CLUSTAL format seed alignment for MF_01862

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSMC_ACIB3      -------MDPRSEVILRQ--QDYLKGRVLLINAPNDALVSQLPTEIDASVWTWNYADYQG
RSMC_ACIBY      -------MDPRSEVILRQ--QDYLKGRVLLINAPNDALVSQLPTEIDASVWTWNYADYQG
RSMC_ACIBC      -------MDPRSEVILRQ--HDYLKGRVLLINAPNDALVSQLPTEIDASVWTWNYADYQG
RSMC_ACIBT      -------MDPRSEVILRQ--QDYLKGRVLLINAPNDALVSQLPTEIDASVWTWNYADYQG
RSMC_ACIBS      -------MDPRSEVILRQ--QDYLKGRVLLINAPNDALVSQLPTEIDASVWTWNYADYQV
RSMC_ACIAD      -------MDPRSEVVLRQ--QQYLAIKILLINPPADELAQQLAHKHQVSVWTWNFADHQY
RSMC_PSEAE      -------MDPRSEVLLRQ--RHLFATPLLLAGLPADDLLAELP---QAQGWSWHAGEQAQ
RSMC_PSEAB      -------MDPRSEVLLRQ--RHLFATPLLLAGLPADDLLAELP---QAQGWSWHAGEQAQ
RSMC_PSEA8      -------MDPRSEVLLRQ--RHLFATPLLLAGLPADDLLAELP---QAQGWSWHAGEQAQ
RSMC_PSEA7      -------MDPRSEVLLRQ--RHLFAAPTLLAGLPADDLLAELP---LAHGWSWHAGEQAQ
RSMC_PSEMY      -------MDPRSEVLLRQ--AELFEGELLLAGLPADDLLGLLP---QAHGWSWHAGDQAQ
RSMC_PSEU5      -------MDPRSEVLLRQ--AELFGGRVLLAGLPADDLLGQLA---GATAWSWHAGEQQQ
RSMC_PSEP1      -------MDPRSEVLLRQ--AELFQGPLLIAGAPADDLLGQLP---QAQAWTWHAGDQAM
RSMC_PSEPK      -------MDPRSEVLLRQ--AELFQGPLLIAGAPADDLLGQLP---QAQAWTWHAGDQAM
RSMC_PSEPG      -------MDPRSEVLLRQ--AELFQGPLLIAGAPADDLLGQLP---QAQAWTWHAGDQAM
RSMC_PSEPW      -------MDPRSEVLLRQ--ADLFQGPLLIAGAPADDLLGQLP---KANAWTWHAGDQAM
RSMC_PSEE4      -------MDPRSEVMLRQ--AELFQGPLLIAGAPADGLLGQLP---KAHGWTWHAGDQAL
RSMC_PSEF5      -------MDTRSEVLLRQ--AELFQGSLLLAGLAADDLLGRLP---NARGWSWHAGDQAA
RSMC_PSEPF      -------MDPRSEVLLRQ--AELFQGSVLLAGLPADDLLGRLP---DAFGWCWHAGDQAA
RSMC_PSE14      -------MDPRSEVLLRQ--AELFQGSLLLVGLPADDLLGKLP---DARGWCWHAGDQAA
RSMC_PSEU2      -------MDPRSEVLLRQ--AELFQGSLLLVGLPADDLLGKLP---DARGWCWHAGDQAA
RSMC_PSESM      -------MDPRSEVLLRQ--PELFQGSLLLVGLPADDLLGKLP---NARGWCWHAGDQAA
RSMC_IDILO      -------MSAAILSMLGRQSAQPWANGSLLVIHPGGGELSALP---NASAWSFHAGHAAY
RSMC_ALCBS      -------MENTTQLLLRQ--SDALAGRNVLVVDANDPALKTLS----VDATVHVHADDYT
RSMC_CHRSD      -----MSAETPPCQLLER--QSEAYRDWLWVAPPHDAWLHTVG----GSVWSADATICQA
RSMC_HAEIN      ------MISLESQVLERHISFFDGKSVLFAGGISDSFPQTLASKCSSIQIWSCY----FD
RSMC_HAEIG      ------MISLESQVLERHLSFFDGKSVLFAGGISDNFPQTLASKCSSIQIWSCY----FD
RSMC_HAEIE      ------MISLESQVLERHLSFFDGKSVLFAGGISDNFPQTLASKCPSIQIWSCH----FD
RSMC_HAEI8      ------MISLESQVLERHLSFFDGKSVLFAGGISDNFPQTLASKCSSIQIWSCY----FD
RSMC_PASMU      ------MISLESQVLQRHLSFFEHKSVLFAGGINDQFPQQVPAR--SVKVWSWY----FD
RSMC_ACTSZ      ------MISLESQVLERHLSIFADKTLLFAGGVNDDFPVQIQKIAKTVTVWSWY----FD
RSMC_MANSM      ------MISLESQVLERHLPLFADKSVLLAGGVNDDFPQKIQSQCRSVKIWSWY----FD
RSMC_ACTPJ      ------MLSLESEVLTRHLPLFANKSILLFGDVRDRFADQIKANAKSVAVFSSY----FD
RSMC_ACTP2      ------MLSLESEVLTRHLPLFANKSILLFGDVRDRFADQIKANAKSVAVFSSY----FD
RSMC_ACTP7      ------MLSLESEVLTRHLPLFANKSILLFGDVRDRFADQIKANAKSVAVFSSY----FD
RSMC_HAEDU      ------MLSLKSEVLARHLPLFNGKSILLFGNVRDRFADQIRSISSHVAIFSHY----FD
RSMC_BUCAI      -----MLLSKNSQLILRHRKKFKTKKVFFSGNIQDDFPLSLSTMRTKINFHKYNDCIDFK
RSMC_BUCAP      -----MIFSKNSQLILRHQKIFKNKIVFFSGNIEDELPINLLTIKTKIHLQKSQNFLKIN
RSMC_ECOLI      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHIDS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO45      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECODH      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO81      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOL5      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTATSRAHTQQFHHWQVLS
RSMC_ECOUT      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOK1      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOL6      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO7I      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO57      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFQHWQVLS
RSMC_ECO5E      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFQHWQVLS
RSMC_ECOLC      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHIBS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHISS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHIB3      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHGQVLS
RSMC_ECO55      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOSE      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO24      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECO8A      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOHS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOLU      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHIFL      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SHIF8      ----MSAFTPASEVLLRHSDDLEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ECOSM      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_ESCF3      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLS
RSMC_SALA4      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAYTQQFHHWQALS
RSMC_SALSV      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAYTQQFHHWQALS
RSMC_SALPA      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAYTQQFHHWQALS
RSMC_SALPK      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAYTQQFHHWQALS
RSMC_SALTI      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAYTQQFHHWQALS
RSMC_SALHS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQALS
RSMC_SALPB      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQALS
RSMC_SALDC      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_SALEP      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_SALTY      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_SALG2      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_SALCH      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPALFECAASRAHTQQFHHWQVLS
RSMC_SALNS      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_SALAR      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFECAASRAHTQQFHHWQVLS
RSMC_ENT38      ----MSAFTPASEVLLRHSDDFEQSRILFAGDMQDDLPGRFECAASRAHTQQYHHWQLLS
RSMC_CITK8      ----MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARFESAASRVHTQQFHHWQLLS
RSMC_KLEP3      ----MSAFTPASEVLLRHSDDFESARVLFAGDLQDDLPARLDTAASRAHTQQFHHWQVLN
RSMC_KLEP7      ----MSAFTPASEVLLRHSDDFESARVLFAGDLQDDLPARLDTAASRAHTQQFHHWQVLN
RSMC_CROS8      ----MSGFSPASEVLLRHSDDFTESRVLFAGDMQDDLPARFDTAQSRAHTQQFHHWQVLS
RSMC_ERWT9      ----MSAFTPASEVILRHSDEFTQRRVLFAGDLQDDLPAQLETALSRVHTQQYHHWQILS
RSMC_YERPE      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPP      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPY      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPG      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPA      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPN      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERP3      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPS      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERPB      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVHTNQYHHWQLLS
RSMC_YERE8      ----MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGIRVHTNQYHHWQLLS
RSMC_SERP5      ----MSALTPASEVMLRHSDEFIERRVLFAGDLQDALPAQFEAADVRVHTQQYHHWQLLN
RSMC_PECAS      ----MSALTPASEVILRHSDEFLSRRVLFAGDLQDTLPAQFEAASVRVHCNQYHHWQQMA
RSMC_SODGM      ----MSALIPASEVILRHQDTFSDKQVVIAGDVQDLLPARLEARSVKVHTAWFHHRQTLA
RSMC_PHOLL      ----MSALTPASEVILRHREQFSSHHLLFAGDIQDTLATQIDAASVRVHTNQYHHWQSLI
RSMC_PROMH      ----MSSLSPASEVILRHLDHFADRHVLIAGDLQDTLASQIQAKSVRAYTNQYHQWLPLL
