLMNGKL
RLMKL_PSYA2       K--PLYQSIGLILQDSFAGSG------VDPMLGILASHVEQVDILPIREPKTLRCHNGAI
RLMKL_PSYCK       K--PLYQSIGLILQDSFAGSG------IDPMLGILASHVEQVDILPIREPKTLRCHNGAI
RLMKL_PSYWF       K--PLYQGLGLTLQEIFAKQK------YQPMLGLLAAHVEQADVLPIEDPQTLRCHNGAI
RLMKL_DESPS       R--QLYAAFGRIGRKHFAGW----------DVAVFISNPDLAESFRVSWEKKYRLFNGTI
G8QSR6_SPHPG      PLEMLYRVIGRQFNSLFGGWH------IAILCGQQELLSFVDMKPDRTNTVNNGGIPCQI
F0RUX4_SPHGB      DLEVLYRQMGNKISTLFGGWN------VAILCGRQELLSHVDMKPDRTNTVNNGGVTCQI
RLMKL_ALCBS       QAGWLHYALGRILSVRAPGYQ------ALLLGADAEVMDRSGMNLEQQWRLKNGPFNNFI
C8WGP0_EGGLE      ERAQSDARSQADAAAFVRAASVAPAGSTFAVAGGEIVEARFGVAPA----VRAVLGRDRV
F7V0X9_EEGSY      ERMQSEARAQAEAAAFIAAASSAPAASLFAVAGEKGIEARFGVEPV----VRTEIGRERL
E1QZ79_OLSUV      DVAAALVPATAGLPAQTGV---------VAVARDATVDSALGCKPD----TTLGILVGQS
C8W7K3_ATOPD      PTLQGSAYATLGLFAGQAS---------TLLTSDTNTDTVLRATPT----QTLSVYVGNS
F2N9W7_CORGP      ATPLGRMASAIALITGVCSQPALKDFTLVAVARDGALEAAMAAAPD----GTHQIRLGGD
C7N0P8_SLAHD      SQVYAALDSATAKLGGGWQ--------LAIISPDEGVDTGLGRMPE----RSIACHNGPL
                                                                              

RLMKL_STRMK       ECALIVCDPIAVPGRDP-------------------------------------------
RLMKL_STRM5       ECALIICDPIAVPGRDP-------------------------------------------
RLMKL_XANAC       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANC5       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANOM       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANOP       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANOR       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANCP       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANC8       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XANCB       ECALIVCDPIAVPRRTPL------------------------------------------
RLMKL_XYLF2       ECVLIVCDPVVPLAREA-------------------------------------------
RLMKL_XYLFT       ECVLIVCDPVVPLAREA-------------------------------------------
RLMKL_XYLFM       ECVLIVCDPVVPLAREA-------------------------------------------
RLMKL_XYLFA       ECVLIVCDPVVPLAREA-------------------------------------------
RLMKL_ALKEH       ETQLAVFALREQGADR--------------------------------------------
RLMKL_CHRSD       DCKLLLIPVVAQRTERETSSEGDEPQGASGAT----------------------------
RLMKL_MARHV       PAQLLLFEVQPENARTPRDP------AAPGQI----------------------------
RLMKL_PSEAE       ACKLLMIQVEPRQFVTGERGERNDEGLARAPS----------------------------
RLMKL_PSEA7       ACKLLMIQVEPRQFVTGERGERNDDGQARAPS----------------------------
RLMKL_PSEP1       PCKLLLFKVQPDQFVTGERREAQPEGTEARQQ------------------VPQASEP---
RLMKL_PSEPK       PCKLLLFKVQPDQFVTGERREAQPEGTEARQQ------------------VPQASEP---
RLMKL_PSEPG       PCKLLLFKVQPDQFVTGERREAQPEGTEVRQQ------------------APQASEP---
RLMKL_PSEPW       PCKLLLFKIQPDQFVTGERREAQADSGDTHRP------------------LPVASEP---
RLMKL_PSEE4       PCKLLLFKVQPDQFVTGERRQAAVEEGEPRRQ------------------APVASEP---
RLMKL_PSEF5       PCKLLLIKVLPDQFVTGERRTAEQRQVEREQA--QAAADEAPVRQYNKNGNPIKPAPAPA
RLMKL_PSEPF       PCKLLLIKVLPDQFVTGERRTPEQRQAEREQAAYDQTPNEPQERKFNKNGNPIKPTPAPA
RLMKL_PSE14       PCKLLLIKVTPDQFVTGERRTPEQRQIERENP----VEVEVVERKLNKNGNPIKPEP---
RLMKL_PSEU2       PCKLLLIKVTPDQFVTGERRTPEQRQIERENP----VEVEVVERKLNKNGNPIKPEP---
RLMKL_PSESM       PCKLLLIKVTPDQFVTGERRTPEQRQVERENP----VEVEVVERKLNKNGNPIKPEP---
RLMKL_PSEMY       ACKLLLIKVQTEQFVTGERRTRTEDEPVAEAS----------------------------
RLMKL_PSEU5       PCKLLLIKVELDQFVTGQRAGSTEPQPQQAPV----------------------------
RLMKL_METCA       ECRLFLFDIAPERFFTPRSGVPETEGQKKLRQ-------------------------IVE
RLMKL_PELCD       ECRLLNFDIAEQRFFGADA-----------------------------------------
RLMKL_ALLVD       ECRLLSFQIEPRYFVSHLP-----------------------------------------
RLMKL_HYDCU       SCRLFRFEIEEEWFRQPALQP-----KQDLAE-------------------------QVL
RLMKL_CELJU       ASELLMFSINTDVFVQSRVEQDGRFSKDEVER-----------------DAAEQKVKAAA
RLMKL_SACD2       PAELFVYSVLSADDAKLRKDKLTQAVQTDEDG-----------------QVENASGAWVR
RLMKL_MARMS       ECRAYQFPLLAGSIKEDVVAQ---------------------------------------
RLMKL_LEGPC       ECKLYCLTLSAANKLKNTPNAP--------------------------------------
RLMKL_LEGPA       ECKLYCLTLSAANKLKNTPDAP--------------------------------------
RLMKL_LEGPH       ECKLYCLTLSAANKLKNTPNAP--------------------------------------
RLMKL_LEGPL       ECKLYCLTLSAANKLKNTPNAP--------------------------------------
RLMKL_HAHCH       ATTLYLFDVYGNRPEAETPRKPQNASLE--------------------------------
RLMKL_DICNV       AAQIVHYRRSEQPESQETAAQQKLAQASV-------------------------------
RLMKL_MAGMM       PCAYILHGTEPKPQAAKGAPAPKPGLQQGVVS----------------------------
RLMKL_ALTMD       ECRLANYVLDEQN-------------------------------------------TVQF
RLMKL_PSEA6       ECQLVNFALDEKN-------------------------------------------CITR
RLMKL_COLP3       DCQLALYNLDAKQ-------------------------------------------GAKD
RLMKL_PSEHT       DVELNLYQLDDKQ-------------------------------------------VSLT
RLMKL_ALIF1       PCVQKNYSITESA-----------------------------------ERKE--------
RLMKL_ALIFM       PCVQKNYSITESA-----------------------------------ERKE--------
RLMKL_ALISL       PCVQKNYSISESA-----------------------------------ERKE--------
RLMKL_PHOPR       DCVLKTYLITAGS-----------------------------------VKKEEGEA----
RLMKL_VIBCH       PCHQKNYTIAMRE-----------------------------------QNSVSNE-----
RLMKL_VIBC3       PCHQKNYTIAMRE-----------------------------------QNSVSNE-----
RLMKL_VIBCB       PCHQKNYSIAERS-----------------------------------ADEVKG------
RLMKL_VIBPA       PCHQKNYSIAERS-----------------------------------ADEVKG------
RLMKL_VIBVY       PCHQKNYTIAQRS-----------------------------------AEQIEG------
RLMKL_AERHH       ECQLRNYQIA--------------------------------------------------
RLMKL_AERS4       ECQLRNYQIA--------------------------------------------------
RLMKL_BUCAI       NCIQKNFLIF--------------------------------------------------
RLMKL_BUCAP       YCTLKNYEIF--------------------------------------------------
RLMKL_SHIFL       DCVQKNYHVA--------------------------------------------------
RLMKL_SHIF8       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOLI       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOHS       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOLC       DCVQKNYHVA--------------------------------------------------
RLMKL_ECODH       DCVQKNYHVA--------------------------------------------------
RLMKL_ECO57       DCVQKNYHVA--------------------------------------------------
RLMKL_ECO5E       DCVQKNYHVA--------------------------------------------------
RLMKL_ECO24       DCVQKNYHVA--------------------------------------------------
RLMKL_SHIDS       DCVQKNYHVA--------------------------------------------------
RLMKL_SHIB3       DCVQKNYHVA--------------------------------------------------
RLMKL_SHIBS       DCVQKNYHVA--------------------------------------------------
RLMKL_SHISS       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOSM       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOL5       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOUT       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOK1       DCVQKNYHVA--------------------------------------------------
RLMKL_ECOL6       DCVQKNYHVA--------------------------------------------------
RLMKL_SALA4       DCVQKNYHIA--------------------------------------------------
RLMKL_SALTY       DCVQKNYHIA--------------------------------------------------
RLMKL_SALDC       DCVQKNYHIA--------------------------------------------------
RLMKL_SALEP       DCVQKNYHIA--------------------------------------------------
RLMKL_SALHS       DCVQKNYHIA--------------------------------------------------
RLMKL_SALNS       DCVQKNYHIA--------------------------------------------------
RLMKL_SALPA       DCVQKNYHIA--------------------------------------------------
RLMKL_SALPK       DCVQKNYHIA--------------------------------------------------
RLMKL_SALPB       DCVQKNYHIA--------------------------------------------------
RLMKL_SALG2       DCVQKNYHIA--------------------------------------------------
RLMKL_SALCH       DCVQKNYHIA--------------------------------------------------
RLMKL_SALSV       DCVQKNYHIA--------------------------------------------------
RLMKL_SALTI       DCVQKNYHIA--------------------------------------------------
RLMKL_SALAR       DCVQKNYHIA--------------------------------------------------
RLMKL_CITK8       DCVQKNYHLA--------------------------------------------------
RLMKL_KLEP3       DCIQKNYHLA--------------------------------------------------
RLMKL_KLEP7       DCVQKNYHLA--------------------------------------------------
RLMKL_ENT38       DCVQKNYHLT--------------------------------------------------
RLMKL_CROS8       DCVQKNYRLA--------------------------------------------------
RLMKL_ERWT9       DCVQKNYQLA--------------------------------------------------
RLMKL_YERPG       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPY       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPA       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPN       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPE       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPP       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPS       DCVQKNYQLT--------------------------------------------------
RLMKL_YERP3       DCVQKNYQLT--------------------------------------------------
RLMKL_YERPB       DCVQKNYQLT--------------------------------------------------
RLMKL_YERE8       DCVQKNYQLA--------------------------------------------------
RLMKL_SERP5       DCVQKNYQLA--------------------------------------------------
RLMKL_PECAS       DCVQKNYQLA--------------------------------------------------
RLMKL_PHOLL       DCVQKNYLLS--------------------------------------------------
RLMKL_PROMH       DCVQKNYLLS--------------------------------------------------
RLMKL_SODGM       DCEQKNYLLAET------------------------------------------------
RLMKL_HAEIE       DCVQKNYQVSERK-----------------------------------SDAITDEKELE-
RLMKL_HAEIG       DCVQKNYQVSERK-----------------------------------SDAITDEKELE-
RLMKL_HAEIN       DCVQKNYQVSERK-----------------------------------SDAITDEKELE-
RLMKL_HAEI8       DCVQKNYQVSERK-----------------------------------SDEITAENELE-
RLMKL_HAES1       DCVQKNYHIAVRK-----------------------------------QVESAVENSQEK
RLMKL_HISS2       DCVQKNYHIAVRK-----------------------------------QVESAVENSQEK
RLMKL_ACTSZ       DCVQKNYRISDRS-----------------------------------SVQTDERAAENP
RLMKL_MANSM       DCIQKNYQISDRT-----------------------------------LSPENKSAVENA
RLMKL_PASMU       DCVQKNYHISARA-----------------------------------TAS-DENTQNSP
RLMKL_ACTPJ       DCLQKNYQISERT-----------------------------------AAEQQADELKF-
RLMKL_ACTP2       DCLQKNYQISERT-----------------------------------AAEQQADELKF-
RLMKL_ACTP7       DCLQKNYQISERA-----------------------------------VAEQQADELKF-
RLMKL_HAEDU       DCLQKNYQIAEYA-----------------------------------IHNQHISESSV-
RLMKL_PSYIN       ECVLKNYRISPKRPAVEVEPVAPKKTNKETPEP--INPWTMGQNESVVEAAIENESELVF
RLMKL_SHEB5       ECAFNIYTLHANSTRRDTP----------------------------------------V
RLMKL_SHEB9       ECAFNIYTLHANSTRRDTP----------------------------------------V
RLMKL_SHEB8       ECAFNIYTLHANSTRRDTP----------------------------------------V
RLMKL_SHEPC       ECAFNLYTLHANSTRRDTP----------------------------------------V
RLMKL_SHESW       ECAFNLYTLHANSTRRDTP----------------------------------------V
RLMKL_SHESM       ECAFNLYTLHAQSTRRDTP----------------------------------------V
RLMKL_SHESR       ECAFNLYTLHAQSTRRDTP----------------------------------------V
RLMKL_SHESA       ECAFNLYTLHAQSTRRDTP----------------------------------------V
RLMKL_SHEON       ECAFNLYTLHAQSTRRDTP----------------------------------------V
RLMKL_SHEDO       ECAFNLYTLHANSTRRDAP----------------------------------------V
RLMKL_SHEFN       ECAFNIYTLHANSTRRDVP----------------------------------------E
RLMKL_SHEHH       ECAFNLYTVHALNTRRVDPA--------------------------------------NI
RLMKL_SHEPA       ECAFNLYTVHAENTRRVDPA--------------------------------------NI
RLMKL_SHESH       ECAFNLYTVHAENTRRVDPS--------------------------------------KI
RLMKL_SHEWM       ECAFNLYTVHATNTRRVDPS--------------------------------------NI
RLMKL_SHELP       ECAFNLYTLHANSTRRLDPS--------------------------------------QV
RLMKL_SHEAM       ECAFNLYTLHATSTRRDIPV--------------------------------------DT
RLMKL_IDILO       PVNLALYDLTK-------------------------------------------------
RLMKL_FRATF       LYQFKINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRATH       LYQFKINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRATO       LYQFKINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRATW       LYQFEINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRATT       LYQFEINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRAT1       LYQFEINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRATM       LYQFEINEHAQFKHETQLEKNIRI------------------------------------
RLMKL_FRATN       LYQFEINEHAKFKHETQLEKNIRI------------------------------------
RLMKL_FRAP2       LYQFDINEHARFKHESQLEKNIRL------------------------------------
D0KZE4_HALNC      RGSFDGKARREAPGPIGLANRLCA------------------------------------
RLMKL_ACIBY       PIYVRFGTVKPEKVTQPFLANWQA------------------------------------
RLMKL_ACIBS       PIYVRFGTVKLEKVTQPFLANWQA------------------------------------
RLMKL_ACIBC       PIYVRFGTVKPEKVTQPFLANWQA------------------------------------
RLMKL_ACIAD       PIYIRLGQVKPVANSQPFLANWHA------------------------------------
RLMKL_PSYA2       TVYFRYGTLIA-GQTGNLVNRFEK------------------------------------
RLMKL_PSYCK       TVYFRYGTLIA-GQTGNLVSRFEK------------------------------------
RLMKL_PSYWF       TVYFRHGQLIR-KEGESLITRFEK------------------------------------
RLMKL_DESPS       ACRLSTGVFAEEEENS---FAWEI------------------------------------
G8QSR6_SPHPG      AHYYVFSDDERQAMIDRAIQKKA-------------------------------------
F0RUX4_SPHGB      AHYYVFTDEQRAQMIERAIERKK-------------------------------------
RLMKL_ALCBS       RLYSPRKQ------TPANVVKVA-------------------------------------
C8WGP0_EGGLE      ETEALVFDKPPMEAVKVVVPDPAGGAEH--------------------------------
F7V0X9_EEGSY      ATEVLVFDEAPRGTVTVVVPDSAGGAEH--------------------------------
E1QZ79_OLSUV      DATIRSYTAGNMAATRPQVSVADRNGRQ--------------------------------
C8W7K3_ATOPD      IATIRSYPAANAEGADSSATNAPVSSSKPTSVP--------------------AGPTVMV
F2N9W7_CORGP      DATISIFDAVGNTASTGENAGVRVTGSVDIGC----------------------------
C7N0P8_SLAHD      DTSLRIYDLGKAAARLSIPSLSGS------------------------------------
                                                                              

