CLUSTAL format seed alignment for MF_01860

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1141_BACVZ      MLFLHDVWVNWFEGEENGYNVCHFHEWRKEDTVELLDQTPLLRVPSVLFHYIENDLSELP
YJBA_BACSU       MLFLHDVWVNWFEGEENGYNVCHFHEWRKEDTVELLDQVPLLRVPSVLFHYIENDLSELP
Y3322_BACLD      MLFLHDVWVNWFEGEENGYNVCHFHEWRKEDSVELLDQVPLLRVSSVLFHYIENDLSELP
Y1067_BACP2      MLFLHDVWVNWFEGEENGYNVCHFHEWRKEDSVELLDQVPLLKVQSPLYDYIENDLSELP
Y808_GEOKA       MLYLHDIWVNWFEGEENGYNVCHFHEWRKDDQIELLDQVPLLKVSPALFHYIENSLSDLP
Y688_GEOTN       MLYLHDIWVNWFEGEENGYNVCHFHEWRKDDQIELLDQVPLLKVSPALFHYIENSLSDLP
Y2136_ANOFW      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDAIELLDQVPVLKVSAPLFHHLENSLAEIP
Y1040_BACAH      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1080_BACHK      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1098_BACAN      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1258_BACC0      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1074_BACCZ      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1335_BACC7      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDSTLYHYIENELLELP
Y1296_BACC1      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIENELLELP
Y1085_BACMK      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIENELLELP
Y1176_BACCR      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIENELLELP
Y1231_BACC4      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIENELLELP
Y4111_BACC2      MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIEDELLELP
Y893_BACCN       MLYLHDVWVNWFEGEENGYNVCHFYEWRKDDTIELLDQVPLLKVDATLYHYIENELLELP
Y1207_OCEIH      -MYLHDVWVNWFEGEENGYNVCHFHEWRKEDTIELLDQVPLLYISKELLHYIENDMHDLP
Y2536_BACSK      MVMMRDVWVNWFEGEENGYNVCPFHEWRSEDRIEVLDQVKLLKVDEKLMDYIEDQLLDLP
Y2872_BACHD      MVHMRDVWVNWFEGEENGYNVCDFFEWRSDDRIEVLDQVVVVRVSPPLFDYIENQMSDLP
                  : ::*:*************** *.***.:* :*:***. :: :   * .::*:.: ::*

Y1141_BACVZ      KELLDQVHQKSYVRKNHERTKLEYCFVVTDGIGIIAVDTIGYTIPVRKSRLIPRQEQLVY
YJBA_BACSU       KGLLEDVHQKSYIRKNHERTKLEYCFVVTDGIGILAVDTIGYTIPVRKSRLIPRQEQLVY
Y3322_BACLD      AELLNEVHQKAYIRKNHERTQLDHCFVVTDGIGILAVDTAGYTIPVRKSRLIPRQEQLVY
Y1067_BACP2      KTLLESVFEKSYIRKNHERRKLEYCFVVTDGIRIIAVDTIGYSIPVRKSRLIPRQEQLVY
Y808_GEOKA       KPLLDDVHQKAYVRKNHERIQLDYCFVVTDGAGVLAVDTIGYQIPIRKSRLIPRQEQLVY
Y688_GEOTN       KPLLDDVYQKAYIRKNHERIQLDYCFIVTDGVGILAVDTIGYHIPIRKSRLIPRQEQLVY
Y2136_ANOFW      KALLEDVYQKAYVRKNHERIQLDYCFIATDGYGIIAIDTIGYHIPIRKSRLIPRQEQLVY
Y1040_BACAH      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1080_BACHK      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1098_BACAN      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1258_BACC0      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1074_BACCZ      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1335_BACC7      QKMLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1296_BACC1      QKMLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1085_BACMK      QKLLEDVYHKAYIRKNHERLQQEYCFVVTDGKGIIAIDSIGYNVPIRKSRLIPRQEQMVY
Y1176_BACCR      QKMLKTYIIRLIFVKIMNVCSKSIALLLQNGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y1231_BACC4      QKMLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y4111_BACC2      QKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPRQEQMVY
Y893_BACCN       QQLLEDVHHKAYIRKNHERLQQEYCFVVTDGRGIIAVDTIGYNVPIRKSRLIPRQEQMVY
Y1207_OCEIH      KSLLDTIYKRGYTRKGQKRTVVEYAAVVTDGDNILAFDTVGYYIPIRKSRLIPRQEQLVY
Y2536_BACSK      MELLKEVFQKSYLRKNMSRIQLDYCFIATDGKRIIAVDTMGYKTPIRKSRLTPRQEQVVF
Y2872_BACHD      EDLLQDVYQKSYLRKNMSRIQLDYAFVASDGERIIAVDTMGYKTPIRKSRLTPRQEQLVY
                   :*.    :    *  .    . . :  :*  ::*.*: **  *:***** *****:*:

Y1141_BACVZ      EMVKDVEPESFQFEPAQLESSKEYHILSLAPEHVRGLTRKERQIKQLMFMALDQLKGLKN
YJBA_BACSU       EMVKDVEPETYEFEPKKLESSKEYHILSLAPEHVRGLTRKERQIKQLMFMALDQLKGLKN
Y3322_BACLD      EMVKDVEAETYEFAPEKLQSSKEYHILSLSPEHVRGLTRKERQLKQLLFMALDQLKGLQN
Y1067_BACP2      EMVKDVKAEEYEFSQDSLESSKEYHILSLPPQHISGLTRKERQLKQLMFMALDQLKGLQN
Y808_GEOKA       EMAAEAEERDYPLP----RYEKEYHILSPAPELMCGLTRKERQLKQLLFMALDQLYSTKN
Y688_GEOTN       EMAAEAEEQKYPLP----KYEKEYHILSPAPELMCGLTRKERQLKQLLFMALDQLYSTKN
Y2136_ANOFW      EMMKEQEVRTYPFQ----QSEKEYHILSPHPALMSGLTRKERQLKQLLFMALDQLYGTKN
Y1040_BACAH      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKN
Y1080_BACHK      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKN
Y1098_BACAN      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKN
Y1258_BACC0      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKN
Y1074_BACCZ      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKN
Y1335_BACC7      EMVENVQAEKYEFQVE--EMEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y1296_BACC1      EMVENVQAEKYEFQVE--EIEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y1085_BACMK      EMVENVQAEKYEFQVE--EIEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y1176_BACCR      EMVENVQAEKYEFQVE--ETEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y1231_BACC4      EMVENVQAEKYEFQVE--ETEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y4111_BACC2      EMVENVQAEKYEFQVE--ETEKEHHILSPSPFIMNGLTRKERQLKQLLFMALDQLHTTKN
Y893_BACCN       EMVENVQAEKYKFQME--ETEKEHHILSPSPHIMNGLTRKERQLKQLLFMALDQLHTTKN
Y1207_OCEIH      DMIENNKPQNFEFDNK--IHDKEYHMLSMPPEYVFGLTRKERQLKQLLMIGLDQLRTTNN
Y2536_BACSK      ETLTEQDVPYFQLEIP--LPAKDYHLLSPSPAELAGLTRKERQLKQLLLMVLDQLQTTGS
Y2872_BACHD      ELLQNESDICYDLQGH--EPKKEHHILSPDPMEMKGLTRKERQLKQLLYMALDQLFTSGN
                 :   : .   : :        *::*:**  *  : ********:***: : ****    .

Y1141_BACVZ      RAEIVYWYTEWNPHMYEQIKRMSFEEIWDMLYNETIEGWSDKHLAFCENLIKGQPFFEKL
YJBA_BACSU       RAEIGYWYTEWNPHMYEQIKRMSFEEIWDMLYNETIEGWSDKHLAFCENLIKGQPFFEKL
Y3322_BACLD      RAEIAYWYTEWNPYMYEQIKRMTFEEIWDMLFNETIDGWSDKHRDFCENLIKGQPFFEKL
Y1067_BACP2      RAEIAYWYTEWNPRMYNQIKRMSFEEIWNMLYNETIDGWSENHLAFCEKMIKGQPFFEKL
Y808_GEOKA       TAQMRYWYTEWAPEKYAAIQKMSFDEAWEQLYNETKYGWSERHEQLCENLIKGQPFFEKL
Y688_GEOTN       SAEVRYWYTEWAPEKYSDIQKMSFEEAWERLYEETKYGWSERHEQLCENLIKGQPFFEKL
Y2136_ANOFW      VAEVRYWYTEWAPEKYAYIQQMSFEEAWNGLYEEAKYGWSERHVHLCERLVKGQPFFEKL
Y1040_BACAH      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1080_BACHK      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1098_BACAN      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1258_BACC0      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1074_BACCZ      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKAGWSEKHEQLCERLVKGQPFFEKL
Y1335_BACC7      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYEEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1296_BACC1      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYEEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1085_BACMK      PAEIRYWFTEWDPSAYGMVQHMEFEDVWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKL
Y1176_BACCR      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSDKHEQLCERLVKGQPFFEKL
Y1231_BACC4      TAEIRYWFTEWDPSAYGMVQHMEFEDIWAKLYDEAKTGWSDKHEQLCERLVKGQPFFEKL
Y4111_BACC2      TAEIRYWYTEWDPSAYGTVQHMEFEDIWARLYDEAESGWSEKHEQLCERLVKGQPFFEKL
Y893_BACCN       PAEIRYWYTEWDPSAYGAVQHMEFEDVWKQLYEEAKNGWSEKHEQLCERLVKGQPFFEKL
Y1207_OCEIH      KEELRYWLTEWDPKQYPSIRYMDEEQVWTALYDGVKHGWSSAHEDLCSKLIRGQAFLERM
Y2536_BACSK      DAEIKYWCTEWDPLTYKKLQQKGRTEVWEQLLNGVRAGWSQRHYKLCEAMVKGHSFFEKL
Y2872_BACHD      EAEIRYWLTEWEPDRYDEIQGMDHHQAWETLYRDVRQGWSEHHYHFCESLIKGQAFFEKL
                   :: ** *** *  *  ::     : *  *   .  ***. *  :*. :::*:.*:*::

Y1141_BACVZ      WEME--QESKVN---
YJBA_BACSU       WEME--NESKVN---
Y3322_BACLD      WEIE--NESKVN---
Y1067_BACP2      WEME--NESKVN---
Y808_GEOKA       WEME--QEPKVN---
Y688_GEOTN       WETQ--QEPKVN---
Y2136_ANOFW      WEME--QEPKVN---
Y1040_BACAH      WEME--NEQKVN---
Y1080_BACHK      WEME--NEQKVN---
Y1098_BACAN      WEME--NEQKVN---
Y1258_BACC0      WEME--NEQKVN---
Y1074_BACCZ      WEME--NEQKVN---
Y1335_BACC7      WEME--NEQKVN---
Y1296_BACC1      WEME--NEQKVN---
Y1085_BACMK      WEME--NEQKVN---
Y1176_BACCR      WEME--NEQKVN---
Y1231_BACC4      WEME--NEQKVN---
Y4111_BACC2      WEME--NEQKVN---
Y893_BACCN       WEME--NEQKVN---
Y1207_OCEIH      WEAEMGNEQHTSNQK
Y2536_BACSK      WELE--HPERVK---
Y2872_BACHD      WELE--HGESVK---
                 ** :  :   ..