RSMC_ALIF1      -----MSYSAPSQITQRQLAYFEGKHVLIAGELIDDFPFELAKHCESTSIFTTNYSYYKQ
RSMC_ALIFM      -----MSYSAPSQITQRQLAYFEGKHVLIAGELIDDFPFELAKHCESTSIFTTNYSYYKQ
RSMC_ALISL      -----MSYSAPSQITQRQLAYFEGKHVLIAGELNDNFPLELDKHCASTSIFTTNYGYYKQ
RSMC_VIBCB      ----MSAYIAPSQIAQRQLEYFNGKHVLVAGEVEDLFPLELVAHCESVEVFTSNYSYYRQ
RSMC_VIBPA      ----MSAYIAPSQIAQRQLEYFNGKHVLVAGEVEDMFPLELTAHCESVEVFTSNYSYFRQ
RSMC_VIBVU      ----MSAYTAPSQIAQRQLDYFNGKHVLVAGEVEDLFPLELAEHCESVSVFTSNYSYFRQ
RSMC_VIBVY      ----MSAYTAPSQIAQRQLDYFNGKHVLVAGEVEDLFPLELAEHCESVSVFTSNYSYFRQ
RSMC_VIBCH      ----MQPYTAPSEIALRQLDYFADKHVLVAGEVEDRFPIELRQYCASVSVFTTHYGYYSQ
RSMC_VIBC3      ----MQPYTAPSEIALRQLDYFADKHVLVAGEVEDRFPIELRQYCASVSVFTTHYGYYSQ
RSMC_PHOPR      -----MSYTAASQVVARQLAFFEGRKVLIAGELSDAYPVELANVAQSVAVFTTNFGYHNS
RSMC_AERHH      ---MSSPISAVSQMLERNQALFVGKRLLVCGALEDDYPRQLATLTHSLTVFTTDYCYYRS
RSMC_AERS4      ---MSSPISAVSQMLERNQALFVGKRLLVCGTLEDDYPRQLAELASSLTVFTTDYCYYRS
RSMC_PSYIN      MSLANHTFSNPSRVLQRNESLFTNKNILVAGNIDDEYPLQLQALANSSTFCFSDYRYYSV
RSMC_ALTMD      -----MILSPQSQLLERNIALFDEGQWAFINPSDAYFLDGLKSQEVTVIHQYFDIFAECV
RSMC_PSEA6      ------MLSAASQVLLRSEELLEQGKWLLVNPTDGHVFSALSNPEVYGFHQFFDIYEQS-
RSMC_MARMS      -----MNLNSTSQLLVRNEEGL-VGKILFANPEDTYPLDLSRKADVYAWCQSKTYYDAL-
RSMC_PSET1      ----MSVLTNPSLLLLRNSEKLVGKSILVVNFVQDGFLAELKKRNPESKITAFSYNHANG
RSMC_COLP3      -MSCPMSLSNPSQILLRNSELLVAKVPLFINLPEDGFIEAYTEIHKPDTIHCFNTNFIDY
RSMC_HAHCH      ----MSQLSNPSQAFLRQRGQLSGR-ILLCSPPADAIAAELRQTGVEVSVLSWDHTAVNA
RSMC_MARHV      ----MSALPNTHEVLLRNAHLLNGR-PALLGVSDASLLPRCPVPGIAMTEHAGLWQILSH
RSMC_SHEB5      ------MLTNPSQVIIRNQDSLSQHKVLVLNHEADLLPKALLDVAASVDALALDYHHYLH
RSMC_SHEB8      ------MLTNPSQVIIRNQDSLSQHKVLVLNHEADLLPKALLDVAASVDALALDYHHYLH
RSMC_SHEB9      ------MLTNPSQVIIRNQDSLSQHKVLVLNHEADLLPKALLDVAASVDALALDYHHYLH
RSMC_SHEPC      ------MLTNPSQVIIRNQDSLNQHKVLVLNHEADLLPKALLDVAASVDALALDYHHYLH
RSMC_SHESW      ------MLTNPSQVIIRNQDSLNQHKVLVLNHEADLLPKALLDVAASVDALALDYHHYLH
RSMC_SHESM      ------MLTNPSQVIIRNQETLSQHKVLVLNHEADSLPKALLDVAQSVDALALDYHHYLH
RSMC_SHESR      ------MLTNPSQVIIRNQETLSQHRVLVLNHEADSLPKALLDVAQSVDALALDYHHYLH
RSMC_SHESA      ------MLTNPSQVIIRNQETLSQHRVLVLNHEADSLPKALLDVAQSVDALALDYHHYLH
RSMC_SHEON      ------MLTNPSQVIIRNQETLSQHKVLVLNHEADLLPKALLDVASSVDALALDYHHYLH
RSMC_SHEDO      ------MLSNSSQVILRNSDYFQHQDVLILNYEADTLGLSLLAHAKSVTALALDFNHYLQ
RSMC_SHEFN      ------MLTNPSQALIRNSKYFQQHSVLVLNYEADTFAHQCLEFADNVTALALDYNHHLT
RSMC_SHELP      ------MLSNPSQVVLRNIELFESKNVLLINHECDLLATALLEDAAKVTTLALDFNHFQR
RSMC_SHEHH      ------MLTNASQVLLRNRDLVKDQSVLVLNYEGDHLPKELLNTARSVCGLALDYHHHLM
RSMC_SHEPA      ------MLTNASQVLLRNSDLVKDQSVLVLNYESDHLPKELLATASSVCGLALDYHHHLM
RSMC_SHEPW      ------MLTNASQVLLRNSDLFKDHSVLVLNYEGDTLPKALLESASSVSALALDFHHHLI
RSMC_SHESH      ------MLTNPSQLILRNSDLFAGQNVLVLNYEGDLLPKQLLESAKKVTALSLDYHHHLI
RSMC_SHEWM      ------MLTNPSQLILKNSDLFTSQNVLVLNCEGDLLPKQLLESASCVTTLSLDFHHHLV
RSMC_SHEAM      ------MLSNPSELVTRNIEQLENQRVMLINIEADELGHHLTRHCSEVAALALDFNHFQA
                                            .                               

RSMC_ACIB3      FVNTGT----------------------PAHFSVEFPSQEFDQAIIFVPKSKELLNYILH
RSMC_ACIBY      FVNTGT----------------------PAHFSVEFPSQEFDQAIIFVPKSKELLNYILH
RSMC_ACIBC      FLNAGA----------------------TAHFSVEFPLQEFDQAIIFVPKSKELLNYILH
RSMC_ACIBT      FLNAGA----------------------TAHFSVEFPLQEFDQAIIFVPKSKELLNYILH
RSMC_ACIBS      FLNAGA----------------------TAHFSVEFPLQEFDQAIIFVPKSKELLNYILH
RSMC_ACIAD      FQHQSI----------------------QSDFAVTFPDQIPDQVIIFVPKSKELLSYLLH
RSMC_PSEAE      LDARFPG---------------------RSRFDTRAPTGAWTSAVLFLPKSRELTDYLLA
RSMC_PSEAB      LDARFPD---------------------RSRFDTRAPTGAWTSAVLFLPKSRELTDYLLA
RSMC_PSEA8      LDARFPG---------------------RSRFDTRAPTGAWTSAVLFLPKSRELTDYLLA
RSMC_PSEA7      LDARFPG---------------------RSRFDTRAPVGAWSAAVVFLPKSRELADYLLA
RSMC_PSEMY      LAARFAG---------------------RSRFDTQMPEGDYRAAVLFLPKSRELTDYLLQ
RSMC_PSEU5      LDKRFGG---------------------RCSFGVAPPQGVFDTAVLFLPKSRELTDYLLQ
RSMC_PSEP1      LESRFAG---------------------RSHYGVEAPEAAFESAVLFLPKSRELAAYLLN
RSMC_PSEPK      LESRFAG---------------------RSHYGVEAPEAAFDSAVLFLPKSRELAAYLLN
RSMC_PSEPG      LDSRFAG---------------------RSHYAVEPPDLPFDSAVLFLPKSRELAAYLLN
RSMC_PSEPW      LDARFAG---------------------RSHYGVDVPPVAFEAAVLFLPKSRELAAYLLN
RSMC_PSEE4      LESRFGN---------------------RCHHGVGVPEVAFDAAILFLPKSRELAAYLLN
RSMC_PSEF5      LEARFPG---------------------RSHFGVDAPAQSFDSAVLFLPKSKDLTDYLLN
RSMC_PSEPF      LDARFEG---------------------RSHFGVNVPERSFDTAVVFLPKAKDLTDYILN
RSMC_PSE14      LDARFEG---------------------RVDFGVEAPEAAFEAAVLFLPKARDLTDYLLN
RSMC_PSEU2      LDARFEG---------------------RVDFGVEAPQTGFEAAVLFLPKARDLTDYLLN
RSMC_PSESM      LDARFEG---------------------RVDFGVEAPEATFEAAVLFLPKARDLTDYLLN
RSMC_IDILO      WKAAGRP---------------------VFCQIQPPNLSHYDGVLFLVAKEKELNQYLLE
RSMC_ALCBS      IGAQ-------------------------QWAPAPTVPAGTDLLVLPLSKSLDRLRFLLN
RSMC_CHRSD      WRARGRP---------------------VHADLAPTLTAPVPGAVLFWPKTHALGEWWLL
RSMC_HAEIN      YART-----------------------QSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLI
RSMC_HAEIG      YART-----------------------QSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLL
RSMC_HAEIE      YART-----------------------QSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLL
RSMC_HAEI8      YART-----------------------QSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLI
RSMC_PASMU      YAKS-----------------------KSAVDFSLTCEEKADLMVFYWTKNKQEVQFQLM
RSMC_ACTSZ      YANAQGR--------------------KSAVDFSPVCDTQVDVIVYYWTKNKAEVQFQLM
RSMC_MANSM      YVNQIQG--------------------KSAVDFSVIFTGRADLIVYYWTKNKQEVQFQLM
RSMC_ACTPJ      YARQ-----------------------YADVSFGLYCEIKAELAVFYWTKNKQECQYQLL
RSMC_ACTP2      YARQ-----------------------YADVSFGLYCEIKAELAVFYWTKNKQECQYQLL
RSMC_ACTP7      YARQ-----------------------YADVSFGLYCEIKAELAVFYWTKNKQECQYQLL
RSMC_HAEDU      YARH-----------------------YNDVEFGLDCTTPANLGVFYWTKNKQECHYQLL
RSMC_BUCAI      KKIMNNNIV------------------HNNLLISQEMIQNCDVIIYYWPKDKSEAKFQLM
RSMC_BUCAP      NN--KNITF------------------YRKLLVSQDTVQDCNILIYYWPKNKSEARFQLF
RSMC_ECOLI      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SHIDS      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO45      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECODH      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO81      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOL5      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOUT      RQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOK1      RQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOL6      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO7I      RQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO57      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO5E      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOLC      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SHIBS      RQMGDNA--------------------RFSLVATVDDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SHISS      RQMGDNA--------------------RFSLVATVDDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SHIB3      RQMGDNA--------------------RFSLVATVDDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO55      RQMGDNA--------------------RFSLVATVDDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOSE      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO24      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECO8A      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOHS      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOLU      RQMGDNA--------------------RFSLVATADDVADCNTLIYYWPKNKPEAQFQLM