RLMKL_STRMK       --AQPRELSEGAQMVANRLRKNLKKFKSWRAREDITCFRAYDADLPEYAAAIDVYEEDGG
RLMKL_STRM5       --AQPRELSEGAQMVANRLRKNLKKFKSWRAREDITCFRAYDADLPEYAAAIDVYEEDGG
RLMKL_XANAC       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGIECFRAYDADLPEYSAAIDVYQQADG
RLMKL_XANC5       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGIECFRAYDADLPEYSAAIDVYQQADG
RLMKL_XANOM       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGVECFRAYDADLPEYSAAIDVYQQADG
RLMKL_XANOP       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGVECFRAYDADLPEYSAAIDVYQQADG
RLMKL_XANOR       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGVECFRAYDADLPEYSAAIDVYQQADG
RLMKL_XANCP       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGIECFRVYDADLPEYSAAIDVYQQADG
RLMKL_XANC8       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGIECFRVYDADLPEYSAAIDVYQQADG
RLMKL_XANCB       --AAPTALSEGAQMVANRLRKNLQKFKKWRAREGIECFRVYDADLPEYSAAIDVYQQADG
RLMKL_XYLF2       --GGAQALSEGAQMAANRLRKNVQRLKKWRIRAGVECYRVYDADLPEYAAAIDVYQEVDG
RLMKL_XYLFT       --GGAQALSEGAQMAANRLRKNVQRLKKWRIRAGVECYRVYDADLPEYAAAIDVYQEVDG
RLMKL_XYLFM       --GGAQALSEGAQMAANRLRKNVQRLKKWRIRAGVECYRVYDADLPEYAAAIDVYQEVDG
RLMKL_XYLFA       --GGAQALSEGAQMVANRLRKNVQRLKKWRMRAGVECYRVYDADLPEYAAAIDVYQEVDG
RLMKL_ALKEH       -------RSQGATALDNRLQKNHRHLRRWLRREGVKAYRLYDGDLPEYALAVDVYETES-
RLMKL_CHRSD       --SRPGPRNDGAQMFANRLEKNRKRLKKWLKQSGERCYRLYDADMPEYALAVDVY-----
RLMKL_MARHV       --MPRIANAERADMLRNRLKKNLKTIGQWARKQNIGCYRLYDADMPEYALAIDIY-----
RLMKL_PSEAE       ---EPARLSEGGQMFANRLQKNLRQLGKWARRDKIECYRLYDADMPEYALAVDIY-----
RLMKL_PSEA7       ---EPARLSEGGQMFANRLQKNLRQLGKWARRDKVECYRLYDADMPEYALAVDIY-----
RLMKL_PSEP1       -----ARLSEGAQMFANRLQKNLKQLGKWARREQIDCYRLYDADMPEYALAVDLY-----
RLMKL_PSEPK       -----ARLSEGAQMFANRLQKNLKQLGKWARREQIDCYRLYDADMPEYALAVDLY-----
RLMKL_PSEPG       -----ARLSEGAQMFANRLQKNLKQLGKWARREQIDCYRLYDADMPEYALAVDLY-----
RLMKL_PSEPW       -----ARLSEGAQMFANRLQKNLKQLGKWARKEQIDCYRVYDADMPEYALAVDLY-----
RLMKL_PSEE4       -----ARLSEGAQMFANRLQKNFKQLGKWARREQVDCYRVYDADMPEYALAVDLY-----
RLMKL_PSEF5       PVVEQARLSEGGQMFANRLQKNLKQLGKWAKREGIECYRVYDADMPEYSLAIDLY-----
RLMKL_PSEPF       PVIEQPRLSEGGQMFANRLQKNLKAMSKWVKREGIDCYRVYDADMPEYAMAIDLY-----
RLMKL_PSE14       VVVEQARLSEGGQMFANRLQKNLKLMGKWVRREGIDRYRVYDADMPEYSLAIDLY-----
RLMKL_PSEU2       VVVEQARLSEGGQMFANRLQKNLKLMGKWVRREGIDCYRVYDADMPEYSLAIDLY-----
RLMKL_PSESM       VVVEQARLSEGGQMFANRLQKNLKLLGKWVRREGIDCYRVYDADMPEYSLAIDLY-----
RLMKL_PSEMY       ---SQARLSEGGQMFANRLQKNLKQLGKWARREGVECYRLYDADMPEYALAVDLY-----
RLMKL_PSEU5       ---EQARLSEGGQMFANRLQKNLRQLGKWARREGIECYRLYDADMPEYALAVDLY-----
RLMKL_METCA       KARRGAIPAEQSEMFANRLRKNLRNLGTWARRNGVSCYRLYDADLPEFAVAVDIYQGEK-
RLMKL_PELCD       ---PQAPLSEGAIMFANRLRKNIKQLRRWLKKEDVTCYRLYDADMPEYAVAVDIYEDR--
RLMKL_ALLVD       RPLPPEERSPGAAMFANRLSKNLKALRKWRQRDGIDCLRIYDADLPEYALAIDLYEGER-
RLMKL_HYDCU       QLQPDLADTDNAKMVSNRIRKNMKGLKSWVKQNDISAYRVYDADIPEYALAIDLYDTLES
RLMKL_CELJU       KEEQAAALSNGAQMLVNRLQKNRKQLEKWARKNEVSCYRLYDADMPEYAAAIDLYLGQTP
RLMKL_SACD2       KNLCDKPLTEAATMVANRIKKNLKRLKKSVKQNDWHGYRVYDADMPEYSAAIDLYNDQV-
RLMKL_MARMS       -----SVMTPGAQMFANRLQKNAKKLKKWVEKNKIQCYRVYDADMPEYSVAIDIYGNWA-
RLMKL_LEGPC       -------LSDNAQMLFNRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYA-
RLMKL_LEGPA       -------LSDNAQMLFNRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYA-
RLMKL_LEGPH       -------LSDNAQMLFNRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYA-
RLMKL_LEGPL       -------LSDNAQMLFNRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYA-
RLMKL_HAHCH       ------GISEQAQMFRNRLSKNLAKWSKWAKKQQLSAYRIYDADMPEYAVAIDWYDGGI-
RLMKL_DICNV       ------GISEQAQMFANRLQKNIQKIRPSAERAQTDAYRIYDQDMPEYAVAIDCYGDAV-
RLMKL_MAGMM       --------PENAQMFANRLKKNQKRLKKWVTRENVRCYRLYDADMPEYALAVDRYE----
RLMKL_ALTMD       SEDAG------NHEFANRLKKNLKRMKGWVKSANTNCYRIYDADLPDYNVAVDRYGD---
RLMKL_PSEA6       ETSLS------NNDFANRLNKNIKRLSKWLKSENTNCYRIYDADLPEYNVAIDRYGD---
RLMKL_COLP3       AINPQSDFAEEDSAFANRLKKNRKNLKGWLKSNEIEAYRLYDGDIPEYNVAIDIYGE---
RLMKL_PSEHT       TDDKKALNFEGSMSFANRLKKNKQGLKNWLKQNEITAYRVYEADIPEYNVAVDIYGD---
RLMKL_ALIF1       -----AVSIEVAPEFMNRLKKNIGKIGKWARKEKLDCYRIYDADLPDYNAAIDVYKD---
RLMKL_ALIFM       -----AVSVEVAPEFMNRLKKNIGKIGKWARKEKLDCYRIYDADLPDYNAAIDVYKD---
RLMKL_ALISL       -----AANIEVAPEFMNRLKKNLSKLGKWARKEKLDCYRLYDADLPDYNAAIDVYKD---
RLMKL_PHOPR       --EGHVEQENVAPDFANRLKKNITKLNKWAKKEGIDCYRIYDADLPNYNAAIDKYND---
RLMKL_VIBCH       ----GTQEILIAPDFANRLKKNFNKIGKWAKREGLDCFRLYDADLPEYNVAIDVYQD---
RLMKL_VIBC3       ----GTQEILIAPDFANRLKKNFNKIGKWAKREGLDCFRLYDADLPEYNVAIDVYQD---
RLMKL_VIBCB       ----ADTNVQIAPDFSNRLKKNIGKIGKWARKEKLDCYRIYDADLPEYNVAIDVYGD---
RLMKL_VIBPA       ----ADTNTQIAPDFSNRLKKNIGKIGKWARKEKLDCYRIYDADLPEYNVAIDVYGD---
RLMKL_VIBVY       ----ADGPLSIAPDFANRLKKNIGKIGKWAHKEQLDCYRIYDADLPEYNVAIDVYQD---
RLMKL_AERHH       -QDSVASQKEVAQDFANRLRKNLKTLEKWAQKENLDCYRLYDADLPEYNAAIDRYQD---
RLMKL_AERS4       -LDSVASQKEVAQDFANRLRKNLKTLEKWASKEGIDCYRLYDADLPEYNAAIDRYQD---
RLMKL_BUCAI       ----FKNSSITTNEFKDRLNKNFKKLKKWINSEKLESFRVYHADLPNYNIIVDVYDK---
RLMKL_BUCAP       ----LNKFNNTNKEYENRLEKNFKKLKKWNDLKEIECFRVYDSDLPNYKLIVDVYKK---
RLMKL_SHIFL       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_SHIF8       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOLI       ESTPDSKPAMVAEDYTNRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOHS       ESTPDSKPAMVAEDYTNRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOLC       ESTPDSKPAMVAEDYTNRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECODH       ESTPDSKPAMVAEDYTNRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECO57       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECO5E       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECO24       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_SHIDS       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQDGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_SHIB3       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYSD---
RLMKL_SHIBS       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYSD---
RLMKL_SHISS       ESTPDSKPAMVAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOSM       ESTPDSKPAMAAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOL5       ESTPDSKPAMAAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOUT       ESTPDSKPVMAAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOK1       ESTPDSKPVMAAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_ECOL6       ESTPDSKPVMAAEDYANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_SALA4       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALTY       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALDC       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALEP       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALHS       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALNS       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALPA       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALPK       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALPB       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALG2       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALCH       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALSV       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALTI       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_SALAR       ETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGD---
RLMKL_CITK8       EKTPDSKPATVAEDYANRLRKNIKKLEKWARQEGIECYRLYDADLPEYNVAVDRYGE---
RLMKL_KLEP3       ESEG-GKPAMLAEDFANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAIDRYGD---
RLMKL_KLEP7       ESEG-GKPAMLAEDFANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAIDRYAD---
RLMKL_ENT38       EKEGDSKPSTVAEDYANRLRKNLKKFEKWAKQEGIECYRLYDADLPEYNVAVDRYAD---
RLMKL_CROS8       PTQPGAAPAQIAEDYANRLRKNLKKLEKWAKQEGIECYRLYDADLPDYNVAVDRYAD---
RLMKL_ERWT9       ENPTGAPAGQLAEDYANRLRKNVKKLDKWARQEGIQCYRVYDADLPDYNVAVDRYGD---
RLMKL_YERPG       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPY       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPA       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPN       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPE       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPP       ANPLGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPS       ANPQGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERP3       ANPQGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERPB       ANPQGAGGALVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_YERE8       ANPQGAVGVQVAEDYANRLRKNVKKLDKWAKQQGIECYRLYDADLPDYNVAVDRYGS---
RLMKL_SERP5       ENPLGAGGVQVAEDFANRLRKNLKKLDKWAKQQGIECYRLYDADLPEYNVAVDRYGS---
RLMKL_PECAS       DTQ-GESAGQIAEDFANRLRKNLRKLEKWAKQQGIECYRIYDADLPEYNVAVDRYGS---
RLMKL_PHOLL       DKP-HSSEVNVAEDYANRLRKNEKKLAHWAKQQGIDCYRLYDADLPEYNVAVDRYAD---
RLMKL_PROMH       ETP-STINTRLAEDFANRLRKNEKKLAKWAKQQQIECYRLYDADLPEYNVAVDRYGE---
RLMKL_SODGM       ATAPGSVEGQIATDFANRLRKNVRSLQKWVEREKLDCYRLYDADLPEYNVAIDRYSS---
RLMKL_HAEIE       ----FNRTSEVAPDFANRLQKNIKKISKWAKQQELDAYRLYDADLPEYNLAVDRYAD---
RLMKL_HAEIG       ----FNRTSEVAPDFANRLQKNIKKISKWAKQQELDAYRLYDADLPEYNLAVDRYAD---
RLMKL_HAEIN       ----FNRTSEVAPDFANRLQKNIKKISKWAKQQELDAYRLYDADLPEYNLAVDRYAD---
RLMKL_HAEI8       ----FNRTSEVATDFANRLQKNIKKISKWAKQQGLDAYRLYDADLPEYNLAVDRYAD---
RLMKL_HAES1       TLTFVSENTQVAQDFANRLRKNIKKIDKWANQQKLDAYRLYDADLPEYNLAVDRYAD---
RLMKL_HISS2       TLTFVSENTQVAQDFANRLRKNIKKIDKWANQQKLDAYRLYDADLPEYNLAVDRYAD---
RLMKL_ACTSZ       AVSADSAHTDVATDFANRLQKNIKKIEKWAQQQGLDAYRLYDADLPDYNLAVDRYGD---
RLMKL_MANSM       GEFKPNA--NVATDFANRLQKNIKKIEKWAKQEGIEAYRLYDADLPDYNLAVDHYGD---
RLMKL_PASMU       EIDRTLTSSQVAVDFANRLQKNSKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDD---
RLMKL_ACTPJ       -----EQNAQVAPDFANRLAKNIKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDD---
RLMKL_ACTP2       -----EQNAQVAPDFANRLAKNIKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDD---
RLMKL_ACTP7       -----EQNAQVAPDFANRLTKNIKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDD---
RLMKL_HAEDU       -----AQNTQVAPDFANRLTKNIKKIEKWAKQQQLDAYRLYDADLPEYNFAVDRYSD---
RLMKL_PSYIN       KEVQQIKPAIYAEEFANRLLKNLKQLEKWAKREGVECYRLYDADLPEYNVAIDRYAE---
RLMKL_SHEB5       LPDGVD-IADIAPAFANRIKKNAKLLEKWAKKEGIDSYRIYDADIPEYNVAVDKYLD---
RLMKL_SHEB9       LPDGVD-IADIAPAFANRIKKNAKLLEKWAKKEGIDSYRIYDADIPEYNVAVDKYLD---
RLMKL_SHEB8       LPDGVD-IADIAPAFANRIKKNAKLLEKWAKKEGIDSYRIYDADIPEYNVAVDKYLD---
RLMKL_SHEPC       LPEGVD-IADIAPAFANRIKKNAKQLEKWAQKEGIDSYRIYDADIPEYNVAVDKYLD---
RLMKL_SHESW       LPEGVD-IADIAPAFANRIKKNAKQLEKWAQKEGIDSYRIYDADIPEYNVAVDKYLD---
RLMKL_SHESM       LPEGVD-IADIAPAFANRIKKNAKQLEKWAKKEGIDSYRLYDADIPEYNVAVDRYLD---
RLMKL_SHESR       LPEGVD-IADIAPAFANRIKKNAKQLEKWAKKEGIDSYRLYDADIPEYNVAVDRYLD---
RLMKL_SHESA       LPEGVD-IADIAPAFANRIKKNAKQLEKWAKKEGIDSYRLYDADIPEYNVAVDRYLD---
RLMKL_SHEON       LPEGVD-IADIAPAFANRIKKNAKQFEKWAQKEGIDSYRLYDADIPEYNVAVDKYLD---
RLMKL_SHEDO       LPEGVDDIADIAPAFANRIKKNVKTLGKWAKKEGIDSYRLYDADLPEYNVAIDKYVD---
RLMKL_SHEFN       LPEGVD-IIDIAPAFANRIKKNVKQFEKWAKKERIDSYRLYDADLPEYNVAIDRYVD---
RLMKL_SHEHH       KIEG-D-VSDIAVPFANRIKKNFKQLEKWAKKEGIDSYRLYDADIPEYNVAIDKYLD---
RLMKL_SHEPA       KIEG-D-VSDIAVPFANRIKKNFKQLEKWAKKEGIDSYRLYDADLPEYNVAVDKYLD---
RLMKL_SHESH       NRDG-D-VSDIAVPFANRVKKNFKQLQKWAKKEGVDSYRIYDADLPDYKVAIDKYLD---
RLMKL_SHEWM       NREG-D-VSDIAVPFVNRVKKNIKQLQKWAKKEGIDSYRIYDADLPDYKVAIDKYLD---
RLMKL_SHELP       LSQGGE-VSEVATAFSNRIKKNHKQLSKWAQREGIDSYRLYDADIPEYNVAVDIYLD---
RLMKL_SHEAM       TGQGGE----IAAPFANRLKKNLKQLEKWAKREGIDSYRLYDADIPEYNVAVDRYLD---
RLMKL_IDILO       --EQPDFAESQADDLVNRVKKNHAKLSKWANKEGLDCWRVYDADIPEYNAAIDIYQD---
RLMKL_FRATF       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATH       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATO       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATW       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATT       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRAT1       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATM       -AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGFECYRLYDADIPTFAVAVDVYSEHI-
RLMKL_FRATN       -AEASVQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYGEHI-
RLMKL_FRAP2       -AEASALKSDEHIDFSNKLKKNLKNLKPWLKQSGVECYRLYDADIPTFAVAVDIYGEHV-
D0KZE4_HALNC      -AAEQARALVDAAPFANRLQKNYRHLKKLAEREGWCCFRVYDADLPDFNCAVDLYRDEAG
RLMKL_ACIBY       -QPVEMEE---AQDFANRLQKNMTALKKWATKENIYCLRLYDADLPDFNLAVDLYGDRL-
RLMKL_ACIBS       -QPVEMEE---AQDFANRLQKNMTALKKWATKENIYCLRLYDADLPDFNLAVDLYSDRL-
RLMKL_ACIBC       -QPVEMEE---AQDFANRLQKNMTALKKWATKENIYCLRLYDADLPDFNLAVDLYGDRL-
RLMKL_ACIAD       -DPVEIEG---AQDFANRLQKNMSALKKWAVKDQVFCLRLYDADLPDFNVAVDLYGDRL-
RLMKL_PSYA2       -REIEVED---GQDFINRLQKNLTRLKKLAKKDNVSNIRVYNADLPDFKVAIDLYGDYA-
RLMKL_PSYCK       -REIEVED---GQDFINRLQKNLTRLKKLAKKDNVSNIRVYNADLPDFKVAIDLYGDYA-
RLMKL_PSYWF       -TEIKVDE---AQDFVNRLQKNVNHLKKLAAKEDVTNLRVYDADLPDYKVAIDVYGDYV-
RLMKL_DESPS       -QQVEVQED--ALQFANRFKKNLKKYLKWAKKENISCFRVYDRDLQEFNLSVDLYEKWI-
G8QSR6_SPHPG      -ERLAQPLSDGAQMAYNRLKKNLDRIVPIMEKQGVTCYRIYDADMPEYSAAIDLYENKY-
F0RUX4_SPHGB      -ERLALPLSDGAQMAYNRLVKNLANLKPIMEKQGVTCYRIYDADMPEYSAAIDLYENRY-
RLMKL_ALCBS       -DDSAFNVPEGAQPLLNRLRKNGKHLRRWLEREDIQCYRLYDRDLPEFNVAVDIYADQ--
C8WGP0_EGGLE      ---VVEVLEPTSEQFAARLRKTAKERRKWARREGVSCYRVYDADLPDYAVAIDVYPGAG-
F7V0X9_EEGSY      ---RVDVLESSSEQFAARLRKVAKERRKWARREGVSCYRVYDADLPDYAVAIDVYPGAG-
E1QZ79_OLSUV      --VGVPVFVEASDQFAARLSKVYRQRRKWAQREDVSCYRIYDADLPDYAVTIDLFQGSEL
C8W7K3_ATOPD      NNQPVSVLVPASDQFAARLTKVAKQRAKWARKNDVSCYRVYDADLPDYAVSIDIYKGA--
F2N9W7_CORGP      -GAPIPILVPGSEHLAHRLKKVARLRRRWAARTGVSSYRVYDADLPDYAASIDLYTAAE-
C7N0P8_SLAHD      -DSVVPVAEGASEQFAARFRKVAKERAKWARKAGVHSYRVYDADLPEYAFSVDVFRSAE-
                                   :. *                 * *. *:  :   :* :     

RLMKL_STRMK       -----KRRTFLHVQEYAAPAAIPENDVRRRRNELLAAAREVFGVPPEQVSMKSRERGKGG
RLMKL_STRM5       -----QRRTFLHVQEYAAPAAIPENDVRRRRNELLAAAREVFGVPPEQVSMKSRERGKGG
RLMKL_XANAC       -----DRRIFLHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANC5       -----DRRIFLHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANOM       -----DRRIFLHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANOP       -----DRRIFLHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANOR       -----DRRIFLHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANCP       -----DRRIFLHVQEYAAPATIPEADVRRRLGELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANC8       -----DRRIFLHVQEYAAPATIPEADVRRRLGELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XANCB       -----DRRIFLHVQEYAAPATIPEADVRRRLGELLAAAREVFEVPAERVALKSRERGKGG