RSMC_SHIFL      CQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SHIF8      CQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ECOSM      RQMGDNA--------------------RFSLVATANDVADCDTLIYYWPKNKPEAQFQLM
RSMC_ESCF3      RQMGDNA--------------------RFSLVATADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALA4      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALSV      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALPA      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALPK      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALTI      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALHS      RQMGENV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALPB      RQMCDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALDC      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALEP      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALTY      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALG2      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALCH      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALNS      RQMGDNV--------------------RFSLVAQASDVADCDTLIYYWPKNKPEAQFQLM
RSMC_SALAR      RQMGDNV--------------------RFSLVAQACDIADCDTLIYYWPKNKPEAQFQLM
RSMC_ENT38      RQMEDRV--------------------RFSLVAEQSDVADCDTLIYYWPKNKPEAQFQLM
RSMC_CITK8      QLMGEKA--------------------RFSLVAHADDVADCDTLIYYWPKNKPEAQFQLM
RSMC_KLEP3      RQMGDNV--------------------RFSLVAEAADVADCDTLIYYWPKNKPEAQFQLM
RSMC_KLEP7      RQMGDTV--------------------RFSLVAEAADVAECDTLIYYWPKNKPEAQFQLM
RSMC_CROS8      KPMGDNA--------------------RYGLVADAEIVADSDTLIYYWPKNKPEAQFQLM
RSMC_ERWT9      RVLGENA--------------------HYGLFASAETLADCDTLVYYWPKNKPEAQYQLQ
RSMC_YERPE      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPP      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPY      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPG      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPA      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPN      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERP3      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPS      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERPB      NTLEENV--------------------QFGLLATAETLAACDTLIYYWPKSKQEAQFQLA
RSMC_YERE8      NTLDENV--------------------QFGLVATPETVAACDTLVYYWPKSKQEAQFQLA
RSMC_SERP5      RAMGDNV--------------------QYGLTVDAAFVAECDTLIYYWPKSKQEAQFQLC
RSMC_PECAS      KPLGDNA--------------------QYSLVADAELVADSDTLIYYWPKSKQEAEFQLC
RSMC_SODGM      RALGEQAV-------------------QFGLVADAALGGGCDTLIYYWPKNKPEALFQLT
RSMC_PHOLL      RTLGESA--------------------WFGLVAEKAFTQGCDTLIYYWPKSKQEARFQLR
RSMC_PROMH      KSMGDNA--------------------FFGLAADQSFVKYCDTLIYFWPKNKNEATFQLR
RSMC_ALIF1      FAGHNSI--------------------QCYFGSELTEPTNVDMILLYWPKAKAEAEYLLT
RSMC_ALIFM      FAEHDSI--------------------HCYFGSELTETTNADMILLYWPKAKAEAEYLLT
RSMC_ALISL      FSENPKI--------------------NCYFGTELIEESHADMILLYWPKAKAEAEYLLT
RSMC_VIBCB      IRTSDKV--------------------KSHFGSEFDIETQADMVLLYWPKAKAEAEYLLA
RSMC_VIBPA      IRHSDKI--------------------KSHFGSEFDVETQADMLLLYWPKAKAEAEYLLA
RSMC_VIBVU      IRAHSTI--------------------TSYFGSQLEADSQADLLLLYWPKAKAEAEYLLA
RSMC_VIBVY      IRGHSTI--------------------TSYFGSQLEADSQADLLLLYWPKAKAEAEYLLA
RSMC_VIBCH      LKAYPEI--------------------TRYFGEQLTADLNADLILLYWPKAKQEAEYLLA
RSMC_VIBC3      LKAYPEI--------------------TRYFGEQLTADLNADLILLYWPKAKQEAEYLLA
RSMC_PHOPR      MSRHDNI--------------------DCHFGVQLDAKLDIDMLLIYWPKAKAEADYLMS
RSMC_AERHH      QQAALGDA--------------------ILFDHQLGGAPRFDALLLLMPKAKAEAQYLLA
RSMC_AERS4      QQATLGDA--------------------ILFDHQLGGAPRFDALLLLMPKAKAEAQYLLA
RSMC_PSYIN      LKDKLTTSE-------------------VHFTDNYQGETKFDLLLIFLPKAKQETLYLLA
RSMC_ALTMD      RVIPSASFDSRDITSKGFEVSQKVGNHTHIFTPFVALEKSHTDVMISLPKAKTHFQMLLR
RSMC_PSEA6      --IASAKAQGR--------------DTQHQFVAAYDTDASFDGAVLYLPKAKAHGQMLLA
RSMC_MARMS      --LRVGFADEK---------------LFLSEQWALEHGSDFDHIVIYQPKAKELLDYLLA
RSMC_PSET1      EFAKNTPGVDV-------------------CVNHCISGNDFDLVILYYPKSKPEVLMALD
RSMC_COLP3      QAITKKHCSPT-----------KTKNVKATFASTYQTTSCHDLVIIAFPKSKAELNFTLA
RSMC_HAHCH      CRGAVAEEWLF-------------TDLALPADAQW------DQIALFMPKARELLDLMLS
RSMC_MARHV      DTDWAGCFGYE-------------PDRQ--QQGSC------DTVVVFLPKARAECELRLA
RSMC_SHEB5      LAPHANTKLRC-------------YFGHDLPHQDPLEREKYDTVIVYFPKAKPLAPYLFN
RSMC_SHEB8      LAPHANSKLRC-------------YFGHDLPHQDPLEREKYDTVIVYFPKAKPLAPYLFN
RSMC_SHEB9      LAPHANSKLRC-------------YFGHDLPHQDPLEREKYDTVIVYFPKAKPLAPYLFN
RSMC_SHEPC      LVPHANSKLRC-------------YFGHELPHQDPIKPEKYDTVIVYFPKAKPLAPYLFT
RSMC_SHESW      LVPHANSKLRC-------------YFGHELPHQDPIKPEKYDTVIVYFPKAKPLAPYLFT
RSMC_SHESM      LAPQANAKLRC-------------YFGHQLPHQD-----KYDTVIVYFPKAKPLAPYLFN
RSMC_SHESR      LAPQANAKLRC-------------YFGHQLPHQD-----KYDTVIVYFPKAKPLAPYLFN
RSMC_SHESA      LAPQANAKLRC-------------YFGHQLPHQD-----KYDTVIVYFPKAKPLAPYLFN
RSMC_SHEON      LAPQANNKLRC-------------YFGHQLPHQN-----KYNTVIVYFPKAKPLAPYLFN
RSMC_SHEDO      LAAKEQPQLAC-------------FFGHTLPSSFA--GKTFDSVIVFFPKAKSLAPYLFE
RSMC_SHEFN      LSSCANEKLQS-------------YFGHQLPESLA--DTKFDSVIIYFPKAKPLMGYLLQ
RSMC_SHELP      IKSHENARLQC-------------HFGHQLPSTQ-----TFDAVVLFYPKSKSLAPYLLN
RSMC_SHEHH      MQPYAAANLTL-------------HFGHQLPNDES-----FDTVIVYFPKAKALAPYLFN
RSMC_SHEPA      MQPYAAANLTL-------------HFGHQLPTDEC-----FDTVIVYFPKAKALAPYLFN
RSMC_SHEPW      MQPYAAKNLQL-------------YFGHQLPTQEC-----FDSVIVYFPKAKALAPYLFN
RSMC_SHESH      MSPYAEQNLAL-------------HFGHMLPDEEQ-----FDTVIIYYPKAKALASYLLN
RSMC_SHEWM      MSQHSSPNLTL-------------HFGHQLPNADQT----FDSVIIYYPKAKALAGYLLN
RSMC_SHEAM      QPS-GKSGFRC-------------EFGHQWSRDEK-----FDVVVVYFPKAKALAPYLFA
                                                                .*        : 

RSMC_ACIB3      VVMSHLKTDQSVFLVGEKKGGVERAAKQLQNFGTI-LKLDSARHCQLWHLKI-EKIEKIK
RSMC_ACIBY      VVMSHLKTDQSVFLVGEKKGGVERAAKQLQNFGTI-LKLDSARHCQLWHLKI-EKIEKIK
RSMC_ACIBC      VVMSHLKIDQSVFLVGEKKGGVERAAKQLQSFGKI-LKLDSARHCQLWHLKI-EKTEKIK
RSMC_ACIBT      VVMSHLKIDQSVFLVGEKKGGVERAAKQLQSFGKI-LKLDSARHCQLWHLKI-EKTEKIK
RSMC_ACIBS      VVMSHLKIDQSVFLVGEKKGGVERAAKQLQSFGKI-LKLDSARHCQLWHLKI-EKTEKIK
RSMC_ACIAD      VVVSHLPAGQHIFLVGEKKGGVERASKQLQSYGKT-VKLDSARHCQLWQTTI-ETTEQLK
RSMC_PSEAE      SLAARLP-GGELFLVGEKRGGIERASKQLAAYGKP-RKLDSARHCQLWQVRI-EQAPAEP
RSMC_PSEAB      SLAARLP-GGELFLVGEKRGGIERASKQLAAYGKP-RKLDSARHCQLWQVRI-EQAPAEP
RSMC_PSEA8      SLAARLP-GGELFLVGEKRGGIERASKQLAAYGKP-RKLDSARHCQLWQVRI-EQAPAEP
RSMC_PSEA7      SLAARLP-GGELFLVGEKRGGIERASKQLAAYGRP-RKLDSARHCQLWQVQV-EQAPAEP
RSMC_PSEMY      ALASRLT-GRPLYLVGEKRGGIERAAKQLAVYGKP-RKLDSARHCQLWSVQI-EQAPATP
RSMC_PSEU5      TLAARLP-GRPLYLVGEKRGGIERAAKQLGSFGRA-RKLDSARHCQLWQVEV-EQAPAAP
RSMC_PSEP1      TLASRLA-GRELYLVGEKRGGIEGAAKQLAAFGKP-RKLDSARHCQLWQVTI-DQAPQAK
RSMC_PSEPK      ALASRLA-GRELYLVGEKRGGIEGAAKQLQAFGKP-RKLDSARHCQLWQVTI-DQAPQAK
RSMC_PSEPG      ALASRLA-GRELYLVGEKRGGIEGAAKQLQAFGKP-RKLDSARHCQLWQVTI-DQAPQAK
RSMC_PSEPW      ALASRLG-GGELYLVGEKRGGIEGAAKHLQALGKP-RKLDSARHCQLWQVTV-DNAPEAK
RSMC_PSEE4      ALAARLA-GRELYLVGEKRGGIEGAAKQLQAFGKP-RKLDSARHCQLWQVTV-DHAPEAK
RSMC_PSEF5      ALASRLA-GRELYLVGEKRSGVESAAKQLNPFGKP-RKLDSARHCQLWQVTV-ANAPEPL