RLMKL_XYLF2       -----ARRLFLHVQEYAAPASIPEGDVRRRRHELLAAVRAVFDVSVAQVALKTRQRGKGG
RLMKL_XYLFT       -----ARRLFLHVQEYAAPASIPEGDVRRRRHELLAAVRAVFDVSVAQVALKTRQRGKGG
RLMKL_XYLFM       -----ARRLFLHVQEYAAPTSIPEGDVRRRRHELLAAVRAVFDVSVAQVALKTRQRGKGG
RLMKL_XYLFA       -----ARRLFLHVQEYAAPASIPEGDVRRRRHELLAAVRAVFDVSVAQVALKTRQRGKGG
RLMKL_ALKEH       -------GRHAHVQEYQAPRSVDPRSARRRLREALEVIAAHLEVGPERVHLKVRRRQKGA
RLMKL_CHRSD       -------GDRVHVQEYAPPRSVDPRQAQRRLLDALEVIPQVLGVRPESVHYKQRTRQAGK
RLMKL_MARHV       -------EGRVHVQEYLAPKSVDEKAARERLAEAMAVIPEVLEVAPEDLVCKQRQRQTGT
RLMKL_PSEAE       -------GDWVHVQEYAAPKSIDPAKAQARLFDALAAIPQTLGVAQERVVVKRRERQAGK
RLMKL_PSEA7       -------GDWVHVQEYAAPKSVDPAKAQARLFDALAAIPQALGVAQERVVVKRRERQAGK
RLMKL_PSEP1       -------QDWVHVQEYAAPRSVDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGT
RLMKL_PSEPK       -------QDWVHVQEYAAPRSVDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGT
RLMKL_PSEPG       -------QDWVHVQEYAAPRSIDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGT
RLMKL_PSEPW       -------QDWVHVQEYAAPRSIDPEKAQARLIDALSAIPQALGVDPQRVVLKRRERQSGT
RLMKL_PSEE4       -------QDWVHVQEYAAPRSVDPDKAQVRLLDALAAIPQALGIDPQRVVLKRRERQSGT
RLMKL_PSEF5       -------QDWVHVQEYAAPKSVDPEKAQARLFDALAAIPQALNVDKSRVVIKRRERQSGT
RLMKL_PSEPF       -------HDWVHVQEYAAPKSIDPEKASIRMFDALAAIPQALNIDKSRVVVKRRERQSGT
RLMKL_PSE14       -------HDWVHVQEYAAPKSIDPEKASARLFDALAAIPQALNIDKNRVVIKRRERQSGT
RLMKL_PSEU2       -------HDWVHVQEYAAPKSIDPEKASARLFDALAAIPQALNIDKNRVVIKRRERQSGT
RLMKL_PSESM       -------HDWVHVQEYAAPKSIDPEKASARLFDALAAIPQALNIDKSRVVIKRRERQSGT
RLMKL_PSEMY       -------RDWVHVQEYAAPRSVDPDKAQARLLDALAAIPQALGVAQSRVAIKRRERQTGT
RLMKL_PSEU5       -------RDWVHVQEYAPPRSIDPDKAQARLLDALAAIPQALGIAREKVVVKRRERQSGT
RLMKL_METCA       --------LWVHVQEYEAPASVDPAKAQSRLAGAVAMIPEVLEVPREQIFLKVRRRQKGD
RLMKL_PELCD       ----------VHVQEYQAPASVDSRQAERRLREVMRVLPEVLQVEPEAITLKVRRKQKGS
RLMKL_ALLVD       --------RWVHVQEYAAPPSVDPKRARQRLREALGLIPEVLEVPGEQVFLKVRRQQKGR
RLMKL_HYDCU       -------GLWVVVAEYAPPKTVNPTKAKRRLYEAMSVLPSVFNVSPERIVFKVRSQQKGQ
RLMKL_CELJU       PN--RAPQLYAHVQEYAAPKSVDEARAAQRFADIEAAVPYALDIPVSHISYKQRRRNKGS
RLMKL_SACD2       -----------HIQEYAAPKTIDADKAEARFETLKHGAAVALQAPDNKLFVKTRKRNKGK
RLMKL_MARMS       -----------HVQEYQAPKSIDPEKAKQRLFEVMSAIPTALNISESNVILKQRQRQTGK
RLMKL_LEGPC       -----------VLQEYAPPASIPVHKAEKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGS
RLMKL_LEGPA       -----------VLQEYAPPASIPVHKAEKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGS
RLMKL_LEGPH       -----------VLQEYAPPASIPVHKAEKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGS
RLMKL_LEGPL       -----------VLQEYAPPASIPVHKAEKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGS
RLMKL_HAHCH       -----------IVQEYAPPKSVDEEKARQRLLDVLEVTPAVLGIDGGQLFLKQRKKQKGM
RLMKL_DICNV       -----------VIQEYAPPKTIDPQKAQQRLFDVLQVVPEVLALDERSVFLKTRQRQTGK
RLMKL_MAGMM       --------EWVVVQEYQAPSSIPDADAHRRLQDACSVLPEVLGVPPERVVVKQRKRQKGY
RLMKL_ALTMD       ---------WLVVQEYAPPKTVSEDKARKRLQEVLLHLPAVTGVSPKNIALKVRAQQKGS
RLMKL_PSEA6       ---------WLVVQEYAAPKNVPEAKAKRRLHEVIVALPQVVDVPAEQIVMKVRAQQKGK
RLMKL_COLP3       ---------YLVIQEYAAPKTIEEDKAKKRLQEVIYWAPKVLNIPTDKVILKTRAKQRGA
RLMKL_PSEHT       ---------SAVIFEYAAPKEIDEKTSEKRLQDVISLTAEQLKIAPENIAVKVRKKQKGE
RLMKL_ALIF1       ---------YIIIQEYAAPKTISEDKARRRLTDMIRATVLVTGVETNNVILKVRQKQSGK
RLMKL_ALIFM       ---------YIIIQEYAAPKTISEDKARRRLTDMIRATVLVTGVETNNVILKVRQKQSGK
RLMKL_ALISL       ---------YIIIQEYTAPKEISEDKARRRLTDMIRATVLVTGVETNNVILKVRQKQSGK
RLMKL_PHOPR       ---------YLIIQEYAAPKTVPEEIARRRIMDVLRATIEVTGVQTDKVILKVRERQKGK
RLMKL_VIBCH       ---------HLMIQEYAAPKDIPEEKAKRRLTDIIRAAIQVLDVDANNVVLKVRERQKGT
RLMKL_VIBC3       ---------HLMIQEYAAPKDIPEEKAKRRLTDIIRAAIQVLDVDANNVVLKVRERQKGT
RLMKL_VIBCB       ---------QIVIQEYAAPKNIPEEKAKRRLTDIIRATIQVTGVEANKVVLKVREKQKGL
RLMKL_VIBPA       ---------QIVIQEYAAPKNIPEEKAKRRLTDIIRATIQVTGVEANKVVLKVREKQKGR
RLMKL_VIBVY       ---------HLVIQEYAAPKNIPEEKAKRRLTDIIRAAIQVTGVEANKVVLKVREKQKGR
RLMKL_AERHH       ---------YLVVQEYAAPKDIPAQKTRQRLLDMVQAAIKVTGMDGEKVILKVRERQEGK
RLMKL_AERS4       ---------YLVVQEYAAPKDIPAQKTRQRLLDMVQAAIKVTGMDGEKVILKVRERQEGK
RLMKL_BUCAI       ---------WVVIQEYQAPKSIDHNKAFKRLCDAIYYTKEVLSISINNIVLKTRIKNKNK
RLMKL_BUCAP       ---------WLVIQEYQAPKSINYEKAHKRLCSAIYHSKEILSIPTNNVVIKFRKKQKRK
RLMKL_SHIFL       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERHKGK
RLMKL_SHIF8       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERHKGK
RLMKL_ECOLI       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOHS       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOLC       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECODH       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECO57       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECO5E       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECO24       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_SHIDS       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_SHIB3       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_SHIBS       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_SHISS       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOSM       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOL5       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOUT       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOK1       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_ECOL6       ---------WVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGK
RLMKL_SALA4       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALTY       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALDC       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALEP       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALHS       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALNS       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALPA       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALPK       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALPB       ---------RAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALG2       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALCH       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALSV       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALTI       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_SALAR       ---------WAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLKTRERQKGK
RLMKL_CITK8       ---------WVVIQEYAPPKTVDAQKARQRLFDIIAATLLVLEIAPNKLVLKTRERQKGK
RLMKL_KLEP3       ---------WVVVQEYAPPKTVDAHKARQRLFDIIAATIAVLEIAPNKLVLKTRERQKGK
RLMKL_KLEP7       ---------WVVVQEYAPPKTVDAHKARQRLFDIIAATIAVLDMAPNKLVLKTRERQKGK
RLMKL_ENT38       ---------WIVVQEYAAPKTIDAQKARQRLLDIIAATIGVLGIAPNKLVLKTRERQKGT
RLMKL_CROS8       ---------WVVIQEYAPPKTIEPEKARQRLFDVIAATLSVLGLAPNKLVLKTRERQKGK
RLMKL_ERWT9       ---------WVVIQEYAAPKTIDPAKARQRLFDVISATLSVLDLPANKLVLKTREKQKGK
RLMKL_YERPG       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPY       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPA       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPN       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPE       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPP       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPS       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERP3       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERPB       ---------KVVVQEYAPPKTIDPQKARQRLFDVINATLAVLELPSNQLVLKTRERQKGK
RLMKL_YERE8       ---------KVVVQEYAPPKTIDAQKARQRLFDVINATLAVLNLPSNQLVLKTRERQKGK
RLMKL_SERP5       ---------KVVVQEYAPPKTIDAQKARQRLFDVINATLAVLELPSNQLILKTRERQKGK
RLMKL_PECAS       ---------WVVVQEYAPPKTIDAQKARQRLFDVINATLIVLELPSNRLVLKTRERQKGK
RLMKL_PHOLL       ---------KVVIQEYAPPKSVDANKARQRLFDVISATMQVLGLSSNQLVLKTRQRQKGK
RLMKL_PROMH       ---------KVVIQEYAPPKTINEHKARQRLFDVISATMEVLALRSDQLILKTRQRQKGK
RLMKL_SODGM       ---------WVVIQEYVAPKSVDPERARQRLYDVINATLAVLAIPASRLVVKARERQKGK
RLMKL_HAEIE       ---------YIVVQEYAAPKNIDENKARQRLLDAVTATLQVTGVETNKLILKVRQKQKGT
RLMKL_HAEIG       ---------YIVVQEYAAPKNIDENKARQRLLDAVTATLQVTGVETNKLILKVRQKQKGT
RLMKL_HAEIN       ---------YIVVQEYAAPKNIDENKARQRLLDAVTATLQVTGVETNKLILKVRQKQKGT
RLMKL_HAEI8       ---------YIVVQEYAAPKNIDENKARQRLLDAVTATLHVTGVETNKLILKVRQKQKGT
RLMKL_HAES1       ---------HIIVQEYAAPKNVDENKARQRLLDAVSAILLVTGIETNKLILKVRQKQKGT
RLMKL_HISS2       ---------HIIVQEYAAPKNVDENKARQRLLDAVSAILSVTGIETNKLILKVRQKQKGT
RLMKL_ACTSZ       ---------HIVVQEYAAPKNIDENKTRQRLLDAVTATLAVTGVETSKLILKVRRKQKGS
RLMKL_MANSM       ---------HIVVQEYAAPKNIDENKARQRLLDAVTATLAVTGVETNKLILKVRQKQKGA
RLMKL_PASMU       ---------HIVVQEYAAPKNIDENKARQRLLDAVTATLQVTGVETNKLILKVRQKQKGT
RLMKL_ACTPJ       ---------HIVVQEYAAPKNIDEQKARQRLLDAVSATLYVTGVETNKLVLKVRQKQKGT
RLMKL_ACTP2       ---------HIVVQEYAAPKNIDEQKARQRLLDAVSATLYVTGVETNKLVLKVRQKQKGT
RLMKL_ACTP7       ---------HIVVQEYAAPKNIDEQKARQRLLDAVSATLYVTGVETNKLVLKVRQKQKGT
RLMKL_HAEDU       ---------HIVIQEYAAPKSIEQNKARQRLLDAVTATLHVTGIETNKLVLKVRQKQKGT
RLMKL_PSYIN       ---------YIIIQEYRAPKEIETQKVRRRFLDVVSTVRYVLNLPDDKLVIKVRERQKGR
RLMKL_SHEB5       ---------YVIIQEYMAPATIPEAVTKRRLSDVLLALPSAIGINPNKMIMKTRERQKGT
RLMKL_SHEB9       ---------YVIIQEYMAPATIPEAVTKRRLSDVLLALPSAIGINPNKMIMKTRERQKGT
RLMKL_SHEB8       ---------YVIIQEYMAPATIPEAVTKRRLSDVLLALPSAIGINPNKMIMKTRERQKGT
RLMKL_SHEPC       ---------YVIVQEYMAPATIPEAVTKRRLSDVLLALPAAIGINPNKIIMKTRERQKGT
RLMKL_SHESW       ---------YVIVQEYMAPATIPEAVTKRRLSDVLLALPAAIGINPNKIIMKTRERQKGT
RLMKL_SHESM       ---------HIVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVDPHKITMKTRERQKGT
RLMKL_SHESR       ---------HIVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVDPHKITMKTRERQKGT
RLMKL_SHESA       ---------HIVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVDPHKITMKTRERQKGT
RLMKL_SHEON       ---------YVVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVDPHKIIMKTRERQKGT
RLMKL_SHEDO       ---------YVVIQEYSAPATIPEAVTKRRLSDVLLALPNALGIHPDKITLKTRERQKGT
RLMKL_SHEFN       ---------YVVIQEYSAPATIPEAVTKRRISDVLLALPGALGIHPDRITLKTRERQKGA
RLMKL_SHEHH       ---------YVVIQEYSAPSEIPEAVTKRRLTDVLISLPSAIGIDPNHIILKTRERKKGT
RLMKL_SHEPA       ---------YVVIQEYSAPSQIPEAVTKRRLTDVLISLPSAIGIDPNHIILKTRERKKGT
RLMKL_SHESH       ---------YVVIQEYTAPVDIPESVTKRRLTDVLITLPSAIGIDPENIILKTRERQKGT
RLMKL_SHEWM       ---------YVVIQEYTAPVDIPESVTKRRLTDVLITLPGAIGIDPNNIILKTREKQKGT
RLMKL_SHELP       ---------HVVIQEYSAPKSIPEAVTKRRLTDVLLVLPQAIGVDPDKIILKTRERQKGT
RLMKL_SHEAM       ---------YVVVQEYAAPSAIPEAVTKRRLTDVLLALPRALGIDPDKIVLKTRERQKGT
RLMKL_IDILO       ---------YVVVQEYAAPKDIPEGVANDRLWFMLESLSSALPVSEDKIILKRRQRQSGK
RLMKL_FRATF       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATH       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATO       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATW       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATT       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRAT1       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATM       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRATN       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGK
RLMKL_FRAP2       -----------FLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIQYENIHTRVRQRQKGK
D0KZE4_HALNC      -------ETWADIQEYRAPNKIDPQLARARLSIIVEQVMENLSLAENHSVVRQRKRQTGT
RLMKL_ACIBY       -----------HVQEYAPPKKIDPEKAKKRFNLALAAIRAVTGLNRDAIFIKTRARQTGT
RLMKL_ACIBS       -----------HVQEYAPPKKIDPEKAKKRFNLALAAIRAVTGLNRDAIFIKTRARQTGT
RLMKL_ACIBC       -----------HVQEYAPPKKIDPEKAKKRFNLALAAIRAVTGLNRDAIFIKTRARQTGT
RLMKL_ACIAD       -----------HVQEYAPPKTIDPEKAKKRFNLALAAIRAVTGLPREAIFIKTRARQEGK
RLMKL_PSYA2       -----------HVQEYAPPKTIPPETAKKRFNLALMGIREVFGINREQIFIKTRARQSGN
RLMKL_PSYCK       -----------HVQEYAPPKTIPPETAKKRFNLALMGIREVFGINREQIFIKTRARQSGN
RLMKL_PSYWF       -----------HVQEWAPPKSIPPETARKRFNLALMGIREVFGINREQIFIKTRARQVGN
RLMKL_DESPS       -----------HVQEYLPPKTIDPDLASRRFNIALRAIREILGLRSDRVFIKKRQRQKGA
G8QSR6_SPHPG      ----------ISLQEYAAPSTIDVDDALKRLNELIDATERATGIERDMIFVKQRTQQRGD
F0RUX4_SPHGB      ----------ISLQEYAPPETIDPEDALRRLGELIDATERATGLDREQIYVRQRTQQKGE
RLMKL_ALCBS       ----------VLVQEFKAPKTIDPEKAKERRDWAVTAVRAALGVHREQVHLRTREKQKGN
C8WGP0_EGGLE      ---DAEGNLYLHIAEYAAPSTIDPGKAQRRYDDVLALAPVVLGVRPDHVFSKVRRRDKGG
F7V0X9_EEGSY      ---EASGNLYLHIAEYAAPSSIDPGKAQRRYDDVLALAPVVLGVRPDHVFSKVRRRDKGG
E1QZ79_OLSUV      MAPQGARRRWLQVYEYAAPKDVDATLARRRLLDVLAIAPRVLGVEPQDVFVRVRSHGRGG
C8W7K3_ATOPD      ----TKPTTWLQISEYAASKEIDPDLAKRRLLDVLALAPRILGVPSSNVNLRTRTRAKGG
F2N9W7_CORGP      ----ATAGRWLVISEYAAPATIEPDLARARFLDILQIASRVLDVEPEHVHARARVRSRGG
C7N0P8_SLAHD      -----DDGLLVRVEEHRAGSNVDADRANRRVFDGLAIVSAVLDVPRERVFCKRARQEKSR
                              : *  .   :       *                     :   :    

RLMKL_STRMK       SKYGR--------------------------------------------FEQRD-----E
RLMKL_STRM5       SKYGR--------------------------------------------FEQRD-----E
RLMKL_XANAC       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANC5       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANOM       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANOP       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANOR       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANCP       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANC8       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XANCB       SKYGR--------------------------------------------FEQRN-----E
RLMKL_XYLF2       SQYGC--------------------------------------------FAQRG-----E
RLMKL_XYLFT       SQYGC--------------------------------------------FAQRG-----E
RLMKL_XYLFM       SQYGC--------------------------------------------FAQRG-----E
RLMKL_XYLFA       SQYGC--------------------------------------------FAQRG-----E
RLMKL_ALKEH       DQYRP--------------------------------------------VDQTG-----E
RLMKL_CHRSD       AQYAK--------------------------------------------QDASG-----E
RLMKL_MARHV       RQYEK--------------------------------------------QAATG-----E
RLMKL_PSEAE       KQYER--------------------------------------------QSSEG-----K
RLMKL_PSEA7       KQYER--------------------------------------------QSSEG-----K
RLMKL_PSEP1       RQYER--------------------------------------------QATEG-----R
RLMKL_PSEPK       RQYER--------------------------------------------QATEG-----R
RLMKL_PSEPG       RQYER--------------------------------------------QATEG-----R
RLMKL_PSEPW       RQYER--------------------------------------------QATEG-----R
RLMKL_PSEE4       RQYER--------------------------------------------QATEG-----R
RLMKL_PSEF5       KQYER--------------------------------------------QSAQG-----Q