RSMC_PSEPF      AVASRLA-GREVYLVGEKRSGIEGASKQLNPFGKP-RKLDSARHCQLWQVTV-ANAPEAK
RSMC_PSE14      ALASRLA-GRELFLVGEKRGGIEAAAKQLSPFGRA-RKLDSARHCQLWQVTV-ENAPQAV
RSMC_PSEU2      ALASRLA-GRELFLVGEKRGGIEAAAKQLSPFGRA-RKLDSARHCQLWQVTV-EHAPQAV
RSMC_PSESM      ALASRLA-GRELFLVGEKRGGIEAAAKQLSPFGRA-RKLDSARHCQLWQVTV-ENAPQAV
RSMC_IDILO      QLASLPT-GTPVWFAGEKRSGIQPLMKHLPAWLQPPQKLASANHCLLFASERNEQVHQSA
RSMC_ALCBS      WLAGEIAEPTELWLIGPTKGGIRGALKYLEAHVDGTMLEDSARHCKLYSGLL------QP
RSMC_CHRSD      ALCAALPEGTPLQVVGEHQGGVKRVLKSLAALGLGCRKVDSARRCTLYATRT------AR
RSMC_HAEIN      QLLAQASIGQEILIIGENRCGVRSVEKTLSPYGEI-AKIDSARRCGLYHFSL-----QNK
RSMC_HAEIG      QLLAQASIGQEILIIGENRCGVRSVEKTLAPYGEI-AKIDSARRCGLYHFSL-----QNK
RSMC_HAEIE      QLLAQAPIGQEILIIGENRCGVRSVEKTLAPYGEI-AKIDSARRCGLYHFSL-----QNK
RSMC_HAEI8      QLLAQASIGQEILIIGENRCGVRSVEKTLAPYGEI-AKIDSARRCGLYHFSL-----QNK
RSMC_PASMU      QLLAQAPIGQEMLIVGENRCGVRSVEKMLDAYGDI-AKIDSARRCGLYHFCL-----KNT
RSMC_ACTSZ      QLLANGRDNQEILIVGENRCGVRSAEKMLSAFGDI-GKIDSARRCGLYHFRL-----KKR
RSMC_MANSM      QLLANAPVGQEVLIIGENRSGVRSAEKMLAHFGDI-GKIDSARRCGLYHFTL-----QKQ
RSMC_ACTPJ      QWLSQVDVGQEMLIIGENRAGVRSVEKLLEPYGNI-AKIDSARRCGLYHFEL-----QSV
RSMC_ACTP2      QWLSQVDVGQEMLIIGENRAGVRSVEKLLEPYGNI-AKIDSARRCGLYHFEL-----QSV
RSMC_ACTP7      QWLSQVDVGQEMLIIGENRAGVRSVEKLLEPYGNI-AKIDSARRCGLYHFEL-----QSV
RSMC_HAEDU      QWLSQTAIGQQMLIIGENRAGVRSVEKLLSPFGQI-AKIDSARRCGLYHFEL-----QTI
RSMC_BUCAI      NIISCSPINTEIFIVGNNSSGVKSAPLMLKKWIEL-EKIDSAKHSILISGLI-----KKK
RSMC_BUCAP      NILSFLPIKSEIFIVGSNSSGVKSAKLILEESIKL-KKIDNANHSILMSGIL-----INK
RSMC_ECOLI      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHIDS      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO45      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECODH      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO81      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOL5      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOUT      NLLSLLPVGTDIFVVGENRSGVRIAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOK1      NLLSLLPVGTDIFVVGENRSGVRIAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOL6      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO7I      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO57      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO5E      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOLC      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHIBS      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHISS      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHIB3      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO55      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOSE      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO24      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECO8A      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOHS      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOLU      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHIFL      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SHIF8      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ECOSM      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_ESCF3      NLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYFGRL-----EKQ
RSMC_SALA4      NILSLMPVGSDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALSV      NILSLMPVGSDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALPA      NILSLMSVGSDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALPK      NILSLMSVGSDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALTI      NILSLMPVGSDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALHS      NILSLMPVGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALPB      NILSLMPSGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALDC      NILSLMPSGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALEP      NILSLMPSGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALTY      NILSLMPSGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALG2      NILSLMPSGVDVFVVGENRSGVRSAEPMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALCH      NILSLMPSGSDVFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALNS      NILSLMPSGSDVFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_SALAR      NILSLMPSGADIFVVGENRSGVRSAEQMLADYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_ENT38      NLLSMMPVGCDIFVVGENRSGVRSAESMLAEYATL-NKIDSARRCGLYHGRL-----DKQ
RSMC_CITK8      NILSLLPLGTDIFVVGENRSGVRSAEQMLADYAPL-NKIDSARRCGLYHGRL-----EKQ
RSMC_KLEP3      NLLSLLPVGIDIFVVGENRSGVRSAEQMLAEYAPL-NKIDSARRCGLYHGRL-----EKQ
RSMC_KLEP7      NLLSLLPVGSDIFVVGENRSGVRSAEQMLAEYAPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_CROS8      NLLSLLPVGTDVFVVGENRSGVRSAEAMLEAHCPL-NKVDSARRCGLYHGRL-----EKQ
RSMC_ERWT9      NLLALLPVGSDIFVVGENRSGVRSAEQMVADWAKL-EKIDSARRCGLYHGRL-----DSR
RSMC_YERPE      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPP      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPY      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPG      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPA      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPN      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERP3      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPS      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERPB      NLLSILPVGTDIFVVGENRSGVRSAEEMLADFAQL-AKIDSARRCGLYHGRL-----DKQ
RSMC_YERE8      NLLSLLPVGCDVFVVGENRSGVRSAEEMLSGFAQL-TKIDSARRCGLYHGRL-----DKQ
RSMC_SERP5      NILALLPVGTDVFVVGENRSGVRSADQMVEDYATL-VKIDSARRCGLYHGRL-----DTQ
RSMC_PECAS      NLLSLLPVGAEIFVVGENRSGVRSAETVLSDFVEL-VKIDSARRCGLYHGRI-----DKQ
RSMC_SODGM      NLLSLLPLGCDVFVVGENRSGVRSAEPMLAAWCPL-AKIDSARRCGLYHGEL-----VQQ
RSMC_PHOLL      SLFSVLPKGINIFIVGENRSGVRSVDKLMDGMATF-RKIDSARRCSLFYGQL-----EHE
RSMC_PROMH      SLCASLSVGTEIFIVGENRSGVKSATELMNGIAKL-KKIDSARRCSLFFGSL-----TYQ
RSMC_ALIF1      MLLAKLGKNTEIVVVGENRSGVKSIEKMFADFGPI-NKFDSARRCSFYWGQC----TEEA
RSMC_ALIFM      MLLAKLGKSTEIVVVGENRSGVKSIEKMFADFGPI-NKFDSARRCSFYWGQC----TEEA
RSMC_ALISL      MLLAKLGKDTEIIVVGENRSGVKSVEKMFANFGPM-NKLDSARRCSFYWGQC----TETA
RSMC_VIBCB      MLMTKLGINTEIVVVGENRSGIKSIEKMFKEYGPV-KKYDSARRCSFYWGTC----LNEP
RSMC_VIBPA      MLMAKLGVNTEIVVVGENRSGVKSIEKMFKEYGPV-NKYDSARRCSFYWGNC----LNEP
RSMC_VIBVU      MLLAKLGSGCEIVVVGENRSGVKSIEKMFQAYGPV-NKYDSARRCSFYWGQC----NTQP
RSMC_VIBVY      MLLAKLGSGCEIVVVGENRSGVKSIEKMFQAYGTV-NKYDSARRCSFYWGQC----NTQP
RSMC_VIBCH      MLLAKLGTGTEIVVVGENRSGVKSIEKMFAAYGPI-HKYDSARRCSFYWGHC----VHTP
RSMC_VIBC3      MLLAKLGTGTEIVVVGENRSGVKSIEKMFAAYGPI-HKYDSARRCSFYWGHC----VHTP
RSMC_PHOPR      MLLAKFGPETEICIVGENRSGVRSAEKMFQPYGPL-TKYDSARRCSFYWGRC----DNEV
RSMC_AERHH      MMTPLLEAGAELFLAGENRGGINGADKLLAPYGDKPVKRDSARRCSLYHGELS----KPV
RSMC_AERS4      MMTPLLEAGADLFLAGENRGGINGADKLLAPYGNKPVKRDSARRCSLYHGELS----KPV
RSMC_PSYIN      NLTPHLQPGASIILVGEKKCGIKSADSLLASYSNRINMIDSARHCSILHAELN----QPV
RSMC_ALTMD      MAASMVGQNGRIHVVGENKGGIKSAAKLMQQYGAT-QKVDSARHCSLITVIV----EAPH
RSMC_PSEA6      NIVACLKPGGTLLVVGENKGGIKSAAKLLTPYSDNVNKIDSARHCAMFAAVV----DKPV
RSMC_MARMS      SVLPLLKEGGQIWLVGDNKSGVKSSMKRLEAGLDEVGKRDGAKHCLLYTGYK----RRPT
RSMC_PSET1      NIRAVITADAELLVVGENKSGVKSIEKQLTDKANFSNKIDSAKHCVLYSFAE----LKQL
RSMC_COLP3      MITHCINDETKIILVGEKKGGIQSAAKLTQHIFSCCQKVDAARHCLLFVGLFQP--ERLS
RSMC_HAHCH      VVAPALKHAQHIWLVGEKREGVESAAKRLAKEDWDATKVDSARHCQVWSLTPP----ADW
RSMC_MARHV      LARYLGKPGAALVVIGEKKEGIAGAIKQFSVVAGEVVKVDSARHCQVWCGRNT----QPL
RSMC_SHEB5      LAANHLVPNGQLLVVGENKGGIKSLVKLLPEYFATGMKLDNARHCLLFGSSLE----GSA
RSMC_SHEB8      LAANHLVPNGQLLVVGENKGGIKSLVKLLPEYFATGMKLDNARHCLLFGSSLE----GSA
RSMC_SHEB9      LAANHLVPNGQLLVVGENKGGIKSLVKLLPEYFATGMKLDNARHCLLFGSSLE----GSA
RSMC_SHEPC      LAANHLVPNGQLLVVGENKGGIKSLVKLLPEYFATGMKLDNARHCLLFGSNLE----GRA
RSMC_SHESW      LAANHLVPNGQLLVVGENKGGIKSLVKLLPEYFATGMKLDNARHCLLFGSNLE----GRA
RSMC_SHESM      LAAQHLVADGQLLVVGENKGGVKSLVKLLPKYFATGVKLDNARHCLLFGSSLI----DTA
RSMC_SHESR      LAAQHLVADGQLLVVGENKGGVKSLVKLLPKYFATGVKLDNARHCLLFGSSII----DTA
RSMC_SHESA      LAAQHLVADGQLLVVGENKGGVKSLVKLLPKYFATGVKLDNARHCLLFGSSLI----DTA
RSMC_SHEON      LAAQHLVPNGQLLVVGENKGGIKSLVKLLPNYFAAGVKLDNARHSLLFGSSLI----DTA
RSMC_SHEDO      LAANHLNIDGQLMIVGDNKGGIKSVAKLIPDCFSAPVKRDNARHCLLYTCQLE----RQG
RSMC_SHEFN      LAAQHLNVDGQLIIVGENKGGIKSIAKLTPDYYSQPIKQDNARHCLVYVSYLI----QAA
RSMC_SHELP      LAGRHLIPGGELVIVGEKKGGIRSITKQLPDYFDGGIKLDNARHCMLYSSSLL----SEA
RSMC_SHEHH      LAAKHLKPQGQLIVVGENKGGIKSLPKQLPSYFDKPFKADNARHCIVFLSELN----AAA
RSMC_SHEPA      LAAKHLKPQGQLIVAGENKGGIKSLPKQLPSYFDKAFKVDNARHCILFTSELN----SPA
RSMC_SHEPW      LAGKHLKPQGQLIVVGENKGGIKSLPKQLPDYFDKAFKADNARHCIVFTSELN----REA
RSMC_SHESH      LAGVHLKPNGQLLVVGENKGGIRSIVKQVPDYFDSPFKQDSARHCLLYVSQLV----EKA
RSMC_SHEWM      LAGQHLKAEGELIVVGENKGGVKSIVKQIPDYFDTPFKRDNARHCLLFTSQLT----QKA
RSMC_SHEAM      LAAWHLRPDGTLLITGENKGGIRSVDKLLGNAFSPACKIDNARHCLLYSATLV----AEA
                           : . *    *:                   *.:. .             

RSMC_ACIB3      PLESWLKTYTVQVNG---QELTICALPGVFSQTHLDVGTAVLLPYLNQVKS------GRI
RSMC_ACIBY      PLESWLKTYTVQVNG---QELTICALPGVFSQTHLDVGTAVLLPYLNQVKS------GRI
RSMC_ACIBC      PLESWLKTYTVQVNE---QELTICALPGVFSQTHLDVGTAVLLPYLNQVKS------GRI
RSMC_ACIBT      PLESWLKTYTVQVNE---QELTICALPGVFSQTHLDVGTAVLLPYLNQVKS------GRI
RSMC_ACIBS      PLESWLKTYTVQVNE---QELTICALPGVFSQTHLDVGTAVLLPYLNQVKS------GRI
RSMC_ACIAD      PLEQWLKHYSVKNEN---IQLEIYALPGVFSQNHLDIGTAVLLPYLNQIKL------GKI
RSMC_PSEAE      DLHALAQRYSLPLAD---GELQVVSLPGVFSHGRLDRGSALLLGQLQALPG------GHL
RSMC_PSEAB      DLHALAQRYSLPLAD---GELQVVSLPGVFSHGRLDRGSALLLGQLQALPG------GHL
RSMC_PSEA8      DLHALAQRYSLPLAD---GELQVVSLPGVFSHGRLDRGSALLLGQLQALPG------GHL
RSMC_PSEA7      DLLALAQRYSLPLAD---GELQVVSLPGVFSHGRLDRGSALLLEHLDDLPK------GHL
RSMC_PSEMY      DLDALAQVYSLQLAD---GPLQVVSLPGVFAHGRLDRGSALLLEHLDSLPQ------GHL
RSMC_PSEU5      NLDALARHFTLQLAD---GPLEVVSLPGVFSHGRLDLGSALLLEHLDNLPG------GRL
RSMC_PSEP1      PLESLAERFELALED---GPLQVVSLPGVFSHGRLDRGTALLLKHLDGLPG------GHM
RSMC_PSEPK      PLESLAERFELALED---GPLQVVSLPGVFSHGRLDRGTALLLKHLDGLPG------GHM
RSMC_PSEPG      PLESLAERFELALED---GPLQVVSLPGVFSHGRLDRGTALLLKHLDGLPD------GHM
RSMC_PSEPW      PLESLAERFALELED---GPLQVVSLPGVFSHGRLDRGTALLLKHLDNLPV------GHV
RSMC_PSEE4      PLESLAERFELPLED---GPLQVVSLPGVFSHGRLDKGTALLLEHLDGLPS------GHV
RSMC_PSEF5      TLQSLAQEYELPLAE---GPLKVISLPGVFSHGRLDRGTALLLEHLDHLPA------GHL
RSMC_PSEPF      PLESLAQTYELPLAE---GPLKVISLPGVFSHGRLDRGSALLLEHLDKLPS------GHL
RSMC_PSE14      TLESLARPYQIDLQD---GPLTVVSLPGVFSHGRLDRGSALLLENIDKLPS------GNL
RSMC_PSEU2      SLDSLARPYQIELQD---GPLTVVSLPGVFSHGRLDRGSALLLENIDKLPS------GNL
RSMC_PSESM      TLESLARPYQIELQD---GPLTVISLPGVFSHGRLDRGSALLLENIDKLPS------GNL
RSMC_IDILO      SIEDYAKNITYELNQ---QQESFVTLPGVFSREHIDPATLLLLQHIKDLPK------GRG
RSMC_ALCBS      GEKQSLNAWGTVLEV---ADQEAVSYPGVFSHGRLDEGSALLLQAMEGHNLG--KPG-KV
RSMC_CHRSD      LALSPEAAW-TRFEA---AGLTLESHPGVFGHGKLDDGTRQLLEVLPTALGD--PAGQRV
RSMC_HAEIN      PHFELKNFWRTYQHST-LENLTIYSLPGVFSAAELDTGTELLLSTID--NK----IKGKV
RSMC_HAEIG      PHFELKNFWRTYQHST-LENLTIYSLPGVFSAAELDTGTELLLSTID--NK----IKGKV
RSMC_HAEIE      PHFELKNFWKTYQHST-LENLTIYSLPGVFSAAELDTGTELLLSTID--NK----IKGKV
RSMC_HAEI8      PHFELKNFWKTYQHPT-IQDLTIYSLPGVFSAAELDTGTELLLSTID--NK----IKGKV
RSMC_PASMU      PHFALADYWKTYQHPR-LGDLRIYSLPGVFSANELDVGTDLLLSTLD--QP----VRGKV
RSMC_ACTSZ      PHFDINAYWKTYRNPK-LDALTVYSLPGVFSADELDGGTELLLSTIN--TH----IRGDV
RSMC_MANSM      PNFELENFWKTYRSPQ-LGELIVYSLPGVFSANELDVGTQLLLSTVK--DN----IRGDV
RSMC_ACTPJ      PDFDGKKFWKSYR----LQDLNIFALPAVFSSAELDGGTQLLLSTFNKADR----LKGKV
RSMC_ACTP2      PDFDGKKFWKSYR----LQDLNIFALPAVFSSAELDGGTQLLLSTFNKADR----LKGKV
RSMC_ACTP7      PDFDGKKFWKSYR----LQDLNIFALPAVFSSAELDDGTQLLLSTFNKADR----LKGKV
RSMC_HAEDU      PQFDCQKFWKSYR----LADLTVLSLPAAFSSTELDAGSQLLLSSFTNQDR----LTGNV
RSMC_BUCAI      AIFVLEDFFKTHL----WKNLIIKSLPGVFGHKKIDSGSKLLASTFS--NR----ITGKV
RSMC_BUCAP      TKFKLEKFFKIHI----WKNLIIKSLPGVFGHKKIDEGSKFIASTFS--EK----INGKI
RSMC_ECOLI      PVFDAEKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHIDS      PVFDAEKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO45      PVFDAEKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECODH      PVFDAEKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO81      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOL5      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOUT      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOK1      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOL6      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO7I      PVFDANKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO57      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO5E      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOLC      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHIBS      PVFDADKFWGEYS----VDGLTVKTLPSVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHISS      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHIB3      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO55      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOSE      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO24      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECO8A      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOHS      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOLU      PEFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHIFL      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SHIF8      PVFDADKFWGEYS----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ECOSM      PVFDANKFWGEYN----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ESCF3      PMFDADKFWGEYN----VDGLTVKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALA4      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALSV      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALPA      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALPK      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALTI      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALHS      PQFSLESWWAEYS----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALPB      PQFSLESWWAEYS----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALDC      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALEP      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALTY      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALG2      PQFSLESCWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALCH      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALNS      PQFSLESWWAEYN----IDGLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_SALAR      PLFSLEPYWDEYS----IDGLIIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_ENT38      PTFDAEKYWGEYQ----LDGLTIKTLPGVFSRDGLDVGSQLLLSTFT--PH----TKGKV
RSMC_CITK8      PVFDAEKYWGEYR----INDLTIKTLPGVFSRDGLDVGSQLLLSTLT--PH----TKGKV
RSMC_KLEP3      PTFDAEAFWGEYA----LDNLTIKTLPGVFSRDGLDVGSQLLLSTLE--PH----TKGKV