RLMKL_PSEPF       KQYER--------------------------------------------QAAQG-----K
RLMKL_PSE14       KQYER--------------------------------------------QSAQG-----Q
RLMKL_PSEU2       KQYER--------------------------------------------QSAQG-----Q
RLMKL_PSESM       KQYER--------------------------------------------QSAQG-----Q
RLMKL_PSEMY       KQYQR--------------------------------------------QAAQG-----Q
RLMKL_PSEU5       RQYER--------------------------------------------QASQG-----E
RLMKL_METCA       AQYVK--------------------------------------------QGQTA-----H
RLMKL_PELCD       SQYQK--------------------------------------------LDRSG-----E
RLMKL_ALLVD       AQYER--------------------------------------------LAETG-----R
RLMKL_HYDCU       DQYER--------------------------------------------LDEQK-----A
RLMKL_CELJU       SQYEK--------------------------------------------LNERP---TGD
RLMKL_SACD2       AQYEK--------------------------------------------QTDTQGFDAER
RLMKL_MARMS       EQYEK--------------------------------------------FDQTK-----H
RLMKL_LEGPC       EQYQK--------------------------------------------IGKTS-----Q
RLMKL_LEGPA       EQYQK--------------------------------------------IGKTS-----Q
RLMKL_LEGPH       EQYQK--------------------------------------------IGKTS-----Q
RLMKL_LEGPL       EQYQK--------------------------------------------IGKTS-----Q
RLMKL_HAHCH       LQYEK--------------------------------------------TDSSR-----K
RLMKL_DICNV       TQYNP--------------------------------------------AAEKRN----E
RLMKL_MAGMM       NQYDK--------------------------------------------MANRG-----Q
RLMKL_ALTMD       KQYEK--------------------------------------------INQSG-----E
RLMKL_PSEA6       SQYEK--------------------------------------------VSQKQ-----K
RLMKL_COLP3       NQYER--------------------------------------------LEKTK-----Q
RLMKL_PSEHT       EQYTP--------------------------------------------MAKQN-----R
RLMKL_ALIF1       NQYQK--------------------------------------------LAEKS-----R
RLMKL_ALIFM       NQYQK--------------------------------------------LAEKS-----R
RLMKL_ALISL       NQYQK--------------------------------------------LAEKS-----R
RLMKL_PHOPR       NQYQK--------------------------------------------LSNAE-----R
RLMKL_VIBCH       SQYEK--------------------------------------------LGQQA-----Q
RLMKL_VIBC3       SQYEK--------------------------------------------LGQQA-----Q
RLMKL_VIBCB       SQYQK--------------------------------------------LGQVS-----E
RLMKL_VIBPA       SQYQK--------------------------------------------LGQVS-----E
RLMKL_VIBVY       NQYQK--------------------------------------------LGQVS-----E
RLMKL_AERHH       QQYQK--------------------------------------------LSEEQ-----H
RLMKL_AERS4       QQYQK--------------------------------------------LAAEQ-----H
RLMKL_BUCAI       TQYKK--------------------------------------------LFNSN-----D
RLMKL_BUCAP       EQYQK--------------------------------------------LFNSN-----S
RLMKL_SHIFL       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SHIF8       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOLI       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOHS       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOLC       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECODH       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECO57       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECO5E       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECO24       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SHIDS       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SHIB3       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SHIBS       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SHISS       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOSM       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOL5       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOUT       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOK1       NQYQK--------------------------------------------LGEKG-----E
RLMKL_ECOL6       NQYQK--------------------------------------------LGEKG-----E
RLMKL_SALA4       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALTY       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALDC       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALEP       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALHS       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALNS       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALPA       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALPK       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALPB       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALG2       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALCH       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALSV       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALTI       NQYQK--------------------------------------------MSEKG-----E
RLMKL_SALAR       NQYQK--------------------------------------------MSEKG-----E
RLMKL_CITK8       SQYQK--------------------------------------------MNEKG-----E
RLMKL_KLEP3       NQYQK--------------------------------------------MAEKG-----D
RLMKL_KLEP7       NQYQK--------------------------------------------MAEKG-----D
RLMKL_ENT38       NQYQK--------------------------------------------MSDKG-----D
RLMKL_CROS8       NQYEK--------------------------------------------LAQKG-----E
RLMKL_ERWT9       SQYQK--------------------------------------------LGEKG-----D
RLMKL_YERPG       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPY       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPA       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPN       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPE       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPP       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPS       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERP3       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERPB       NQYEK--------------------------------------------LAQKG-----E
RLMKL_YERE8       NQYEK--------------------------------------------LAQKG-----E
RLMKL_SERP5       NQYEK--------------------------------------------LAQKG-----E
RLMKL_PECAS       NQYEK--------------------------------------------LAQKG-----D
RLMKL_PHOLL       SQYER--------------------------------------------MAEKQ-----E
RLMKL_PROMH       QQYEK--------------------------------------------MAEKG-----D
RLMKL_SODGM       SQYEK--------------------------------------------LAQKG-----E
RLMKL_HAEIE       NQYEK--------------------------------------------LANKG-----E
RLMKL_HAEIG       NQYEK--------------------------------------------LANKG-----E
RLMKL_HAEIN       NQYEK--------------------------------------------LANKG-----E
RLMKL_HAEI8       NQYEK--------------------------------------------LANKG-----E
RLMKL_HAES1       SQYEK--------------------------------------------LANKG-----E
RLMKL_HISS2       SQYEK--------------------------------------------LANKG-----E
RLMKL_ACTSZ       NQYEK--------------------------------------------LANKG-----E
RLMKL_MANSM       NQYEK--------------------------------------------LANKG-----E
RLMKL_PASMU       NQYEK--------------------------------------------LANKG-----D
RLMKL_ACTPJ       NQYEK--------------------------------------------LANKG-----D
RLMKL_ACTP2       NQYEK--------------------------------------------LANKG-----D
RLMKL_ACTP7       NQYEK--------------------------------------------LANKG-----D
RLMKL_HAEDU       NQYEK--------------------------------------------LANKG-----E
RLMKL_PSYIN       QQYEK--------------------------------------------LDTKK-----Q
RLMKL_SHEB5       SQYQK--------------------------------------------LDERK-----L
RLMKL_SHEB9       SQYQK--------------------------------------------LDERK-----L
RLMKL_SHEB8       SQYQK--------------------------------------------LDERK-----L
RLMKL_SHEPC       NQYQK--------------------------------------------LDERK-----L
RLMKL_SHESW       SQYQK--------------------------------------------LDERK-----L
RLMKL_SHESM       NQYQK--------------------------------------------LDERK-----L
RLMKL_SHESR       NQYQK--------------------------------------------LDERK-----L
RLMKL_SHESA       NQYQK--------------------------------------------LDERK-----L
RLMKL_SHEON       NQYQK--------------------------------------------LDERK-----L
RLMKL_SHEDO       NQYQK--------------------------------------------LAEKK-----L
RLMKL_SHEFN       NQYQK--------------------------------------------IDERK-----V
RLMKL_SHEHH       NQYEK--------------------------------------------LAASK-----L
RLMKL_SHEPA       NQYEK--------------------------------------------LVANK-----L
RLMKL_SHESH       NQYEK--------------------------------------------IQANK-----L
RLMKL_SHEWM       NQYEK--------------------------------------------IQANK-----L
RLMKL_SHELP       NQYQK--------------------------------------------LDATK-----L
RLMKL_SHEAM       NQYQK--------------------------------------------LDGEK-----L
RLMKL_IDILO       QQYER--------------------------------------------QSQDS-----T
RLMKL_FRATF       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATH       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATO       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATW       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATT       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRAT1       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATM       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRATN       EQYQK--------------------------------------------ENDKN-----K
RLMKL_FRAP2       EQYQK--------------------------------------------NNDRN-----N
D0KZE4_HALNC      EQYQK--------------------------------------------ITQER-----L
RLMKL_ACIBY       NQYTK--------------------------------------------QSTAN-----K
RLMKL_ACIBS       NQYTK--------------------------------------------QSTAN-----K
RLMKL_ACIBC       NQYTK--------------------------------------------QSTAN-----K
RLMKL_ACIAD       NQYTK--------------------------------------------QSTAS-----K
RLMKL_PSYA2       DQYSK------------------------QGN-----------------TEKRG-----K
RLMKL_PSYCK       DQYSK------------------------QGN-----------------TEKRG-----K
RLMKL_PSYWF       TQYGNPEASAQSKESKNAPEPKKDNRNRYKGNKFQQAREEAKRQEAQRLAQKKR-----K
RLMKL_DESPS       GQYQQ--------------------------------------------QGDRK-----K
G8QSR6_SPHPG      NQYEK--------------------------------------------LGQGS-----K
F0RUX4_SPHGB      KQYEK--------------------------------------------MASTD-----K
RLMKL_ALCBS       QQYQK--------------------------------------------LDAQG-----Q
C8WGP0_EGGLE      SQYRDSGRRS-------------------------------------------------Y
F7V0X9_EEGSY      GQYREARRRS-------------------------------------------------Y
E1QZ79_OLSUV      SQYASQAAGDKRDGRGMHGARAQHDGHDGRGIHA------------GRRGHAGRPTLSPG
C8W7K3_ATOPD      SQYSNEGSATDNSRK--------------------------------------------E
F2N9W7_CORGP      SQYGRRSTKAGGSVRDRTGAADR------------------------------------C
C7N0P8_SLAHD      PAAEPV------------------------------------------------------
                                                                              

RLMKL_STRMK       FIVVRENNALLQVNLFDYLDTGLFLDHRPLRRMMAEQVRGK----RFLNLFCYTGVASVQ
RLMKL_STRM5       FIVVRENNALLQVNLFDYLDTGLFLDHRPLRRMMAEQALGK----RFLNLFCYTGVASVQ
RLMKL_XANAC       IVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQCRGR----RFLNLFCYTGVASVE
RLMKL_XANC5       IVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSKGR----RFLNLFCYTGVASVE
RLMKL_XANOM       IVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSRGR----RFLNLFCYTGVASVE
RLMKL_XANOP       IVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSRGR----RFLNLFCYTGVASVE
RLMKL_XANOR       IVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSRGR----RFLNLFCYTGVASVE
RLMKL_XANCP       IVNVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSKGR----RFLNLFCYTGVASVQ
RLMKL_XANC8       IVNVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSKGR----RFLNLFCYTGVASVQ
RLMKL_XANCB       IVNVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQSKGR----RFLNLFCYTGVASVQ
RLMKL_XYLF2       FFHVCEHGALLRVNLFDYLDTGLFLDHRPLRGRMAREAVGK----RFLNVFCYTGVASVE
RLMKL_XYLFT       FFHVCEHGALLRVNLFDYLDTGLFLDHRPLRGRMAREAVGK----RFLNVFCYTGVASVE
RLMKL_XYLFM       FFHVCEHGALLRVNLFDYLDTGLFLDHRPLRGRMAREAVGK----RFLNVFCYTGVASVE
RLMKL_XYLFA       FFHVCEHGALLRVNLFDYLDTGLFLDHRPLRARMAREAVGK----RFLNVFCYTGVASVE
RLMKL_ALKEH       RWVVQEGPARFYINLSDYLDTGLFLDHRITRLRLGEQARGR----RFLNLFAYTGTATVH
RLMKL_CHRSD       RFEVSEGPARLWVNLRDYLDTGLFLDHRPVRRRLREMADGK----RFLNLFCYTGTATVQ
RLMKL_MARHV       YFNVHEHGCALKVNLKDYLDTGLFLDHRPVRYWIQQHARGK----RFLNLFCYTGAATVH
RLMKL_PSEAE       FLEVGEGDVRLLVNLTDYLDTGLFLDHRPMRLRIQKEAAGK----RFLNLFCYTATATVH
RLMKL_PSEA7       FLEVGEGGVRLLVNLTDYLDTGLFLDHRPMRLRIQKEAAGK----RFLNLFCYTATATVH
RLMKL_PSEP1       FQEVNEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAAGK----RFLNLFCYTATATVH
RLMKL_PSEPK       FQEVNEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAAGK----RFLNLFCYTATATVH
RLMKL_PSEPG       FQEVNEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAAGK----RFLNLFCYTATATVH
RLMKL_PSEPW       FQEVSEGGVRLLVNLTDYLDTGLFLDHRPMRMRIQREAAGK----RFLNLFCYTATASVH
RLMKL_PSEE4       FQEVTEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAVGK----RFLNLFCYTATATVH
RLMKL_PSEF5       FTEVREGGIKLLVNLTDYLDTGLFLDHRPMRMRIQQEAAGK----RFLNLFCYTATASVH
RLMKL_PSEPF       FNEVTEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQKEAAGK----RFLNLFCYTATASVH
RLMKL_PSE14       FLEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREASGK----RFLNLFAYTATASVH
RLMKL_PSEU2       FLEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREASGK----RFLNLFAYTATASVH
RLMKL_PSESM       FLEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREAAGK----RFLNLYAYTATASVH
RLMKL_PSEMY       FMEVSEGGVKLLVNLTDYLDTGLFLDHRPLRLRIQREAAGK----RFLNLFCYTATATVH
RLMKL_PSEU5       FLEVSEGGVKLLVNLTDYLDTGLFLDHRPLRLRIQREAAGK----RFLNLFCYTATATVH
RLMKL_METCA       FHVVEEGGWRFWVNFEDYLDTGLFLDHRITRGLIQQVARDR----HFLNLFAYTGTATVY
RLMKL_PELCD       RFEVREGNCWFLVNLTDYLDTGLFLDHRPTRFMLQAMAEGK----SFLNLFAYTGTATVH
RLMKL_ALLVD       FHEVSEYGLRFLVNFEDYLDTGLFLDHRDVRRLIGSLSDGK----RFLNLFAYTGTATVH
RLMKL_HYDCU       FFTIVENQTRLRVNFTDYLDTGIFLDHRQVRQEVAKLAAGK----RLLNLFCYTATATAE
RLMKL_CELJU       LFSVQEGQAKLHINLWQYLDTGLFLDHRPVRHMIANMARDK----RFLNLFCYTATASVH
RLMKL_SACD2       CIQVQEGNAKLWVNLQDYLDTGLFLDHRPLRMRIHKEATGK----RFLNLFCYTATASVQ
RLMKL_MARMS       EMIVEEYGCEFIVNLKDYLDTGLFLDHRPVRKLIQDKANGV----RFLNLFCYTATASVH