RSMC_KLEP7      PTFDADAFWGEYT----LDNLTIKTLPGVFSRDGLDVGSQLLLSTLE--PH----TKGKV
RSMC_CROS8      PEFNADGWWGEYQ----VDDLTIKTLPGVFSRDGLDVGSDLLLSTLS--PH----TKGKV
RSMC_ERWT9      PTFDADTFWDEYP----LGELTVKTLPGVFSRDGLDIGSQLLLSTLK--PH----MKGKV
RSMC_YERPE      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPP      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPY      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPG      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPA      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPN      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERP3      PEFDADAWWESYQ----VGGVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPS      PEFDADAWWESYQ----VGSVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERPB      PEFDADAWWESYQ----VGSVTVKTLPGVFSRDSLDSGSHLLLSTFN--EP----FKGSV
RSMC_YERE8      PEFDADAWWESYQ----VGDVIVKTLPGVFSRDALDSGSHLLLSTFS--EP----FKGSV
RSMC_SERP5      TEFNLEDWWESYQ----LHDLEVKTLPGVFSRDGLDVGSSLLLSTLD--KH----MKGKV
RSMC_PECAS      ASFTLDDWWDEYV----TEGVTVKTLPGIFSRDGLDPGSRLLLSTFE--PH----MKGKV
RSMC_SODGM      PRFDAEAFWQSYQ----LEDVVIKTLPGVFSRDGLDNGSQLLLSTFD--RP----FQGHV
RSMC_PHOLL      VQFEQDNWWNSYQ----VENVIVNTLPGVFSQDELDVGSRLLLSTFD--KP----LSGNL
RSMC_PROMH      TLFDRNNWWQTYR----YDDLTVMALPGVFSQTALDEGSRLLLSTFD--DA----MVGDL
RSMC_ALIF1      PTFNQQDWFKEYQVEFENHTIEVRSLPGVFSHGEFDKGSELLLQTLPA-------LRGHV
RSMC_ALIFM      PTFNQQDWFKEYQVEFENHTIEVRSLPGVFSHGEFDKGSELLLQTLPA-------LRGHV
RSMC_ALISL      PSFNLQDWFKEYQVQFKEHTIEVRSLPGVFSHGEFDKGSELLLQTLPS-------LRGHV
RSMC_VIBCB      KPFNQADWFKSYEITLGEQSLTVKSLPGVFSHGEFDLGSRLLLETLPK-------LSGKV
RSMC_VIBPA      KPFNQEEWFKSYTVTLGEQSLTVKSLPGVFSHGEFDLGSRLLLETLPN-------LSGKV
RSMC_VIBVU      NAFNQADWFRHYSINIHGQQLEIQSLPGVFSHGEFDLGSQLLLETLPS-------LSGKV
RSMC_VIBVY      NAFNQADWFRHYSINIHGQQLEIQSLPGVFSHGEFDLGSQLLLETLPS-------LSGKV
RSMC_VIBCH      AAFDIEQWFKSYAVDYQGHELTIRSLPGVFSHGEFDLGSRLLLDTLPP-------LSGKV
RSMC_VIBC3      AAFDIEQWFKSYAVDYQGHELTIRSLPGVFSHGEFDLGSRLLLDTLPP-------LSGKV
RSMC_PHOPR      KPFDLNDWFKSYPINVSGVELTVRSLPGVFSHGEFDNGSKLLINTLPS-------LRGKV
RSMC_AERHH      EPFELDSWFGRYQCQAGDTELTVLALPGVFSASELDLGSQMLLASLP-------AMQGSL
RSMC_AERS4      IPFELDAWFSRYECKAGDTELTVLALPGVFSADELDPGSQMLLAAVP-------PMTGEL
RSMC_PSYIN      NAFTQSQWIKTYPLNINNTELQICSLPGVFSYGELDKGSELLLQNLPD------KMSGRV
RSMC_ALTMD      LAFEAEAWIDTNTYAVEGTSWKVASMPGVFSYKELDAGTELLLEKLST------SLSGDV
RSMC_PSEA6      ASFDITKWQDVSEHQVADISFKVCSLPGVFSHGELDTGTQLLLDNIDR------VVSGRI
RSMC_MARMS      KPFVFEDWITTWKQEVAGQTLTLCSLPGVFGHGKLDKGTDILLNQLNQHRFMSDVASARI
RSMC_PSET1      SQFNISDYHKPFTVSVADSEFTAISIPGVFNHGNLDVGTKILLENAPL------IKQGTV
RSMC_COLP3      DVFNLQDWFKKYQITVEGIELTIASLPGVFSQQKLDVGTALLLSNLPS------KMTGKV
RSMC_HAHCH      KPKQNDFWRAYELAQEKVDTLQLFTLPGVFSAGRLDEGTEVLLQSLPE------LHGRRL
RSMC_MARHV      TEFRLTDWLSWTELSCAGVALSVAGLPGVFSLGRLDDGTRMLLETLAESP----LGVDRV
RSMC_SHEB5      PAMKLSDWVSQYQLTTPQGEISICNLVGVFSEKRLDLGTELLLSHLP-------TLSGRV
RSMC_SHEB8      PAMKLSDWVSQYQLTTPQGEISICNLVGVFSEKRLDLGTELLLSHLP-------TLSGRV
RSMC_SHEB9      PAMKLSDWVSQYQLSTPQGEISICNLVGVFSEKRLDLGTELLLSHLP-------TLSGRV
RSMC_SHEPC      PAMKLSDWVSQYQLSTPQGEISICNLVGVFSEKRLDQGTELLLSHLP-------TLSGRV
RSMC_SHESW      PAMKLSDWVSQYQLSTPQGEISICNLVGVFSEKRLDQGTELLLSHLP-------TLSGRV
RSMC_SHESM      PEIKLSDWTSQYQLATPQGNITICNLVGVFSEKHLDQGTELLLSHLP-------TLSGRV
RSMC_SHESR      PEIKLSDWTSQYQLATPQGNITICNLVGVFSEKHLDQGTELLLSHLP-------TLSGRV
RSMC_SHESA      PEIKLSDWTSQYQLSTPQGNITICNLVGVFSEKHLDQGTELLLSHLP-------TLSGRV
RSMC_SHEON      PEITLSDWASQYQLSTPQGNITICNLVGVFSEKHLDQGTELLLSHLP-------TLSGRV
RSMC_SHEDO      RDFKLENWLSQYSLSTPQGEIIICNLVGVFSEKHLDLGTELLLSHLP-------KLEGRV
RSMC_SHEFN      PTLSIRDWVSQYSLETPQGTLQICNAVGVFSEKRLDQGTDLLLSHLPD------NLRGRV
RSMC_SHELP      PEIKLSDWVKDYVLSTPQGELTICNLVGVFSEKRLDEGTELLLEHLP-------TLKGRV
RSMC_SHEHH      PTLKLTDWISRYQLDTPQGQVTICNLVGVFSEKKLDEGTKLLLENLP-------KMRGKV
RSMC_SHEPA      PELKLKDWLSRYQLDTPQGQVTICNLVGVFSEKKLDEGTQLLLANLP-------KMSGNV
RSMC_SHEPW      PEIKLQDWYSEYQLQTPQGEITICNMVGVFSEKKLDEGTKLLLENLP-------KMQGNV
RSMC_SHESH      PQINLSDWVRNYQLETPQGEITICNLVGVFSEKRLDEGTKLLLSHLP-------KMSGRV
RSMC_SHEWM      PSIKLSDWVNSYQLDTPQGELTICNLVGVFSEKRLDEGTKLLLSHLP-------RLSRRV
RSMC_SHEAM      TKPNAEDWVSRYRLSLPSGDIQICNMVGVFSDKQLDQGTALLLDNLP-------KLEGRV
                                           . *    :* .:  :                  

RSMC_ACIB3      ADFGCGAGIISCYLAKANSSNI-----IHALDIDAFALQSTEMTFSRNGIG--SDQLRLQ
RSMC_ACIBY      ADFGCGAGIISCYLAKANSSNI-----IHALDIDAFALQSTEMTFSRNGIG--SDQLRLQ
RSMC_ACIBC      ADFGCGAGIISCYLAKANSSNI-----IHALDIDAFALQSTEMTFSRNGIG--SDQLRLQ
RSMC_ACIBT      ADFGCGAGIISCYLAKANSSNI-----IHALDIDAFALQSTEMTFSRNGIG--SDQLRLQ
RSMC_ACIBS      ADFGCGAGIISCYLAKANSSNI-----IHALDIDAFALQSTEMTFSRNGIG--SDQLRLQ
RSMC_ACIAD      ADFGCGAGVISAYLAQLSPHNE-----IHALDIDAFALRSTEFTFQRNGLA--SERLHLH
RSMC_PSEAE      LDFGCGAGVLGAVLKRRYPASR-----LSLLDVDAFAVESSRLTLAANGLD--GEVIA--
RSMC_PSEAB      LDFGCGAGVLGAVLKRRYPASR-----LTLLDVDAFAVESSRLTLAANGLD--GEVIA--
RSMC_PSEA8      LDFGCGAGVLGAALKRRYPASR-----LTLLDVDAFAVESSRLTLAANGLD--GEVIA--
RSMC_PSEA7      LDFGCGAGVLGALVKRRYPASR-----LTLLDVDAFAVASSRLTLAANGLD--GEVIA--
RSMC_PSEMY      LDFGCGAGVIGAALKRRYPSSR-----VSLLDVDAFALASSRLTLARNGLE--AELIA--
RSMC_PSEU5      LDFGCGAGILGATLKRRYPQSE-----LVLLDVDAFAVESSRRTLAANGLE--AEVIA--
RSMC_PSEP1      LDFGCGAGVLGATLKRRYPQSR-----VTLLDVDAFAVAASRLTLAANGLE--GEVIS--
RSMC_PSEPK      LDFGCGAGVLGATLKRRYPQSR-----VTLLDVDAFAVAASRLTLAANGLE--GEVIS--
RSMC_PSEPG      LDFGCGAGVLGATLKRRYPQSR-----VTMLDVDAFAVAASRLTLAANGLE--GDVIS--
RSMC_PSEPW      LDFGCGAGVLGATVKRRYPQSR-----VTMLDVDAFAVAASRLTLAANKLE--GEVIS--
RSMC_PSEE4      LDFGCGAGVLGATIKRRYPQSQ-----VTLLDVDAFAVAASRLTLAANGLE--GQVIS--
RSMC_PSEF5      LDFGCGAGVLGATVKRRYPDSR-----VTLLDVDAFAAASSRLTLAANGLE--AEVLT--
RSMC_PSEPF      LDFGCGAGVLGAAVKRRYPHNQ-----VTLLDVDAFAAASSRLTLAANGLE--AEVLT--
RSMC_PSE14      LDFGCGTGVLGAAVKRRYPHND-----VIMLDVDAFATASSRLTLAANGLQ--AQVLT--
RSMC_PSEU2      LDFGCGAGVLGAAIKRRYPHNE-----VIMLDVDAFATASSRLTLAANGLQ--AQVLT--
RSMC_PSESM      LDFGCGAGVLGAAVKRRYPHND-----VVMLDVDAFATASSRLTLAANGLE--AQVVT--
RSMC_IDILO      MDFACGAGVIAKQLASV--ATE-----LMACDVSPIAIAASEITLANEPVK--TELRL--
RSMC_ALCBS      IDMGCGAGVISVWLARH--GWQ-----VQGVDVSASAVTASTESLARNGLQ--GRIMG--
RSMC_CHRSD      LDVGCGDGILGAWLGVR--GAQ-----VAAVDLDAFAVAATRRTFQANGVA--GEAWQ--
RSMC_HAEIN      LDLGCGAGVIGSMIKKRTPNAQ-----ITMTDIHAMALESARKTLSENQLQ--GEVYA--
RSMC_HAEIG      LDLGCGAGVIGSMIKKRAPNAQ-----ITMTDIHAMALESARKTLSENQLQ--GEVYA--
RSMC_HAEIE      LDLGCGAGVIGSMIKKRVPNAQ-----ITMTDIHAMALESARKTLSENQLQ--GKVYA--
RSMC_HAEI8      LDLGCGAGVIGSVIKKSSTNAQ-----ITMTDIHAMALESAHKTLSENQLQ--GEVYA--
RSMC_PASMU      LDLGCGAGVIGAYIKQQYPQVE-----LTMADIHALALASSQRTLAENQLE--AEVIA--
RSMC_ACTSZ      LDLGCGAGVLGAYVKQQNPQAR-----VMLTDIHAMALASAERTLAENRLA--GKVLA--
RSMC_MANSM      LDLGCGAGVIGSMIKLKNPPAK-----VTMTDIHAMALASAERTLLENKLS--GQVLA--
RSMC_ACTPJ      LDLGCGAGVIGASLKQQFEKIK-----LTMSDIHAMALESSRHTLAENALD--GTVVA--
RSMC_ACTP2      LDLGCGAGVIGASLKQQFEKIK-----LTMSDIHAMALESSRRTFAENALD--GTVVA--
RSMC_ACTP7      LDLGCGAGVIGASLKQQFEKIK-----LTMSDIHAMALESSRRTLAENALD--GTVVA--
RSMC_HAEDU      LDLGCGAGVIGAYLKQRFPAIS-----LTMSDIHSMAIHSAQATLAKNKLT--GTVIA--
RSMC_BUCAI      LDIGCGTGFLSASLLYFSPDAI-----LTLVDNNMYALKCSQYTLNSNKFN--GKIVY--
RSMC_BUCAP      LDVGCGSGFLSVSILRKSPKCV-----VTMIDRKLSALESSKATLDANFFK--GEVLS--
RSMC_ECOLI      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_SHIDS      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECO45      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECODH      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECO81      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLATNGVE--GEVFA--
RSMC_ECOL5      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLATNGVE--GEVFA--
RSMC_ECOUT      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLATNGVE--GEVFA--
RSMC_ECOK1      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLATNGVE--GEVFA--
RSMC_ECOL6      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANSVE--GEVFA--
RSMC_ECO7I      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANSVE--GEVFA--
RSMC_ECO57      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECO5E      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECOLC      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_SHIBS      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_SHISS      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_SHIB3      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANYVE--GEVFA--
RSMC_ECO55      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_ECOSE      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_ECO24      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_ECO8A      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_ECOHS      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANCVE--GEVFA--
RSMC_ECOLU      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_SHIFL      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_SHIF8      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGVE--SEVFA--
RSMC_ECOSM      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGIE--GEVFA--
RSMC_ESCF3      LDVGCGAGVLSVAFARHSPKIR-----LTLCDVSAPAVEASRATLAANGIE--GEVFA--
RSMC_SALA4      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALSV      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALPA      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALPK      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALTI      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALHS      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALPB      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALDC      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALEP      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALTY      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALG2      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALCH      LDVGCGAGVLSAALASHSPKAR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALNS      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLE--GEVFA--
RSMC_SALAR      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAVNGLD--GDVFA--
RSMC_ENT38      LDVGCGAGVLSAVLASHSPKVR-----LTLSDVSAPAVEASRATLAANGLE--GDVFA--
RSMC_CITK8      LDVGCGAGVLSAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGVE--GEVFA--
RSMC_KLEP3      LDVGCGAGVLAAVLASHSPKVR-----LTLCDVSAPAVEASRATLAANGFA--GDVFA--
RSMC_KLEP7      LDVGCGAGVLAAALASHSPKVR-----LTLCDVSAPAVEASRATLAANGLA--GDVFA--
RSMC_CROS8      LDVGCGAGVLAAVLASHSPKVR-----LTLCDVSAPAVEASRATLAANGFE--GEVVA--
RSMC_ERWT9      LDVGCGAGVLSAMLASFSPKVR-----LTLTDVNAAAIASSKATLAANQLE--GDVFA--
RSMC_YERPE      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPP      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPY      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPG      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPA      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPN      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERP3      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPS      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERPB      LDVGCGAGVLASVLAQQSPKIK-----WTLSDVSAAAIEASRATLAVNNIE--AQVIA--
RSMC_YERE8      LDVGCGAGVLACVLAQQSPKIK-----WTLSDVSAAAIEASRATLAANNIE--AQVIA--
RSMC_SERP5      LDVGCGAGVMASVLSKLSPKMK-----LTLSDVNAAAIESSRATLAANGIE--GEVIV--
RSMC_PECAS      LDIACGAGVLASVLAKQSPKIR-----LTLSDVSAAAVESSNATLAANALE--GSVIA--
RSMC_SODGM      ADIGCGTGVLSAVLAKGAAGVQ-----LTLSDAHAPALAASRATLAVNGLQ--GEVLA--
RSMC_PHOLL      LDIACGAGVLAAVLGKKNPELA-----LTLSDVNAAAIASSKATLKANKLE--GHVVV--
RSMC_PROMH      LDMACGCGVIATVLGKKNPMLK-----LTLCDVNAAAISSSIATLNVNELE--GRVIA--
RSMC_ALIF1      LDFGCGAGVIGSVMKTINPKIH-----LDMVDISALAIASSIETLKANNLE--GNVFA--
RSMC_ALIFM      LDFGCGAGVIGSVMKTINPKIH-----LDMVDISALAIASSIETLKANNLE--GCVFA--
RSMC_ALISL      LDFGCGAGVLGSVMKTINPKIH-----LDMVDISAFAIASSIETLKANGLE--GNVFA--
RSMC_VIBCB      LDFGCGAGVLGAFMAKANPEIA-----IEMCDINAYAITSSQATLEANGLS--GRVFA--
RSMC_VIBPA      LDFGCGAGVLGAFMAKANPEIA-----IEMCDINAYAITSSQATLEANGLS--GRVFA--
RSMC_VIBVU      LDFGCGAGVIGAFMAKRNPAIE-----LEMCDINAYALASSEATLAANGLQ--GRVFA--
RSMC_VIBVY      LDFGCGAGVIGAFMAKRNPTIE-----LEMCDINAYALASSEATLAANGLQ--GRVFA--
RSMC_VIBCH      IDIGSGAGVLGCVMAKLNPHIE-----LEMTDISALAIRSSQETLVANQLH--GHVYP--
RSMC_VIBC3      IDIGSGAGVLGCVMAKLNPHIE-----LEMTDISALAIRSSQETLVANQLH--GHVYP--
RSMC_PHOPR      LDFGCGAGVLGAIMKAKHPRIE-----LELCDISALAIESAKETFKVNQLD--AKFTA--
RSMC_AERHH      LDFGCGAGVIGSVLAKRNPGLK-----VTMVDINALALESSRRTLAINGL--QGEVWA--
RSMC_AERS4      LDFGCGAGVIGSVLAKRNPGLE-----VKMVDISALALESSRRTLAINGL--QGQVQA--
RSMC_PSYIN      LDFGCGAGVIACYVLKKHPQLS-----VDLVDINAFALASAKLSLQSNQL--EGNVFP--
RSMC_ALTMD      LDFACGAGVIASYIMLKYPHLKL-----HLTDVSALAIYCSALTLAENQL--AATLYA--
RSMC_PSEA6      LDFACGAGIIGCFAGLKNPQAQV-----VMSDVSALAIYCSQKSAELNGV--KAQVIP--
RSMC_MARMS      LDFGCGDGIIALWLHNK-TGARI-----TALDDSVMALKATELTFAANQVSDAVTLIA--
RSMC_PSET1      LDFGCGAGLIATYLGLQNPALSF-----VCSDVSALAIYATTQTLKLNNI--KGEALL--
RSMC_COLP3      LDFGCGAGVISCFIGKKFSGTNL-----SLLDVSALALTSAQESLALNGL--SGNVFP--
RSMC_HAHCH      LDFGCGCGVIGATLKKRYPKAS-----VELTDINLLALKSAARTAEANGV--ELNVYA--
RSMC_MARHV      FDFACGAGVIGSWLHGFHQLAGKMPIRVDGTDVQAQAVFCARESYRKAGV--NGEIFA--
RSMC_SHEB5      LDFGCGAGVIAAALLKAQPSLS-----LECVDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHEB8      LDFGCGAGVIAAALLKAQPSLS-----LECVDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHEB9      LDFGCGAGVIAAALLKAQPSLS-----LECVDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHEPC      LDFGCGAGVIAAALLKAQPHLS-----LECIDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHESW      LDFGCGAGVIAAALLKAQPHLS-----LECIDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHESM      LDFGCGAGVIAAALLKAQPTLS-----LECIDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHESR      LDFGCGAGVIAAALLKAQPTLS-----LECIDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHESA      LDFGCGAGVIAAALLKAQPTLS-----LECIDINAMALASCELTLAANGM--TAKVYP--
RSMC_SHEON      LDFGCGAGVIAATLLKAQPTLS-----LECIDINAMALASCELTLAANGM--MAKVYP--
RSMC_SHEDO      LDFGCGAGVITVALLKAMPKLE-----LECIDINAMALASCELTLQANKL--QAKVYP--
RSMC_SHEFN      LDFGCGAGVITAALLKANPELT-----IECIDINAMALLSCELTLAANSM--QAKVYP--
RSMC_SHELP      LDFGCGAGVITAALLKANPDLE-----LECVDINAMALASCELTLAANGM--QAKVYA--
RSMC_SHEHH      LDFGCGAGVIAAALLKAQPELT-----LECVDINAMALASCEFTLQANGF--NAKIFA--
RSMC_SHEPA      LDFGCGAGVITAALLKAQPDLK-----LECVDINAMALASCELTLEANGF--TAKVFA--
RSMC_SHEPW      LDFGCGAGVIAAALLTAQPKLT-----LDCVDINAMALTSCDLTMQANGL--SANIFA--
RSMC_SHESH      LDFGCGAGVITAALLKAQPELK-----VECVDINAMAIESCKLTLAANNF--TADTYP--
RSMC_SHEWM      LDFGCGAGVIAAALLKAQPELE-----IECVDINAMALKSCELTLEANNF--TAKVYA--
RSMC_SHEAM      LDFGCGAGVIAIALMQQNPGLQ-----LECVDINAMALLSCELSLKANGM--EAKVYA--
                 *...* *.:                     *    *  .   :     .          