RLMKL_LEGPC       RLIVTEGKAKLIVNLYDYLDTGLFLDHRLMRLKFAQLEPGT----RFLNCFCYTASASVH
RLMKL_LEGPA       RLIVTEGKAKLIVNLYDYLDTGLFLDHRLMRLKFAQLEPGT----RFLNCFCYTASASVH
RLMKL_LEGPH       RLIVTEGKAKLIVNLYDYLDTGLFLDHRLMRLKFAQLEPGT----RFLNCFCYTASASVH
RLMKL_LEGPL       RQIVTEGKAKLIVNLYDYLDTGLFLDHRLMRLKFAQLEQGT----RFLNCFCYTASASVH
RLMKL_HAHCH       ERTVEEHGCRFWVNLSDYLDSGLFLDHRPTRYWIQKHSSGK----RFLNLFCYTGAASVH
RLMKL_DICNV       ERIVYEGAARFLVNLSDYLDTGLFLDHRPMRRLLFEQAAGK----RVLNLFCYTATASVQ
RLMKL_MAGMM       KVLVAEQGLNFEVNLTDYLDTGLFPDHAPMRRRIQQEAANR----RFLNLFCYTGTATVH
RLMKL_ALTMD       MMEVFENGARFLVNLTDYLDTGLFLDHRNTRQKVKALSQGK----DVLNLFSYTGSVSVF
RLMKL_PSEA6       MLEVFENGAKFKLNLTDYLDTGLFLDHRVTRQLVQQRVKDK----DVLNLFAYTGSVSVH
RLMKL_COLP3       SLTINEHGALFKINLWDYLDTGLFLDHRKTRQIVAKKSQGK----SLLNLFAYTGSVSVQ
RLMKL_PSEHT       TMVVEEFGAKFKVNLFDYLDTGLFLDHRLMRRYIQENAKDK----RFLNLFAYTGTASVH
RLMKL_ALIF1       YFDVEEYGVKLIVNLQDYLDTGLFLDHKLTRKMLGEIAAGK----DFLNLFAYTGSATVH
RLMKL_ALIFM       YFDVEEYGVKLIVNLQDYLDTGLFLDHKLTRKMLGEMAAGK----DFLNLFAYTGSATVH
RLMKL_ALISL       YFDVEEYGVKLIVNLQDYLDTGLFLDHKLTRKMIGDMAAGK----DFLNLFAYTGSATVH
RLMKL_PHOPR       HIIVNEYGVDLKVNLYDYLDTGLFLDHRITRKMLGDMAKGK----DFLNLFAYTGSASVH
RLMKL_VIBCH       TMQITEYGVKLIVNLYDYLDTGLFLDHKITRRRLGQMAQGK----DFLNLFAYTGSATVH
RLMKL_VIBC3       TMQITEYGVKLIVNLYDYLDTGLFLDHKITRRRLGQMAQGK----DFLNLFAYTGSATVH
RLMKL_VIBCB       TLEVNEYGVKLIVNLHDYLDTGLFLDHKITRRRLGEMAQGK----DFLNLFAYTGSATVH
RLMKL_VIBPA       TLEVNEYGVKLIVNLHDYLDTGLFLDHKITRRRLGEMAQGK----DFLNLFAYTGSATVH
RLMKL_VIBVY       RMEVNEYGAKLIVNLYDYLDTGLFLDHKITRRRLGEMAKGA----DFLNLFAYTGSATVH
RLMKL_AERHH       RMEVQEYGARLWVNLYDYLDTGLFLDHRQTRRMLGQMAKGK----RFLNLFAYTGSATVH
RLMKL_AERS4       RMEVQEYGARLWVNLYDYLDTGLFLDHRQTRRMLGQMAKGK----RFLNLFAYTGSATVH
RLMKL_BUCAI       FITIKEYHAKFLVNLTDYVDTGLFSDKRLVRKLLGVLAKGK----DFLNLFSYTGTATVY
RLMKL_BUCAP       FFIIREYHVKLLVNLIDYLDTGLFSEHRLVRKLIGSMSKGK----DFLNLFSYTGAASVY
RLMKL_SHIFL       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SHIF8       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOLI       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOHS       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOLC       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECODH       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECO57       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECO5E       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECO24       FLEVTEYNAHLLVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SHIDS       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SHIB3       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SHIBS       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SHISS       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOSM       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOL5       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOUT       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOK1       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_ECOL6       FLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSATVH
RLMKL_SALA4       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALTY       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALDC       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALEP       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALHS       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALNS       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALPA       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALPK       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALPB       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALG2       FLDVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALCH       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALSV       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALTI       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFSYTGSASVH
RLMKL_SALAR       FLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSQGK----DFLNLFSYTGSASVH
RLMKL_CITK8       FIEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSASVH
RLMKL_KLEP3       FIEVQEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSASVH
RLMKL_KLEP7       FIEVQEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSASVH
RLMKL_ENT38       FIEVGEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFAYTGSASVH
RLMKL_CROS8       FMEVHEFNARLLVNLTDYLDTGLFLDHRIARRMLGQMSKGK----DFLNLFSYTGSASVH
RLMKL_ERWT9       FFEVAEYNAKLWVNLTDYLDTGVFLDHRIARKMLGQMSKGK----DFLNLFAYTGSASVH
RLMKL_YERPG       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPY       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPA       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPN       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPE       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPP       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPS       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERP3       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERPB       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_YERE8       FLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK----DFLNLFAYTGTASVH
RLMKL_SERP5       FLLVEEFNAKLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK----DFLNLFAYTGTASVH
RLMKL_PECAS       FLLMEEFGAKLWVNLTDYLDTGLFLDHRIARKMLGEMSRGK----DFLNLFAYTGTASVH
RLMKL_PHOLL       FFLVNEYDAKFWVNLTDYLDTGLFLDHRIARKMLGEMSEGK----DFLNLFAYTGAATVH
RLMKL_PROMH       FFLVDEFGAKFWVNLTDYLDTGLFLDHRIARKMLGEMSKGK----DFLNLFAYTGSASVH
RLMKL_SODGM       FLLVEEYGAKLWVNLTDYLDTGLFIDHRIARRMLGEMSRGK----DFLNLFAYTGSASVH
RLMKL_HAEIE       YFYVNEYGAQLWVNLTDYLDTGLFLDHRLTRKMIGELAKGK----DFLNLFAYTGSATVH
RLMKL_HAEIG       YFYVNEYGTQLWVNLTDYLDTGLFLDHRLTRKMIGELAKGK----DFLNLFAYTGSATVH
RLMKL_HAEIN       YFYVNEYGTQLWVNLTDYLDTGLFLDHRLTRKMIGELAKGK----DFLNLFAYTGSATVH
RLMKL_HAEI8       YFYVNEYGAQLWVNLTDYLDTGLFLDHRLTRKMIGALAKGK----DFLNLFAYTGSATVH
RLMKL_HAES1       YFYVHEYGAKLWVNLTDYLDTGLFLDHRLTRKMLGEMAVGK----DFLNLFAYTGSATVH
RLMKL_HISS2       YFYVHEYGAKLWVNLTDYLDTGLFLDHRLTRKMLGEMAVGK----DFLNLFAYTGSATVH
RLMKL_ACTSZ       YFYVTEYGAKLWVNLTDYLDTGLFLDHRLTRKMLGEMAKDK----DFLNLFAYTGSATVH
RLMKL_MANSM       YFYVNEYGAKLWVNLTDYLDTGLFLDHRLTRRMVGQMAKGK----DFLNLFAYTGSATVH
RLMKL_PASMU       YFYVNEYGAKLWVNLTDYLDTGLFLDHRLTRKMLGEMAKGK----DVLNLFAYTGSATVH
RLMKL_ACTPJ       YFYVTEYGAKLWVNLTDYLDTGLFLDHRLTRKMVGQMAKGK----TFLNLFAYTGSATIH
RLMKL_ACTP2       YFYVTEYGAKLWVNLTDYLDTGLFLDHRLTRKMVGQMAKGK----TFLNLFAYTGSATIH
RLMKL_ACTP7       YFYVTEYGAKLWVNLTDYLDTGLFLDHRLTRKMVGQMAKGK----TFLNLFAYTGSATIH
RLMKL_HAEDU       YFYVNEYGAKLWVNLTDYLDTGIFLDHRLTRKMVGQMAKGK----TFLNLFAYTGSATIH
RLMKL_PSYIN       SLVVHEGQAKMLVNLQDYLDTGLFLDHRPTRLLIGNMAKGK----DFLNLFCYTATASVH
RLMKL_SHEB5       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHEB9       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHEB8       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHEPC       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKAKGR----RVLNLFSYTGSASVH
RLMKL_SHESW       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKAKGR----RVLNLFSYTGSASVH
RLMKL_SHESM       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHESR       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHESA       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHEON       ELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGR----RVLNLFSYTGSASVH
RLMKL_SHEDO       EIITQEYGAKFKLNLTGYLDTGLFLDHRVTRKLVGEKAKGR----KVLNLFSYTGSASVH
RLMKL_SHEFN       EVITEEYGAKFKLNLTGYLDTGLFLDHRVTRKLVGDKAKGK----NVLNLFAYTGSASVH
RLMKL_SHEHH       ELITTEYGAKFKLNLKEYLDTGLFLDHRLTRKLVGEKSKGR----SVCNLFSYTGSASVH
RLMKL_SHEPA       ELITTEYGAKFKLNLKEYLDTGLFLDHRLTRKLVGEKSKGR----SVCNLFSYTGSASVH
RLMKL_SHESH       ELITTEYGAKFKLNLKEYLDTGLFLDHRLTRKLVGQKSKDK----DVLNLFAYTGTASVH
RLMKL_SHEWM       ELITTEYGAKFKLNLKEYLDTGLFLDHRLTRKLVGEKSKDR----DVLNLFAYTGTASVH
RLMKL_SHELP       ELVTTEYGAKFKLNLKDYLDTGLFLDHRLTRKLVGEKSKGR----DVLNLFAYTGSASVH
RLMKL_SHEAM       ELVTTEYGCSFKLNLTDYLDTGLFLDHRLTRKLVGEKAKNR----DVLNLFAYTGSASVH
RLMKL_IDILO       VLTVNEYGAKFEVNLTDYLDTGLFMDHRLVRKELLDKCEEL----DVLNLFAYTCTASVQ
RLMKL_FRATF       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATH       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATO       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATW       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATT       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRAT1       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATM       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRATN       FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNK----TLLNLFSYTCTASVH
RLMKL_FRAP2       FHVINEFNAKFYVNFDDYLDTGIFLDHRKIRQLVAKASKNK----TLLNLFSYTCTASVH
D0KZE4_HALNC      ERVVHEGSTRLWVNLTDYLDTGLFLDHRLVRDRVAELSRGK----KLLNLFCYTATASVR
RLMKL_ACIBY       RFIVQEGKAKILVNLTDYLDTGLFLDHRQMRLRIAQEARGK----HFLNLYSYTSTASLH
RLMKL_ACIBS       RFIVQEGKAKILVNLTDYLDTGLFLDHRQMRLRIAQEARGK----HFLNLYSYTSTASLH
RLMKL_ACIBC       RFIVQEGKAKILVNLTDYLDTGLFLDHRQMRLRIAKEARGK----HFLNLYSYTSTASLH
RLMKL_ACIAD       RFIVQEGQAKILVNLTDYLDTGLFLDHRQIRLRIAQEARGK----HFLNLFSYTSTASLH
RLMKL_PSYA2       FYIAREDGAYLYVNFTDYLDTGLFIDHRNMRARIKDNSRNK----SVLNLFAYTCTASVH
RLMKL_PSYCK       FYIAREDGAYLYVNFTDYLDTGLFIDHRNMRARIKDNSRNK----SVLNLFAYTCTASVH
RLMKL_PSYWF       MHVVQEDGAYFYVNFTDYLDTGLFIDHRNMRSMIRSASRGA----DVLNLFAYTCTASVH
RLMKL_DESPS       MHQVREGNCYFLVNFRDYLDTGLFLDHRPIRLRIGRESLGK----KFLNLYGYTGTASVH
G8QSR6_SPHPG      FYLVNENGSRYMVNFTDYLDTGLFLDHRPIRAEIASMAEGK----RFLNLFCYTGSATVQ
F0RUX4_SPHGB      FYIINENGVKYLVNFTDYIDTGIFLDHRPIRNQIASMAEGK----RFLNLFCYTGTATVQ
RLMKL_ALCBS       YRVVREGQSQLLINLQDYLDTGLFLDHRPTRLRIAEEASGK----RFLNLFAYTGSATVH
C8WGP0_EGGLE      VTQVREDGYLFEVDLAGYLDTGLFLDHRLTRELVGKKAEGK----RFLNLFAYTGSASVH
F7V0X9_EEGSY      VTQVQEDGYIFEVDLAGYLDTGLFLDHRLTRELVGAKAKGK----RFLNLFAYTGTASVH
E1QZ79_OLSUV      AHLVDEGGLTFEVNFSTRLDCGLFLDHRETRGLVREMMKQTQGSKRFLNLFAYTGTATCY
C8W7K3_ATOPD      MLLIDEGGLLFEVNFASRLDCGIFLDHRDTRAEIRELMKRAGTAKSFLNLFAYTGTATCY
F2N9W7_CORGP      LPLIQEGGLTFLVNFDDYLDTGIFLDHRITRSIIRERAAHR----RFLNLFGYTGTATVY
C7N0P8_SLAHD      WVDVRESDFVFDMDIASQRECGLPLDMRPVRELLRAHAASK----RFACLLAHGGAPSVY
                       *      :::    : *:  :    *  .            .     :    :  

RLMKL_STRMK       AAVAGAASTTSVDLSATYLQWCYDNLALNGQGG---------------------------
RLMKL_STRM5       AAVAGAASTTSVDLSATYLQWCYDNLALNGQGG---------------------------
RLMKL_XANAC       AAVAGAASTTSVDLSATYLQWCADNLALNGLAG---------------------------
RLMKL_XANC5       AAVAGAASTTSVDLSATYLQWCAENLALNGLAG---------------------------
RLMKL_XANOM       AAVAGAASTTSVDLSGTYLQWCADNLALNGLAG---------------------------
RLMKL_XANOP       AAVAGAASTTSVDLSGTYLQWCADNLALNGLAG---------------------------
RLMKL_XANOR       AAVAGAASTTSVDLSGTYLQWCADNLALNGLAG---------------------------
RLMKL_XANCP       AAVAGASATTSVDLSGTYLQWCADNLALNGQAG---------------------------
RLMKL_XANC8       AAVAGASATTSVDLSGTYLQWCADNLALNGQAG---------------------------
RLMKL_XANCB       AAVAGASATTSVDLSGTYLQWCADNLALNGQAG---------------------------
RLMKL_XYLF2       AAVAGAAATTSVDLSSTYLHWCTDNFALNGQGG---------------------------
RLMKL_XYLFT       AAVAGAAATTSVDLSSTYLHWCTDNFALNGQGG---------------------------
RLMKL_XYLFM       AAVAGAAATTSVDLSSTYLHWCTDNFALNGQGG---------------------------
RLMKL_XYLFA       AAVAGAAATTSVDLSSTYLHWCTDNFALNGQGG---------------------------
RLMKL_ALKEH       AALGGARETITVDLSATYLGWARDNLLLNGIEPG--------------------------
RLMKL_CHRSD       AALGGASDSVSVDLSNTYLAWARDNFALNRLDP---------------------------
RLMKL_MARHV       AAVGGASRSLSLDMSKTYVGWAQDNLALNSADP---------------------------
RLMKL_PSEAE       AARGGARSTTSVDLSKTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSEA7       AARGGARSTTSVDLSKTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSEP1       AAKGGARSTTSVDLSKTYLDWARRNLALNGYSE---------------------------
RLMKL_PSEPK       AAKGGARSTTSVDLSKTYLDWARRNLALNGYSE---------------------------
RLMKL_PSEPG       AAKGGARSTTSVDLSKTYLDWARRNLALNGYSE---------------------------
RLMKL_PSEPW       AAKGGARSTTSVDLSKTYLDWARRNLSLNGFSE---------------------------
RLMKL_PSEE4       AAKGGARSTTSVDLSKTYLDWARRNLSLNGFSE---------------------------
RLMKL_PSEF5       AAKGGARSTTSVDLSKTYLDWARRNFSLNGFSD---------------------------
RLMKL_PSEPF       AAKGGARSTTSVDLSKTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSE14       AAKGGARSTTSIDLSRTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSEU2       AAKGGARSTTSVDLSRTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSESM       AAKGGARSTTSVDLSRTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSEMY       AAKGGARSTTSVDLSKTYLDWARRNLSLNGFSD---------------------------
RLMKL_PSEU5       AAKGGARSTTSVDLSRTYLDWARRNLSLNGFSD---------------------------
RLMKL_METCA       AAGGGAASTTTVDMSHTYLDWAGRNLALNGFGE---------------------------
RLMKL_PELCD       AVKGGAATTVTVDMSRTYLDWAQANLRLNQLSG---------------------------
RLMKL_ALLVD       AAKGGAASTTTVDLSRTYLEWAGRNLELNGIRG---------------------------
RLMKL_HYDCU       AVKAGCKSSLSLDMSKTYLYWAKHNFMCNDINE---------------------------
RLMKL_CELJU       AAMGGARYTVSVDMSNTYLNWARKNFALNGLSE---------------------------
RLMKL_SACD2       AALGGATESVSVDMSNTYLEWADNNFRLNNVHL---------------------------
RLMKL_MARMS       AGQGGARSSLSVDMSNTYTEWARRNIELNEFSD---------------------------
RLMKL_LEGPC       AALAGALTT-NVDLSKTYLLWAEDNFRLNDIDL---------------------------
RLMKL_LEGPA       AALAGALTT-NVDLSKTYLLWAEDNFRLNDINL---------------------------
RLMKL_LEGPH       AALAGALTT-NVDLSKTYLLWAEDNFRLNDINL---------------------------
RLMKL_LEGPL       AALAGALTT-NVDLSKTYLLWAEDNFRLNDINL---------------------------
RLMKL_HAHCH       AAAGGAATTTSVDMSQTYLSWAERNFHLNKLS----------------------------
RLMKL_DICNV       AALGGASYTTSVDLSPTYLDWAQRNFDLNALS----------------------------
RLMKL_MAGMM       AAAGGALTTTSVDLSNTYLEWAQRNMELNGFKGE--------------------------
RLMKL_ALTMD       AAMGGAKSVTTVDMSNTYLDWAKKNVALNKLSG---------------------------
RLMKL_PSEA6       AALGKAKSVTTVDMSNTYVDWAKENFALNKLKG---------------------------
RLMKL_COLP3       AAVQGAASITTVDMSNTYLNWAEDNFALNKLNG---------------------------
RLMKL_PSEHT       AALGGAKAITTVDLSKTYLKWGQDNFDLNNISN---------------------------
RLMKL_ALIF1       AACGGAKSTMTIDMSRTYLEWAQKNMNTNGQTG---------------------------
RLMKL_ALIFM       AACGGAKSTMTIDMSRTYLEWAQKNMNTNGQTG---------------------------
RLMKL_ALISL       AACGGAKSTMTIDMSRTYLEWAQKNMNTNDQTG---------------------------
RLMKL_PHOPR       AACGGAKSTTTIDMSNTYLGWAQENMELNNQVG---------------------------
RLMKL_VIBCH       AACGGAKSTTTVDMSKTYLEWAKENMQLNGQVG---------------------------
RLMKL_VIBC3       AACGGAKSTTTVDMSKTYLEWAKENMQLNGQVG---------------------------
RLMKL_VIBCB       AAVGGARSTTTVDMSNTYLNWAKDNMQLNGCVG---------------------------
RLMKL_VIBPA       AAVGGARSTTTVDMSNTYLNWAKDNMQLNGCIG---------------------------
RLMKL_VIBVY       AALGGASSTTTVDMSNTYLEWAKDNMSANGCIG---------------------------
RLMKL_AERHH       AGLGGASETTTVDMSRTYLNWAQDNMRLNSLVG---------------------------
RLMKL_AERS4       AGLGGASETTTVDMSHTYLNWAQDNMRLNSLVG---------------------------
RLMKL_BUCAI       AGLGHANSTTSVDISNTYIKWSARNMSLNNLTS---------------------------
RLMKL_BUCAP       AGLGKSKSITTVDISNTYIQWSMRNMSINNLIN---------------------------
RLMKL_SHIFL       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTR---------------------------
RLMKL_SHIF8       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTR---------------------------
RLMKL_ECOLI       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOHS       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOLC       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECODH       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECO57       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECO5E       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECO24       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_SHIDS       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_SHIB3       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_SHIBS       AGLGGALSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_SHISS       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOSM       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOL5       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOUT       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOK1       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ECOL6       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_SALA4       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALTY       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALDC       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALEP       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALHS       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALNS       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALPA       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALPK       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALPB       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALG2       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALCH       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALSV       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALTI       AGLGGARNTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_SALAR       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_CITK8       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_KLEP3       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_KLEP7       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_ENT38       AGLGGARSTTTMDMSRTYLEWAERNLRLNGLTG---------------------------
RLMKL_CROS8       AGLGGARSTTTVDMSRTYLEWAERNLRLNGLSG---------------------------
RLMKL_ERWT9       AGLGGARTTTTIDMSRTYLEWAERNMRLNGLSG---------------------------
RLMKL_YERPG       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPY       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPA       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPN       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPE       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPP       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERPS       AGLGGARSTTTVDMSRTYLEWAEKNLRANGLTG---------------------------
RLMKL_YERP3       AGLGGARSTTTVDMSRTYLEWAEKNLRANGLTG---------------------------
RLMKL_YERPB       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_YERE8       AGLGGARSTTTVDMSRTYLEWAEKNLRANGLTG---------------------------
RLMKL_SERP5       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_PECAS       AGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG---------------------------
RLMKL_PHOLL       AGLGGARSTTTVDMSRTYLEWAERNLQANELTG---------------------------
RLMKL_PROMH       AGLGGAKSTTTVDMSRTYLEWAEKNFQANGLSG---------------------------
RLMKL_SODGM       AGIGGACSTTSVDMSRTYLEWAEKNLRSNGLVG---------------------------
RLMKL_HAEIE       AALGGAKSTTTVDMSNTYLNWAEQNLILNDIEG---------------------------
RLMKL_HAEIG       AALGGAKSTTTVDMSNTYLNWAEQNLILNDIEG---------------------------
RLMKL_HAEIN       AALGGAKSTTTVDMSNTYLNWAEQNLILNDIEG---------------------------
RLMKL_HAEI8       AALGGAKSTTTVDMSNTYLNWAEQNLILNDIEG---------------------------
RLMKL_HAES1       AALGLAKSTTTVDMSNTYLNWAEQNLLLNDIEG---------------------------
RLMKL_HISS2       AALGLAKSTTTVDMSNTYLNWAEQNLLLNDIEG---------------------------
RLMKL_ACTSZ       AALGGAKSTTTVDMSNTYLNWAEQNLILNDVDG---------------------------
RLMKL_MANSM       AALGGAKSTTTVDMSNTYLNWAEQNLILNEADG---------------------------
RLMKL_PASMU       MALGGAKSTTTVDMSNTYLNWAEQNLLLNDLEG---------------------------
RLMKL_ACTPJ       AALNGAKSTTTVDMSNTYLNWAEQNLELNNLPL---------------------------
RLMKL_ACTP2       AALNGAKSTTTVDMSNTYLNWAEQNLELNNLPL---------------------------
RLMKL_ACTP7       AALNGAKSTTTIDMSNTYLNWAEQNLELNNLPL---------------------------
RLMKL_HAEDU       AALHGAKATTSVDMSNTYLNWAEQNLELNGLKS---------------------------
RLMKL_PSYIN       AALGGAKSTTSVDMSKTYLAWGEDNFAENGIKG---------------------------
RLMKL_SHEB5       AALGGAKSVTTVDMSNTYIAWAKDNFALNGLQG---------------------------
RLMKL_SHEB9       AALGGAKSVTTVDMSNTYIAWAKDNFALNGLQG---------------------------
RLMKL_SHEB8       AALGGAKSVTTVDMSNTYIAWAKDNFALNGLQG---------------------------
RLMKL_SHEPC       AALGGAKSVTTVDMSNTYINWAKDNFALNGLQG---------------------------
RLMKL_SHESW       AALGGAKSVTTVDMSNTYIAWAKDNFALNGLQG---------------------------
RLMKL_SHESM       AALGGAKSVTTVDMSNTYLAWAKENFALNDLSG---------------------------
RLMKL_SHESR       AALGGAKSVTTVDMSNTYLAWAKENFALNDLSG---------------------------
RLMKL_SHESA       AALGGAKSVTTVDMSNTYLAWAKENFALNDLSG---------------------------
RLMKL_SHEON       AALGGAKSVTTVDMSNTYLAWAKENFALNNLSG---------------------------
RLMKL_SHEDO       AALGGAKSVTTVDMSNTYISWAKENFELNGINL---------------------------
RLMKL_SHEFN       AAIGGAKSVTTIDMSNTYINWAKENFALNGLSG---------------------------
RLMKL_SHEHH       AALGGATSVTTVDMSNTYIDWAKENFALNGLNS---------------------------
RLMKL_SHEPA       AALGGATSVTTVDMSNTYIDWAKENFALNGLNS---------------------------
RLMKL_SHESH       AALGGAKSVKTVDMSNTYTNWAKENFALNGLND---------------------------
RLMKL_SHEWM       AALGGAKSVKTVDMSNTYTNWAKENFALNGLND---------------------------
RLMKL_SHELP       AALGGAKSVTTVDMSNTYLNWAQDNFELNGLKG---------------------------
RLMKL_SHEAM       AGKGGAKSVTTVDMSNTYLNWAKDNFMLNGLIG---------------------------
RLMKL_IDILO       AARAGAARVVSVDMSKTYLKWGERNFALNRLRG---------------------------
RLMKL_FRATF       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRATH       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRATO       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRATW       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRATT       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRAT1       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNIDA---------------------------
RLMKL_FRATM       AALKGA-KTTSVDMSNTYLEWGKNNFTLNNINA---------------------------
RLMKL_FRATN       AALKGA-KTTSVDMSNTYLEWGKNNFELNKLDI---------------------------
RLMKL_FRAP2       AALKGA-KTTSVDMSNTYLEWGKNNFELNNLDI---------------------------
D0KZE4_HALNC      AAHQGASRTVSIDLSNTYLDWAERNFTLNNLKVG--------------------------
RLMKL_ACIBY       AALGGAASTTSVDLSNTYLSWSKENFVLNGLTVDH-------------------------
RLMKL_ACIBS       AALGGAASTTSVDLSNTYLSWSKENFVLNGLTVDH-------------------------
RLMKL_ACIBC       AALGGAASTTSVDLSNTYLSWSKENFVLNGLTVDH-------------------------
RLMKL_ACIAD       AALGGAASTTSVDLSNTYINWSKENFVLNGLTVDH-------------------------
RLMKL_PSYA2       AALAGAKKVTSVDLSQNYLDWGKQNFALNGLNVS--------------------------
RLMKL_PSYCK       AALAGAKKVTSVDLSQNYLDWGKQNFALNGLNVS--------------------------
RLMKL_PSYWF       AALGGAKSVTSVDLSQNYLDWGKQNFALNGLDVT--------------------------
RLMKL_DESPS       AAQGGAASTTTVDLSSTYLQWTEMNFSLNGFAEN--------------------------
G8QSR6_SPHPG      AAKGNALSTVSVDASATYLDWAVKNMELNGYTQM--------------------------
F0RUX4_SPHGB      AAKGGALSTVSVDASSTYLDWAVKNMQLNGYTDM--------------------------
RLMKL_ALCBS       AAVGGAKRTVTVDSSKRYLDWAACNLAANGFSTD--------------------------
C8WGP0_EGGLE      AAGGGAKSTATVDLSQTYLDWAARNMAANGFE----------------------------
F7V0X9_EEGSY      AAGGGAQSTTTVDLSQTYLDWAARNMAANGFA----------------------------
E1QZ79_OLSUV      AADGGAKHTTTVDMSRPSLDWARRNMDRNGFSNGRPGNPRERRNGRNGPGRGSAYGRNGA
C8W7K3_ATOPD      AADGDALHTTTVDLSKPSLEWAKRNMKRNGFG----------------------------
F2N9W7_CORGP      AADGGADETLTVDLSNTYLDWAEENMARNGFT----------------------------
C7N0P8_SLAHD      AAAGGAVSTVTVDPADPFLEQADHALYVNGFR----------------------------
                       .    .:* :          .  *                               

RLMKL_STRMK       ----NQHLLVQADAMAWLEGD------RGQYDVIFCDPPTFSNSARA-DD-FDVQREQLK
RLMKL_STRM5       ----NQHLLVQADAMAWLEGD------RGQYDVIFCDPPTFSNSARA-DD-FDVQREQLK
RLMKL_XANAC       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQREHVR
RLMKL_XANC5       ----SKHKLMQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQREHVR
RLMKL_XANOM       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQRAHVR
RLMKL_XANOP       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQRAHVR
RLMKL_XANOR       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQRAHVR
RLMKL_XANCP       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQREHVR
RLMKL_XANC8       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQREHVR
RLMKL_XANCB       ----SKHKLVQADALAWLEAE------RAHFDVIFCDPPTFSNSARA-ED-FDIQREHVR
RLMKL_XYLF2       ----VRHRLVQADALAWLEAE------RGQYDVIFCDPPTFSNSARA-DD-FDVQRDHVR
RLMKL_XYLFT       ----VRHRLVQADALAWLEAE------RGQYDVIFCDPPTFSNSARA-DD-FDVQRDHVR
RLMKL_XYLFM       ----VRHRLVQADALAWLEAE------RGQYDVIFCDPPTFSNSARA-DD-FDVQRDHVR
RLMKL_XYLFA       ----VRHRLVQADALAWLEAE------RGQYDVIFCDPPTFSNSARA-DD-FDVQRDHVR
RLMKL_ALKEH       ----ARHRLERADCLAWLAGQAE--SRPGRYDLIFMDPPTFSNSKRM-CESFDVQRDHPR
RLMKL_CHRSD       ----SRHRVVRDDCLRWL----E--TAGSEFDLIFMDPPTFSNSKKM-DAVLDVQRDHAR
RLMKL_MARHV       ----RKHVVEQADCLAWLADR-K--TANQSFDLIFMDPPTFSNSARM-AGVLDIQRDHAD
RLMKL_PSEAE       -----KQRLVHGDVMEWLR------EDDGQYELIFIDPPTFSNSKRM-EGVFDVQRDHVE
RLMKL_PSEA7       -----RQRLVHSDVMEWLR------EDDGQYELIFIDPPTFSNSKRM-EGVFDVQRDQVE
RLMKL_PSEP1       -----RNRLEQSDVMAWLE------GNRDSYDLIFIDPPTFSNSKRM-EGVFDVQRDHVQ
RLMKL_PSEPK       -----RNRLEQSDVMTWLE------GNRDSYDLIFIDPPTFSNSKRM-EGVFDVQRDHVQ
RLMKL_PSEPG       -----RNRLEQSDVMAWLE------GNRDSYDLIFIDPPTFSNSKRM-EGVFDVQRDHVQ
RLMKL_PSEPW       -----RNRLEQGDVMAWLE------ANRDTYDLIFIDPPTFSNSKRM-EGVFDVQRDHVQ
RLMKL_PSEE4       -----RNRLEQSDVMAWLQ------NNQESFDLIFIDPPTFSNSKRM-EGVFDVQRDHVE
RLMKL_PSEF5       -----KNRLEQGDVMAWLD------SCRDEFDLIFIDPPTFSNSKRM-EGVFDVQRDQVQ
RLMKL_PSEPF       -----KNRLEQGDVMAWLE------NCREEYDLIFIDPPTFSNSKRM-EGIFDVQRDQVQ
RLMKL_PSE14       -----KNRLEQGDVMAWLQ------ANRDEYDLIFIDPPTFSNSKRM-EGIFDVQRDQVE
RLMKL_PSEU2       -----KNRLEQGDVMAWLQ------ANRDEYDLIFIDPPTFSNSKRM-EGIFDVQRDQVE
RLMKL_PSESM       -----KNRLEQGDVMAWLQ------ANRDEYDLIFIDPPTFSNSKRM-EGIFDVQRDQVE
RLMKL_PSEMY       -----KHRLEQGDVMAWLA------EDRGEYDLIFIDPPTFSNSKRM-EGVFDVQRDHVE
RLMKL_PSEU5       -----RQRLEQGDVMAWLE------ADRGEYDLIFIDPPTFSNSKRM-EGVFDVQRDHVA
RLMKL_METCA       ----RDHLRIQADCLDWLEQAVD--RR-RRYGLIFLDPPTFSNSKRM-TGSFDIQRDQGP
RLMKL_PELCD       ----PQHRFVCADVLQYLEREQ------AHYDLIFLDPPTFSTSKSM-ETTLDIQRDHVD
RLMKL_ALLVD       ----PNHQLIQADCLRWIDSMAG--Q--RRFDLIFLDPPSFSTSKRM-HGTLDIQRDHVD
RLMKL_HYDCU       ----KQHVLQQENVLEWLETATQ--NPKDLFDVIFLDPPSFSTSKRM-DGTLDIQRDHVD
RLMKL_CELJU       ----ARNRLEQADCLKWLE------NNDQQFDLILLDPPSFSNSKRM-EDILDIQRDHVE
RLMKL_SACD2       ----ARHRLVRADCFDWLN------KCREGFDLIMLDPPTFSNSKKM-SDVLDIQKDQVR
RLMKL_MARMS       ----RYHQVERADCIEWLK------QSRDKFDLIFMDPPTFSNSKKM-ADILDIQRDHGE
RLMKL_LEGPC       ----SKHQFLQYDCKEWMK------ITRDKFDVIFLDPPSFSNSKRM-SDILDIQRDHVS
RLMKL_LEGPA       ----SKHQFLQYDCKEWMK------TTRDKFDVIFLDPPSFSNSKRM-SDILDIQRDHVS
RLMKL_LEGPH       ----SKHQFLQYDCKEWMK------TTRDKFDVIFLDPPSFSNSKRM-SDILDIQRDHVS
RLMKL_LEGPL       ----SKHQFLQYDCKEWMK------TTRDKFDVIFLDPPSFSNSKRM-SDILDIQRDHVS
RLMKL_HAHCH       ----GPHRFVRANVLDWLK------AEHNSYDLIFLDPPTFSNSKKM-EDVLDIQRDHAG
RLMKL_DICNV       ----DRHRLQRADVMAWLH------SGKSQFDMIFCDPPTFSNTKKE-QRVFDVQRDQIA
RLMKL_MAGMM       ----HQHRFIKANCMQWIA------TTDQTFDLIFLDPPTFSNSKSM-LESFDIQRDQVT
RLMKL_ALTMD       ----P-HAFIQADCTTWLGTH------KGKYDLIFIDPPSFSNSKRM-QNTWDVQRDHVK
RLMKL_PSEA6       ----P-YEFIQADCLTWLERH------NNQYDFIFIDPPSFSNSKRM-DTTWDVQRDHVA
RLMKL_COLP3       ----HKYQFIQADCLDWLKKN------VNKFDVIFIDPPTFSNSKRM-EDSFDVQRDHVD
RLMKL_PSEHT       ----TRYRFEQADCLKWLEHA------TAQYDLIFLDPPTFSNSKRM-KDAFDVQSDHIK
RLMKL_ALIF1       ----TQHQFLQADCLQWLQQA------DGEFDLIFIDPPTFSNSKRM-EQTFDVQRDHIM
RLMKL_ALIFM       ----TQHQFLQADCLQWLQQA------DGEFDLIFIDPPTFSNSKRM-EQTFDVQRDHIM
RLMKL_ALISL       ----TQHQFLQADCLQWLQQA------EGEFDLIFIDPPTFSNSKRM-DQTFDVQRDHIM
RLMKL_PHOPR       ----DQHEFIQADCLQWLQEV------DDTFDLIFIDPPTFSNSKRM-KQTFDIQRDHIM
RLMKL_VIBCH       ----RQHQYVQADCLQWLANA------QSQYDLIFIDPPTFSNSKRM-EQTFDVQRDHVT
RLMKL_VIBC3       ----RQHQYVQADCLQWLANA------QSQYDLIFIDPPTFSNSKRM-EQTFDVQRDHVT
RLMKL_VIBCB       ----RQHRFEQADCLQWLENA------KGEYDLIFIDPPTFSNSKRM-ETSFDVQRDHIK
RLMKL_VIBPA       ----RQHRFEQADCLQWLENA------KGEYDLIFIDPPTFSNSKRM-ETSFDVQRDHIK
RLMKL_VIBVY       ----RQHKFEQADCLQWLEKA------QGQYDLIFIDPPTFSNSKRM-EDSFDVQRDHIK
RLMKL_AERHH       ----REHKFVQADCLKWLSEA------DDQYDLIFIDPPTFSNSKRM-DESFDVQRDHLL
RLMKL_AERS4       ----RQHKFVQADCLKWLSEA------DDQYDLIFIDPPTFSNSKRM-DESFDVQRDHLL
RLMKL_BUCAI       ----SQHNFIQYDCLKWIKKT------NQKFDLIFINPPTFSNSKKM-QQSFDLKRDYLD
RLMKL_BUCAP       ----SKNIFIQKDCLEWIIST------KNKFDLIFINPPTFSNSKRM-KKSFELKRDYIK
RLMKL_SHIFL       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SHIF8       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECOLI       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECOHS       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECOLC       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECODH       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECO57       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECO5E       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECO24       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SHIDS       ----RTHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SHIB3       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SHIBS       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SHISS       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHMA
RLMKL_ECOSM       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLV
RLMKL_ECOL5       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLV
RLMKL_ECOUT       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECOK1       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_ECOL6       ----RAHRLIQADCLAWLREA------NEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHLA
RLMKL_SALA4       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALTY       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALDC       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALEP       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALHS       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALNS       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALPA       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALPK       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALPB       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALG2       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALCH       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALSV       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALTI       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EESFDVQRDHVA
RLMKL_SALAR       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-EASFDVQRDHVA
RLMKL_CITK8       ----RAHRLIQADCLGWLREA------NEQFDLIFIDPPTFSNSKRM-DESFDVQRDHLV
RLMKL_KLEP3       ----RAHRLMQADVLGWLRES------TEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHIR
RLMKL_KLEP7       ----RAHRLMQADVLGWLRES------TEQFDLIFIDPPTFSNSKRM-EDAFDVQRDHIR
RLMKL_ENT38       ----RQHRLLQADVLGWLRDT------DEQFDLIFIDPPTFSNSKRM-EDTFDVQRDHIR
RLMKL_CROS8       ----RAHRLIQADCLSWLAES------DEQFDLIFIDPPTFSNSKRM-EETFDVQRDHLR
RLMKL_ERWT9       ----RQHRLMQADCLSWLRDA------DEQFDLIFIDPPTFSNSKRM-DESFDVQRDHLD
RLMKL_YERPG       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPY       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPA       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPN       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPE       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPP       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPS       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERP3       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERPB       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_YERE8       ----QQHRLIQADCLSWLSNT------DEQFDVIFIDPPTFSNSKRM-ETTFDVQRDHLV
RLMKL_SERP5       ----KQHRLIHADCLSWMQNA------DEQFDVIFIDPPTFSNSKRM-ENTFDVQRDHLA
RLMKL_PECAS       ----RQHRLIQADCLSWLHNG------HEQFDVIFIDPPTFSNSKRM-EESFDVQRDHLA
RLMKL_PHOLL       ----RQHRLIQADCLAWLARA------NEQFDLIFIDPPTFSNSKRM-EDTFDVQRDHIM
RLMKL_PROMH       ----RQHRLMQADCLQWLSQS------NEQFDVIFIDPPTFSNSKRM-ENTFDVQRDHIE
RLMKL_SODGM       ----RQHRLIQADCLAWLAMA------QETFDVIFIDPPTFSNSKRM-ADTFDVQRDHLA
RLMKL_HAEIE       ----KQHKLIQADCLQWLEKC------DRQFDLIFVDPPTFSNSKRM-EESWDVQRDHVK
RLMKL_HAEIG       ----KQHKLIQADCLQWLEKC------DRQFDLIFVDPPTFSNSKRM-EESWDVQRDHVK
RLMKL_HAEIN       ----KQHKLIQADCLQWLEKC------DRQFDLIFADPPTFSNSKRM-EESWDVQRDHVK
RLMKL_HAEI8       ----KQHKLIQADCLQWLEKC------DRQFDLIFVDPPTFSNSKRM-EDSWDVQRDHVK
RLMKL_HAES1       ----KQHKLIQADCLQWLNKC------DRQFDLIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_HISS2       ----KQHKLIQADCLQWLNKC------DRQFDLIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_ACTSZ       ----KRHKLIQADCLQWLMRC------DKQFDLIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_MANSM       ----KQHKLIQADCLQWLANC------AQQFDLIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_PASMU       ----KQHKLIQADCLQWLARC------DRQFDLIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_ACTPJ       ----RNNRLFQADCLQWLAEC------RERFELIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_ACTP2       ----RNNRLFQADCLQWLAEC------RERFELIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_ACTP7       ----RNNRLFQADCLQWLAEC------RERFELIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_HAEDU       ----RNHRLFQADCLQWLAEC------RERFELIFVDPPTFSNSKRM-EDSWDVQRDHIK
RLMKL_PSYIN       ----K-HEFIQQDCIKWLQHA------HEMYDLIFIDPPTFSNSKRM-NDVFDVQEDHVA
RLMKL_SHEB5       ----KQYEFVQSDCMQWIRDC------NEQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHEB9       ----KQYEFVQSDCMQWIRDC------NEQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHEB8       ----KQYEFVQSDCMQWIRDC------NEQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHEPC       ----KQYEFVQADCLQWIRDC------NEQFDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHESW       ----KQYEFVQADCLQWIRDC------NEQFDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHESM       ----KQYEFVQADCLQWIRDSAL--DKSAQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHESR       ----KQYEFVQADCLQWIRDSAL--DKSAQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHESA       ----KQYEFVQADCLQWIRDSAH--DKSAQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHEON       ----KQYEFVQADCLQWIRDC------NEQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVN
RLMKL_SHEDO       ----KNHEFVQADCLQWV-DDC-----REQFDLIFIDPPTFSNSKRM-EDSWDVQRDHVA
RLMKL_SHEFN       ----AKYDFIQADCLQWIKDNS-----HQKYELIFIDPPTFSNSKRM-EDSWDVQRDHAE
RLMKL_SHEHH       ----DKYQFVQANCLQWMKRT------HDRFDLIFIDPPTFSNSKRM-EDSFDVQRDHLA
RLMKL_SHEPA       ----DKYQFVQANCLQWMKRT------HDRFDLIFIDPPTFSNSKRM-EDSFDVERDHVA
RLMKL_SHESH       ----DKYQFVQANCMQWIKTT------HDKFDLIFIDPPTFSNSKRM-EDSFDVLRDHVA
RLMKL_SHEWM       ----DKYQFVQANCMQWIKTT------HDKFDLIFIDPPTFSNSKRM-EDSFDVLRDHVP
RLMKL_SHELP       ----KQYQFIQGDCLQWIDDC------DQQYDLIFIDPPTFSNSKRM-EDSFDVQRDHVK
RLMKL_SHEAM       ----RQYQFEQADCLQWIRDC------ERQFDLIFIDPPTFSNSKRM-EDSFDVQRDHVD
RLMKL_IDILO       ----D-YQFIQADCFIWMREQRG----KQLFDVIFLDPPTFSNSKRM-SGTLDIQRDHVG
RLMKL_FRATF       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATH       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATO       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATW       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATT       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRAT1       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATM       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRATN       ----KKHSFIQADCISWLKTNK------DKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
RLMKL_FRAP2       ----KKHNFIQADCISWLKSNS------EKFDVIFLDPPTFSNSKRM-DDILDIQRDHEL
D0KZE4_HALNC      ----TEHSLIRADVLDWLEQRSNAIYQPERFDVIFCDPPTFSNSKAM-QDTLDIQRDHEF
RLMKL_ACIBY       --ADEQHMFFASDCFEWLKEGH------EQYDLIFIDPPTFSNSKKF-HGTFDVQRDHVS
RLMKL_ACIBS       --ADEQHMFFASDCFEWLKEGH------EQYDLIFIDPPTFSNSKKF-HGTFDVQRDHVS
RLMKL_ACIBC       --ADEQHMFFASDCFEWLKEGH------EQYDLIFIDPPTFSNSKKF-HGTFDVQRDHVS
RLMKL_ACIAD       --ADEQHMFFASDCFEWLKEGH------EQYDLIFIDPPTFSNSKKF-YGTFDIQRDHVS
RLMKL_PSYA2       ---GNKYQFVAADIFEWIKDNT------EQFDIIFIDPPTFSNSKKF-QGTFDVQRDHAA
RLMKL_PSYCK       ---SNKYQFVAADIFEWIKDNT------EQFDIIFIDPPTFSNSKKF-QGTFDVQRDHAA
RLMKL_PSYWF       ---TSRYQFIASDIFDWIKDNT------DQFDVIFIDPPTFSNSKKF-QGTFDVQRDHTA
RLMKL_DESPS       -----NHRTVKADCIKWLAEET------ELYDTIFVDPPTFSNTQKA-NRVFDIQRDHIQ
G8QSR6_SPHPG      -----NHFFYKSDCIQYLYDTY------DRFDLIFCDPPTFSNSK-G-RDSFDVDRDQVK
F0RUX4_SPHGB      -----NHFFYRSDCLEFLFDTY------DRYDLIFCDPPTFSNGK-G-RQNFDVDRDQMR
RLMKL_ALCBS       -----QHELARADTMRWLDECK------EQFDLVFCDPPTFSNNK-S-RSDFVVEEHHGD
C8WGP0_EGGLE      -GEQ--HTFERGDTMAWVTEARR---TGRRFDLVFVDPPTFSNSKAMGKRTWDVQRDHVE
F7V0X9_EEGSY      -GDT--HTFERGDTMAWITEARR---AGRRFDLVFVDPPTFSNSKAMGKRTWDVQRDHVE
E1QZ79_OLSUV      HGSDDAHEYVQADVIHWVSAQRR---TKNRWDLIFCDVPTFSNSKRMGRGSWDVQRDHAE
C8W7K3_ATOPD      -GED--HEFVQADVLSWITEMRH---TKNRWNVIFCDVPTFSNSSRMKQSSFDVQRDHAE
F2N9W7_CORGP      -GDE--HGFIRADARAFIDEMRR---CRELWDLIFCDPPTFSNSTKMGGSTFDIQRDHVS
C7N0P8_SLAHD      -GRE--HDLVCDDPLDWARREAR---AGRTYDLVFCDLSAFPSSR-----SHDLIADHMS
                              :   :             :  :: : .:*..          :      

RLMKL_STRMK       LLRAAVARLAPGGVLYFSNNFRRFKLEENAIA-EFAQCREITARTIGPDFERNARIHRAW
RLMKL_STRM5       LLRAAVARLAPGGVLYFSNNFRRFKLEENAIA-EFAQCREITARTIGPDFERNARIHRAW
RLMKL_XANAC       LLRAAVARLAPGGVLYFSNNFRRFKLDEEGVA-EFAQCEEISPRTIDPDFERHARIHRAW
RLMKL_XANC5       LLRAAVARLALGGVLYFSNNFRRFKLDEEGVA-EFAQCEEISPRTIDPDFERHARIHRAW
RLMKL_XANOM       LLRAAVARLAPGGVLYFSNNFRRFKLDEEGVA-EFAQCEDISPRTIDPDFERHARIHRAW
RLMKL_XANOP       LLRAAVARLAPGGVLYFSNNFRRFKLDEEGVA-EFAQCEDISPRTIDPDFERHARIHRAW
RLMKL_XANOR       LLRAAVARLAPGGVLYFSNNFRRFKLDEEGVA-EFAQCEDISPSTIDPDFERHARIHRAW
RLMKL_XANCP       LLRAAVARLAPGGVLYFSNNFRRFKLDEEAVS-EFAQCEEISPRTIDPDFERHARIHRAW
RLMKL_XANC8       LLRAAVARLAPGGVLYFSNNFRRFKLDEEAVS-EFAQCEEISPRTIDPDFERHARIHRAW
RLMKL_XANCB       LLRAAVARLAPGGVLYFSNNFRRFKLDEEAVA-EFAQCEEISPRTIDPDFERHVRIHRAW
RLMKL_XYLF2       LLRAAVARLTPGGVLYFSNNFRRFRLDVDAVA-AFAQCEEISPVTIDLDFSRNTRIHRTW
RLMKL_XYLFT       LLRAAVARLTPGGVLYFSNNFRRFRLDVDAVA-AFAQCEEISPVTIDLDFSRNTRIHRTW
RLMKL_XYLFM       LLRAAVARLTPGGVLYFSNNFRRFRLDVDAVA-AFAQCEEISSVTIDLDFSRNTRIHRTW
RLMKL_XYLFA       LLRAAVARLTPGGVLYFSNNFRRFRLDVDAVA-AFAQCEEISPVTIDLDFSRNTRIHRTW
RLMKL_ALKEH       LIRQAMQLLAPDGLLVFSCNRRGFSLDEAVA--SDYACREITRETIPPDYARNPHVHYCW
RLMKL_CHRSD       LIELAMARLAPGGTLVFSNNQRRFVLDAAVG--ERFAVEDISARTFDPDFSRRPDLHHCF
RLMKL_MARHV       LVRQCMARLSSDGLLIFSNNFRKFRLDEALE--SEFEVKEVSASTLDKDFQRNPKIHRCW
RLMKL_PSEAE       LLDLAMARLAPGGVLYFSNNFRKFELDESVQ--ARYAVEEITGETLDPDFARNPKIHRAW
RLMKL_PSEA7       LLDLAMARLAPGGVLYFSNNFRKFELDESVQ--ARYAVEEITGETLDPDFARNPKIHRAW
RLMKL_PSEP1       LLDLAMARLAPGGVLYFSNNFRKFQLDEHLM--ARYVVEEISAQTLDPDFARNNRIHRAW
RLMKL_PSEPK       LLDLAMARLAPGGVLYFSNNFRKFQLDEHLM--ARYVVEEISAQTLDPDFARNNRIHRAW
RLMKL_PSEPG       LLDLAMARLAPGGVLYFSNNFRKFQLDEHLM--ARYAVEEITAQTLDPDFARNNRIHRAW
RLMKL_PSEPW       LLDLAMARLAPGGVLYFSNNFRKFQLDEHLA--ARYVVEEITAQTLDPDFARNNRIHRAW
RLMKL_PSEE4       LLDLAMARLAPGGVLYFSNNFRKFQLDEHLS--TRYAVEEISAQTLDPDFARNNRIHRAW
RLMKL_PSEF5       LLDLAMARLAPGGVLYFSNNFRKFQLDENLA--ARYQIEEITAKTIDPDFARNGKIHRAW
RLMKL_PSEPF       LIDLAMARLASGGVLYFSNNFRKFQLEDNLA--ERYAVEEITASTIDPDFARNGKIHRAW
RLMKL_PSE14       LIDLAMARLAPGGVLYFSNNFRKFVLDENLS--QRYAVEDITAQTIDQDFARNGKIHRAW
RLMKL_PSEU2       LIDLAMARLAPGGVLYFSNNFRKFVLDENLS--QRYAVEDITAHTIDQDFARNGKIHRAW
RLMKL_PSESM       LIDLAMARLAPGGVLYFSNNFRKFVLDENLG--QRYAVEDITAQTIDPDFARNGKIHRAW
RLMKL_PSEMY       LLDLAMARLAGGGVLYFSNNFRKFQLDESLV--ARYQVEEISAQTLDPDFARNPKIHRAW
RLMKL_PSEU5       LLDLAMARLATGGTLYFSNNFRKFVLDASLM--DRYAVEEITASTLDEDFRRNPRIHRAW
RLMKL_METCA       LLKKVVSLLEPGGMLIFSTNRRRFRLDETAL--AGCAVEDVSRVTLPKDFERNPRIHACW
RLMKL_PELCD       IIRLAANLLTPGGVLIFSNNFRKFRMDFESL--PELEIENITAATIPHDFARNPKIHNCW
RLMKL_ALLVD       IIQATMRLLEPGGRLIFSNNLRRFRIDLEGL--APFEVSDISAQTLPRDFARNPRIHNCW
RLMKL_HYDCU       LIQKTLKLLSKDGKLIFSTNLRKFKLDKASFE-PDYQIENITQRTMPKDYARNMKIHQAW
RLMKL_CELJU       MIHNAMRSLSEEGTLIFSNNLRNFKLDLEAL--GAYNIEDISARTIDEDFKRNPKIHQCW
RLMKL_SACD2       LISRCMDILNPGGTLYFSTNFRQFKLDEQIS--TRYVVENISAATIDEDFKGNPKIHYCW
RLMKL_MARMS       LVRLAMARLARGGELIFSNNYRRFVLDEALE--QEYDVKNITRETLDPDFDRNDKIHQCY
RLMKL_LEGPC       LINMAMRLLNPNGVLYFSTNLRQFKLEPMLK--EKYAVQDITPQTIDQDFKRNSKIHHCF
RLMKL_LEGPA       LINMAMRLLNPDGVLYFSTNLRQFKLEPMLK--EKYAVQDITPQTIDQDFKRNSKIHHCF
RLMKL_LEGPH       LINMAMRLLNPDGVLYFSTNLRQFKLEPMLK--EKYAVQDITPQTIDQDFKRNSKIHHCF
RLMKL_LEGPL       LINMAMRLLNPDGVLYFSTNLRQFKLEPMLK--EKYAVQDITPQTIDQDFKRNSKIHHCF
RLMKL_HAHCH       LIEDCMRLLAPGGVLIFSCNYRRFKLDSGIE--QRFAVENHTAASIPEDFKRNERIHQCW
RLMKL_DICNV       LIDGCMQRLAAGGILYFSNNYRGFRLEEALC--ARYCVQEISENTIDFDFKRRPKIHRVW
RLMKL_MAGMM       LIGGVARLLNPDGVLYFSTNRKKFKLEQDLLSAQNLHMEEITQQTLDPDFHREPPIHRCW
RLMKL_ALTMD       MLTDAKACLKEQGTIIFSNNKRGFKLDETAVTALGLQVENITKETIPEDFARKGKIHQCW
RLMKL_PSEA6       LLRNAVKCLRPGGEIMFSNNLRQFKLDEEGVSQLGLTIQDITQKTLPEDFKRNPKIHGCW
RLMKL_COLP3       LITDALKSLNRGGEIFFTNNKRNFKIDFEALDELGLTAEAMSDVTRDKDFARNKHIHNSW
RLMKL_PSEHT       LLTWVKKILSPSGTLIFSNNKRGFVMDEVGLIGLGLKAVNISDKTLSPDFKRNKKIHNSW
RLMKL_ALIF1       LLENLKRMLRENGTIVFSNNKRNFKMDEAGLEKAGLKAKNISKQTLPLDFARNKHIHNCW
RLMKL_ALIFM       LLENLKRMLRENGTIVFSNNKRNFKMDDAALEKAGLKAKNISKQTLPLDFARNKHIHNCW
RLMKL_ALISL       LLENLKRMLRQDGTVVFSNNKRNFKMDEEALDKAGLQAKNISKQTLPLDFARNKHIHNCW
RLMKL_PHOPR       LMENLKRMLRTDGKIVFSNNKRQFKMDLEKLNELGLDAKNISDKTLPMDFAKNKHIHNSW
RLMKL_VIBCH       LMTNLKRLLRPEGTIVFSNNKRHFKMDMEALHALGLNAQNISHQTLPLDFERNKQIHNCW
RLMKL_VIBC3       LMTNLKRLLRPEGTIVFSNNKRHFKMDMEALHALGLNAQNISHQTLPLDFERNKQIHNCW
RLMKL_VIBCB       LMTNLKRLLRAGGAIVFSNNKRHFKMDEAGLAELGLKAQNISSQTLPLDFSRNKQIHNCW
RLMKL_VIBPA       LMTNLKRLLRAGGTIVFSNNKRHFKMDEEGLAELGLKAQNISSQTLPLDFSRNKHIHNCW
RLMKL_VIBVY       LMKNLKRLLRENGTIVFSNNKRHFKMDMEAMEELGLDAKNISSQTLPLDFSRNKHIHNCW
RLMKL_AERHH       LMQHLKRLLAAGGTLVFSNNKRHFKMDLAGLEAIGLKAQNITGKTRPKDFERNQHIHNCW
RLMKL_AERS4       LMQHLKRLLAADGTLVFSNNKRHFKMDLAGLEAAGLKAQNITSKTRPKDFERNQHIHNCW
RLMKL_BUCAI       VMIHLKKILRHDGTIIFSSSTRNFEINFNCIKKMQLHAKKITNKIQSKDHLKNSNIYHSW
RLMKL_BUCAP       LMINLKQILRKDGNIIFSSSTHNFEIDLNNIKKINLYAKKITNLVKTKDFLKKN--YHSW
RLMKL_SHIFL       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SHIF8       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOLI       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOHS       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOLC       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECODH       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECO57       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECO5E       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECO24       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SHIDS       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SHIB3       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SHIBS       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SHISS       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOSM       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOL5       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOUT       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOK1       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_ECOL6       LMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_SALA4       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALTY       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALDC       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALEP       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALHS       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALNS       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALPA       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALPK       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALPB       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALG2       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALCH       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALSV       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALTI       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_SALAR       LMKDLKRLLRKGGTIMFSNNKRGFRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCW
RLMKL_CITK8       LMKDLKRLLRKGGTIMFSNNKRGFRMDLDGLAALGLKAQEITQKTLSQDFARNRQIHNCW
RLMKL_KLEP3       LMTDLKRLLRKGGTIMFSNNKRGFRMDHDGLAALGLKAQEISQKTLSQDFARNRQIHNCW
RLMKL_KLEP7       LMTDLKRLLRKGGTIMFSNNKRGFRMDHDGLAALGLKAQEISQKTLSQDFARNRQIHNCW
RLMKL_ENT38       LMSDLKRLLRKGGTIMFSNNKRGFRMDNDGLAALGLKAQEISQKTLSQDFARNRQIHNCW
RLMKL_CROS8       LMKDLKRLLRRDGTIMFSNNKRGFKMDHEGLAALGLKAQDITQKTLSQDFARNRQIHNCW
RLMKL_ERWT9       LMKDLKRLLRKNGTVMFSNNKRGFKMDFAGMEALGLVANEITTKTQSQDFARNRQIHNCW
RLMKL_YERPG       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPY       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPA       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPN       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPE       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPP       LMKELKWLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPS       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERP3       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERPB       LMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFARNRQIHNCW
RLMKL_YERE8       LMKELKRLLRRKGTIMFSNNKRGFQMDLDGIKALGLEAKEITAQTQSEDFARNRQIHNCW
RLMKL_SERP5       LMQDLKRLLRRNGTIMFSNNKRGFQMDMAGLSALGLEAKEITAQTQSQDFARNRQIHNCW
RLMKL_PECAS       LMKDLKRLLRRGGTIMFSNNKRGFQMDIAGLTALGLNAKEITAQTQSQDFARNRQIHNCW
RLMKL_PHOLL       LMRQLKRLLRRGGTLMFSNNKRGFKMDFAELEKVGLVAEEITSKTQSQDFARNRQIHNCW
RLMKL_PROMH       LMKHLKRLLRKGGTIMFSNNKRGFKMDHEALANIGLTAKEITQKTLSQDFARNRQIHNCW
RLMKL_SODGM       LMAQLKRLLRPGGTLMFSNNKRGFQLDEAGLAALGLRAQSITDRTRSPDFAHNRQIHLCW
RLMKL_HAEIE       LMSNLKRVLSNNGTIVFSNNKRGFKMNLVALEELGLSAIEISHKTLPLDFERNKQIHNCW
RLMKL_HAEIG       LMSNLKRVLSNNGTIVFSNNKRGFKMNLVALEELGLSAVEISHKTLPLDFERNKQIHNCW
RLMKL_HAEIN       LMRNLKRVLSNNGTIVFSNNKRGFKMNLVALEELGLSAIEISHKTLPLDFERNKQIHNCW
RLMKL_HAEI8       LMRNLKRVLSNNGTIVFSNNKRGFKMNLVALEELGLSAVEISHKTLPLDFERNKQIHNCW
RLMKL_HAES1       LMANLKRILRTNGTIVFSNNKRGFKMDIDGLQELELSAVEISAKTLPLDFERNKQIHNCW
RLMKL_HISS2       LMANLKRILRTNGTIVFSNNKRGFKMDIDGLQELELSAVEISAKTLPLDFERNKQIHNCW
RLMKL_ACTSZ       LMKNLKRILRPNGTIVFSNNKRGFKMDFDGLAQLGLNALEISAKTLPLDFERNKQIHNCW
RLMKL_MANSM       LMGNLKRILRPNGTIVFSNNKRGFKMDFEGLTRLGLKAEEISAKTLPLDFERNKQIHNCW
RLMKL_PASMU       LMTQLKRILRPNGTIVFSNNKRGFKMDVEGLAALGLSAVEISAKTLPLDFERNKQIHNCW
RLMKL_ACTPJ       LMTQLKRILTTDGTIVFSNNKRGFKMDFEGLAELGLQAENISHKTLPLDFERNPQIHNCW
RLMKL_ACTP2       LMTQLKRILTTDGTIVFSNNKRGFKMDFEGLAELGLQAENISHKTLPLDFERNPQIHNCW
RLMKL_ACTP7       LMTQLKRILTADGIIVFSNNKRGFKMDFEGLAELGLQAENISHKTLPLDFERNPQIHNCW
RLMKL_HAEDU       LMTQLKRILTSDGMIVFSNNKRGFKMDFNGLTALGLVAENISYKTLPLDFERDPHIHNCW
RLMKL_PSYIN       LLTSASQRLNKQGEIIFSNNKRGFKLDVDAIKALGFYIKDISQSSIPEDFRRNKKIHQCW
RLMKL_SHEB5       LLSSLVKLLSPTGELVFSNNKRKFKMDIETLTKMNINVTNIDDVTLPMDYKRNPHIHNTW
RLMKL_SHEB9       LLASLVKLLSPTGELVFSNNKRKFKMDIETLTKMNINVTNIDDVTLPMDYKRNPHIHNTW
RLMKL_SHEB8       LLSSLVKLLSPTGELVFSNNKRKFKMDIETLTKMNINVTNIDDVTLPMDYKRNPHIHNTW
RLMKL_SHEPC       LLGALVKLLSPTGELVFSNNKRKFKMDIETLTKMNIMVKNIDDITLPMDYKRNPHIHNTW
RLMKL_SHESW       LLSALVKLLSPTGELVFSNNKRKFKMDIETLTKMNITVKNIDDITLPMDYKRNPHIHNTW
RLMKL_SHESM       LLGMLIKLLSPNGEIVFSNNKRKFKMDTETLAKMKIKVENIDDLTLPMDYKRNPHIHNTW
RLMKL_SHESR       LLGMLIKLLSPNGEIVFSNNKRKFKMDTETLAKMKIKVENIDDLTLPMDYKRNPHIHNTW
RLMKL_SHESA       LLGMLIKLLSPNGEIVFSNNKRKFKMDTDTLVKMKIKVENIDDLTLPMDYKRNPHIHNTW
RLMKL_SHEON       LLGMLIKLLSPNGELVFSNNKRKFKMDTETLTKMKIKVQNIDDMTLPLDYKRNPHIHNTW
RLMKL_SHEDO       LLGKLIKLLSPKGELIFSNNKRKFKMDIEALTALGATVNNIDELCLPLDYKRNPHIHNVW
RLMKL_SHEFN       MLGGLIKLLSPNGELIFSNNKRKFKMDIEALNQAGIDVTNIDHLCLPLDYKRNPHIHNVW
RLMKL_SHEHH       MLTDVFKLLNPGGEIIFSNNKRKFKMEIAELEALGMSVKNIDNQTLPLDYKRNPHIHNTW
RLMKL_SHEPA       MLSDVFKLLNPGGEIIFSNNKRKFKMEIAALEAQGMSIKNIDNQTLPLDFKRNPHIHNTW
RLMKL_SHESH       LLSSLIKLLNPGGEIIFSNNKRKFKMEIEALEALNFTVKNIDNQTLPLDFKRNPQIHNTW
RLMKL_SHEWM       LLSSLIKLLNPNGEIIFSNNKRKFKMEIEALEALNFTVKNIDNQTLPLDFKRNPQIHNTW
RLMKL_SHELP       LLSALVKLLRPGGEILFSNNKRKFKMDSEALSALGLSITNLDKQTLPLDYKRNPHIHNTW
RLMKL_SHEAM       LLASLKKLLRPGGEIVFSNNKRKFKMDMEALAAAGLKAVNIDDKVLPMDYARNPQIHNCW
RLMKL_IDILO       LIKTATGMLKEDGVILFSNNRKKFRIDTEGLDKAGLEVNDQTQASIPEDFKRHKGIHHYY
RLMKL_FRATF       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATH       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATO       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATW       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATT       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRAT1       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATM       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRATN       LINLAMDSLKKDGILYFSNNYRRFKMSPQIL--EKFNCENIDKICLSRDFLSNKNIHNCW
RLMKL_FRAP2       LINLAMDSLKKDGVLYFSNNYRRFKMSQEII--AKFNCENIDKVCLSRDFLSNKNIHNCW
D0KZE4_HALNC      LVRSCMHLLSDDGTLIFSNNLKGFTLSSKLL--DEFRINDLSRKTLPGDFARTPNRRSVF
RLMKL_ACIBY       LIKRAMNRLTSEGTLYFSNNYRGFEMDEEIE--ALYDVEEITSETIGPDFKRNQKIHRAW
RLMKL_ACIBS       LIKRAMNRLTSEGTLYFSNNYRGFEMDEEIE--ALYDVEEITSETIGPDFKRNQKIHRAW
RLMKL_ACIBC       LIKRAMNRLTSEGTLYFSNNYRGFEMDEEIE--ALYEVEEITSETIGPDFKRNQKIHRAW
RLMKL_ACIAD       LLKRAMNRLSAEGTLYFSNNYRGFELDEEID--AIFYAQEITNDTIGPDFKRNQKIHRAW
RLMKL_PSYA2       LINRAMNRLTADGILYFSNNFTRFELDEQLT--ERYDIVDITQKTIGFDFDIKKPIHQSF
RLMKL_PSYCK       LINRAMNRLTADGILYFSNNFTRFELDEQLT--ERYDIIDITQKTIGFDFDIKKPIHQSF
RLMKL_PSYWF       LINRAMNRLANGGVIYFSNNFTKFELDEELY--DRYEVTEITSETIGFDFNPKKPIHHSF
RLMKL_DESPS       LLTLAMRRLSPGGLLIFSTNFRRFILDEKLA--EQFDVKDITRESIPLDFSRNEKIHFCW
G8QSR6_SPHPG      LIKACMMHLDPKGTLIFSCNYRKFKLDESLL--EEYDIENITPRTIGEDFERDQKIHYCF
F0RUX4_SPHGB      LIKACMMHLDPKGTLIFSNNFRKFRLDERLL--DEYDVQDITASTIAEDFARDQKIHYTF
RLMKL_ALCBS       LIRKIMRCLEPGGVLYFSCNYRRFQMDESIS--KWYAVEDISRWSIPEDFRRNEKIHYCY
C8WGP0_EGGLE      LLIGVSRLLSEEGEAVFSCNLRSFKPDEEALAKYGVTLEDITAQTIPHDFERNPRIHKCY
F7V0X9_EEGSY      LLIGVSRLLSEEGEVIFSCNLRTFKPDEEALAKYGVVLEDITAQTIPHDFERNPRIHKCY
E1QZ79_OLSUV      LIIGLSRLLTRNGRAIFSCNLRNFRPDVDKLERAGVALEDITEQTIPEDFRRNAKVHHAY
C8W7K3_ATOPD      LIIGISRLLTHGGVAIFSCNLRTFKPDVEKIERAGVVIEDITSKTIPEDFSRNQKIHHAY
F2N9W7_CORGP      LLIGVAHLLAPGGQAVFSTNLRTFRLDVHALERAGIEIRDITAETIPEDFARNPRIHHCY
C7N0P8_SLAHD      VIQQIVRILSPEGKLVLTCHDRRFNLSDKAFGGHGLTAQDITADTIGHDFTRTPKIHRAF
                  ::      *   *   ::     *  .                     *.         :

RLMKL_STRMK       ELKRLG---------------------
RLMKL_STRM5       ELKRLG---------------------
RLMKL_XANAC       RLTA-----------------------
RLMKL_XANC5       RLTA-----------------------
RLMKL_XANOM       RLTA-----------------------
RLMKL_XANOP       RLTA-----------------------
RLMKL_XANOR       RLTA-----------------------
RLMKL_XANCP       RLTA-----------------------
RLMKL_XANC8       RLTA-----------------------
RLMKL_XANCB       RLTA-----------------------
RLMKL_XYLF2       LLWR-----------------------
RLMKL_XYLFT       LLWR-----------------------
RLMKL_XYLFM       LLWR-----------------------
RLMKL_XYLFA       LLWR-----------------------
RLMKL_ALKEH       ELRHR----------------------
RLMKL_CHRSD       LIRHR----------------------
RLMKL_MARHV       HIRHQNS--------------------
RLMKL_PSEAE       RITVR----------------------
RLMKL_PSEA7       RITVR----------------------
RLMKL_PSEP1       RLQLR----------------------
RLMKL_PSEPK       RLQLR----------------------
RLMKL_PSEPG       RLQLR----------------------
RLMKL_PSEPW       RLQLR----------------------
RLMKL_PSEE4       QLRLR----------------------
RLMKL_PSEF5       KVTAR----------------------
RLMKL_PSEPF       KITAR----------------------
RLMKL_PSE14       KIMARA---------------------
RLMKL_PSEU2       KIMARS---------------------
RLMKL_PSESM       KITARA---------------------
RLMKL_PSEMY       RFTAR----------------------
RLMKL_PSEU5       KLQAR----------------------
RLMKL_METCA       RILAPDRQR------------------
RLMKL_PELCD       RITRR----------------------
RLMKL_ALLVD       VIQHPESASNRRNGSDDEDRHA-----
RLMKL_HYDCU       LFSRQ----------------------
RLMKL_CELJU       LIRH-----------------------
RLMKL_SACD2       KIQH-----------------------
RLMKL_MARMS       IIKNK----------------------
RLMKL_LEGPC       KIVMPHFADN-----------------
RLMKL_LEGPA       KIVMPHFADN-----------------
RLMKL_LEGPH       KIVMPHFADN-----------------
RLMKL_LEGPL       KIVMPHFADN-----------------
RLMKL_HAHCH       HIRHSA---------------------
RLMKL_DICNV       KIMHRSDGEQSAEK-------------
RLMKL_MAGMM       RITCA----------------------
RLMKL_ALTMD       VLRS-----------------------
RLMKL_PSEA6       VLTLNA---------------------
RLMKL_COLP3       SIKRTAT--------------------
RLMKL_PSEHT       LITHG----------------------
RLMKL_ALIF1       IITHKED--------------------
RLMKL_ALIFM       IITHKED--------------------
RLMKL_ALISL       IITHKED--------------------
RLMKL_PHOPR       IITHKED--------------------
RLMKL_VIBCH       LITHQS---------------------
RLMKL_VIBC3       LITHQS---------------------
RLMKL_VIBCB       LVTHAE---------------------
RLMKL_VIBPA       LVTHAE---------------------
RLMKL_VIBVY       VVTHKK---------------------
RLMKL_AERHH       IITHAEAQA------------------
RLMKL_AERS4       IITHAEAPAEA----------------
RLMKL_BUCAI       LIKHIK---------------------
RLMKL_BUCAP       LIKHI----------------------
RLMKL_SHIFL       LITAA----------------------
RLMKL_SHIF8       LITAA----------------------
RLMKL_ECOLI       LITAA----------------------
RLMKL_ECOHS       LITAA----------------------
RLMKL_ECOLC       LITAA----------------------
RLMKL_ECODH       LITAA----------------------
RLMKL_ECO57       LITAA----------------------
RLMKL_ECO5E       LITAA----------------------
RLMKL_ECO24       LITAA----------------------
RLMKL_SHIDS       LITAA----------------------
RLMKL_SHIB3       LITAA----------------------
RLMKL_SHIBS       LITAA----------------------
RLMKL_SHISS       LITAA----------------------
RLMKL_ECOSM       LITAA----------------------
RLMKL_ECOL5       LITAA----------------------
RLMKL_ECOUT       LITAA----------------------
RLMKL_ECOK1       LITAA----------------------
RLMKL_ECOL6       LITAA----------------------
RLMKL_SALA4       LIRAA----------------------
RLMKL_SALTY       LIRAA----------------------
RLMKL_SALDC       LIRAA----------------------
RLMKL_SALEP       LIRAA----------------------
RLMKL_SALHS       LIRAA----------------------
RLMKL_SALNS       LIRAA----------------------
RLMKL_SALPA       LIRAA----------------------
RLMKL_SALPK       LIRAA----------------------
RLMKL_SALPB       LIRAA----------------------
RLMKL_SALG2       LIRAA----------------------
RLMKL_SALCH       LIRAA----------------------
RLMKL_SALSV       LIRAA----------------------
RLMKL_SALTI       LIRAA----------------------
RLMKL_SALAR       LICAA----------------------
RLMKL_CITK8       LITAA----------------------
RLMKL_KLEP3       LITAA----------------------
RLMKL_KLEP7       LITAA----------------------
RLMKL_ENT38       LITAV----------------------
RLMKL_CROS8       LVTHQTKD-------------------
RLMKL_ERWT9       LITHAGKE-------------------
RLMKL_YERPG       LVTHSQEEK------------------
RLMKL_YERPY       LVTHSQEEK------------------
RLMKL_YERPA       LVTHSQEEK------------------
RLMKL_YERPN       LVTHSQEEK------------------
RLMKL_YERPE       LVTHSQEEK------------------
RLMKL_YERPP       LVTHSQEEK------------------
RLMKL_YERPS       LVTHSQEEK------------------
RLMKL_YERP3       LVTHSQEEK------------------
RLMKL_YERPB       LVTHSQEEK------------------
RLMKL_YERE8       LVTHSHEEK------------------
RLMKL_SERP5       LLTHAGEGK------------------
RLMKL_PECAS       LLTHAGEEK------------------
RLMKL_PHOLL       LLRHAGEEK------------------
RLMKL_PROMH       LLNHAGEE-------------------
RLMKL_SODGM       LISHADKDTFKSCH-------------
RLMKL_HAEIE       MIQHI----------------------
RLMKL_HAEIG       MIQHI----------------------
RLMKL_HAEIN       MIQHI----------------------
RLMKL_HAEI8       MIQHI----------------------
RLMKL_HAES1       IIRHQS---------------------
RLMKL_HISS2       IIRHQS---------------------
RLMKL_ACTSZ       LLTRKV---------------------
RLMKL_MANSM       IVEFV----------------------
RLMKL_PASMU       VVRLKADL-------------------
RLMKL_ACTPJ       IIRHIEN--------------------
RLMKL_ACTP2       IIRHIEN--------------------
RLMKL_ACTP7       IIRHIEN--------------------
RLMKL_HAEDU       IIRHIEN--------------------
RLMKL_PSYIN       ILTKHTD--------------------
RLMKL_SHEB5       LITHA----------------------
RLMKL_SHEB9       LITHA----------------------
RLMKL_SHEB8       LITHA----------------------
RLMKL_SHEPC       LITHA----------------------
RLMKL_SHESW       LITHA----------------------
RLMKL_SHESM       LITHA----------------------
RLMKL_SHESR       LITHA----------------------
RLMKL_SHESA       LITHA----------------------
RLMKL_SHEON       LITHADK--------------------
RLMKL_SHEDO       LLTHGK---------------------
RLMKL_SHEFN       LLTHAKK--------------------
RLMKL_SHEHH       LITHAG---------------------
RLMKL_SHEPA       LITHAG---------------------
RLMKL_SHESH       LLTHAE---------------------
RLMKL_SHEWM       LLTHGG---------------------
RLMKL_SHELP       LIQHA----------------------
RLMKL_SHEAM       VVTHG----------------------
RLMKL_IDILO       IISRA----------------------
RLMKL_FRATF       EIKYK----------------------
RLMKL_FRATH       EIKYK----------------------
RLMKL_FRATO       EIKYK----------------------
RLMKL_FRATW       EIKYK----------------------
RLMKL_FRATT       EIKYK----------------------
RLMKL_FRAT1       EIKYK----------------------
RLMKL_FRATM       EIKYK----------------------
RLMKL_FRATN       EIKYKK---------------------
RLMKL_FRAP2       EIKYKK---------------------
D0KZE4_HALNC      EIRHHDDT-------------------
RLMKL_ACIBY       KIQHPGLN-------------------
RLMKL_ACIBS       KIQHPGLN-------------------
RLMKL_ACIBC       KIQHPGLN-------------------
RLMKL_ACIAD       KIQHPHMN-------------------
RLMKL_PSYA2       EIRHRQSI-------------------
RLMKL_PSYCK       EIRHRQSL-------------------
RLMKL_PSYWF       EIRHKL---------------------
RLMKL_DESPS       EFRQK----------------------
G8QSR6_SPHPG      LIKFRSMAKKAPVKTGRKLVLKKSEQK
F0RUX4_SPHGB      LIKHRTVVTAKDAKPVIRAVRKK----
RLMKL_ALCBS       AIRHVEDA-------------------
C8WGP0_EGGLE      LVKRTQ---------------------
F7V0X9_EEGSY      LARRS----------------------
E1QZ79_OLSUV      IVRRTGNAAAELS--------------
C8W7K3_ATOPD      KISRKPRENG-----------------
F2N9W7_CORGP      IVDRSSDVDDEASWV------------
C7N0P8_SLAHD      LIGHE----------------------