RSMC_ACIB3      PVTGIADAPTELDAIVSNPPFHQGIHTNYDASEGLCQNAKKHLKASGELWIVANRFLNYP
RSMC_ACIBY      PVTGIADAPTELDAIVSNPPFHQGIHTNYDASEGLCQNAKKHLKASGELWIVANRFLNYP
RSMC_ACIBC      PVTGIADAPTELDAIVSNPPFHQGIHTNYDASEGLCQNAKKHLKASGELWIVANRFLNYP
RSMC_ACIBT      PVTGIADAPTELDAIVSNPPFHQGIHTNYDASEGLCQNAKKHLKASGELWIVANRFLNYP
RSMC_ACIBS      PVTGIADAPTELDAIVSNPPFHQGIHTNYDASEGLCQNAKKHLKASGELWIVANRFLNYP
RSMC_ACIAD      AVTGIQDAPKALDVIVSNPPFHQGIHTDYSASEGLCKTAKQHLNTSGELWIVANRFLNYP
RSMC_PSEAE      -ADGIDGAPRELAAIVSNPPFHQGVHTDYQASERLLQRAAEHLAPGGELRLVANSFLKYP
RSMC_PSEAB      -ADGIDGAPRELAAIVSNPPFHQGVHTDYQASERLLQRAAEHLAPGGELRLVANSFLKYP
RSMC_PSEA8      -ADGIDGAPRELAAIVSNPPFHQGVHTDYQASERLLQRAAEHLAPGGELRLVANSFLKYP
RSMC_PSEA7      -ADGIDGAPRGLAAIVSNPPFHQGVHTDYQASERLLQRAAEHLAAGGELRLVANSFLKYP
RSMC_PSEMY      -GTGIESAPGELAAIVSNPPFHQGVHTHYQASENLLTQAARHLRDGGELRLVANSFLKYP
RSMC_PSEU5      -GDGIDAAPRQLAAIISNPPFHQGVHTSYHASETLIERAAEHLQASGEMRIVANAFLRYP
RSMC_PSEP1      -GDGIDAAPTELSLILSNPPFHTGVHTNYQASENLLKKSAVHLRKGGEMRLVANSFLRYQ
RSMC_PSEPK      -GDGIDAAPTELSLILSNPPFHTGVHTNYQASENLLKKSAVHLRKGGEMRLVANSFLRYQ
RSMC_PSEPG      -GDGIDAAPTELSLILSNPPFHTGVHTNYQASENLLKKSAVHLRKGGEMRLVANSFLRYQ
RSMC_PSEPW      -GDGIDAAPGDLSLILSNPPFHTGVHTNYQASENLLKKSGQHLRKGGEMRLVANSFLRYQ
RSMC_PSEE4      -GDGIDAAPGELDLILSNPPFHTGVHTDYQASENLLKKSGEHLRKGGEIRLVANSFLRYQ
RSMC_PSEF5      -GDGIDAAPMGLNGILTNPPFHTGVHTDYQATENLLRKAAKHLQKGGELRVVANSFLRYQ
RSMC_PSEPF      -GDGIDAAPMGLNAILSNPPFHVGVHTDYFATENLLRKAAKHLKNGGELRLVANSFLKYQ
RSMC_PSE14      -GDGIDAAPMGLNTILSNPPFHVGVHTDYMATENLLRKARQHLKSGGELRLVANNFLRYQ
RSMC_PSEU2      -GDGIDAAPMGLNTILSNPPFHVGVHTDYMATENLLRKARQHLKSGGELRLVANNFLRYQ
RSMC_PSESM      -GDGIDAAPMGLNTILSNPPFHVGVHTDYMATENLLKKARQHLKSGGELRLVANNFLRYQ
RSMC_IDILO      -ADGIPDNAGQFDFIVSNPPFHTGQRTDYEIAREFISNARQHLNKQGVFRVVANRFLPWP
RSMC_ALCBS      -GDLFSPIQGRVDMVVTNPPFHDRRQRTTDITRRLIAEAPTYLKPGGVLWLVANRELPYV
RSMC_CHRSD      -SDVFGDVSGSYDAIVSNPPFHQQRAIDYGPAERLIREAPARLVPGGRLVLVANAFLPYP
RSMC_HAEIN      -SDVFSDIEGKFDLIISNPPFHDGIDTAYRAVTELITQAKWHLNQGGELRIVANSFLPYP
RSMC_HAEIG      -SDVFSDIEGKFDLIISNPPFHDGIDTAYRTVKELITQAKWHLNQGGELRIVANAFLPYP
RSMC_HAEIE      -SDVFSDIEGKFDLIISNPPFHDGIDTAYRAVTELITQAKWHLNQYGELRIVANAFLPYP
RSMC_HAEI8      -SDVFSDIEGKFDLIISNPPFHDGIDTAYRAVTELITQAKWHLNQGGELRIVANAFLPYP
RSMC_PASMU      -SDVFSNVAGKFDLIISNPPFHDGIDTAYRAVSELIMQAKWHLVPGGELRIVANAFLPYP
RSMC_ACTSZ      -SDVFSHIQGKFDLIISNPPFHDGIGTAYRAVSELIKEARWRLKEDGELRIVANAFLPYP
RSMC_MANSM      -SDVFSHVEGKFDLIISNPPFHDGIDTAYRAVRELISNAKWHLVPGGELRIVANAFLPYP
RSMC_ACTPJ      -SDVFSNIEERFDLIVSNPPFHDGIDTAYRAVEDLIAQAKQRLNRGGELRIVANAFLPYP
RSMC_ACTP2      -SDVFSNIEERFDLIVSNPPFHDGIDTAYRAVEDLIAQAKQRLNRGGELRIVANAFLPYP
RSMC_ACTP7      -SDVFSNIEERFDLIVSNPPFHDGIDTAYRAVEDLIAQAKQRLNRGGELRIVANAFLPYP
RSMC_HAEDU      -SDVFSHINDRFDLIVSNPPFHDDIDTAYHTVESLIMQAKNHLNYGGELRIVANAFLPYP
RSMC_BUCAI      -SNLYSNVFKKFDLIISNPPFHNDLQINFNIIEKMICGAKKYLTKTGELRFVTSRFINCH
RSMC_BUCAP      -SNIYSNIFKKFNMIVSNPPLHDDLKINFDITKKIIFNSKKHLKKNGELRFVTNHCFSYD
RSMC_ECOLI      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHIDS      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO45      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECODH      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO81      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOL5      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOUT      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOK1      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOL6      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO7I      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO57      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO5E      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOLC      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHIBS      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHISS      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHIB3      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO55      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOSE      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO24      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECO8A      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOHS      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOLU      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHIFL      -SNVFSEVKGCFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SHIF8      -SNVFSEVKGCFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ECOSM      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_ESCF3      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALA4      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALSV      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALPA      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALPK      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALTI      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALHS      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALPB      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALDC      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALEP      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALTY      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALG2      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALCH      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALNS      -SNIFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP
RSMC_SALAR      -SNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRSAVRHLNSGGELRIVANAFLPYP
RSMC_ENT38      -SNVFSEVTGRFDIIISNPPFHDGMETSLEAAQTLIRGAVRHLGSGGELRIVANAFLPYP
RSMC_CITK8      -SNVFSDVKGRFDMIISNPPFHDGIQTSLDAAQTLIHGAVRHLNSGGELRIVANAFLPYP
RSMC_KLEP3      -SNVFSEVNGRFDMIISNPPFHDGLQTSLEAAQALIRGAVRHLNSGGELRIVANAFLPYP
RSMC_KLEP7      -SNVFSEVNGRFDMIISNPPFHDGLQTSLEAAQALIRGAVRHLNSGGELRIVANAFLPYP
RSMC_CROS8      -SNVFSEIKGRFDMIISNPPFHDGMETSFEAAQTLIRSAVRHLNIGGELRIVANAFLPYP
RSMC_ERWT9      -SNVYSDISGRFDMIISNPPFHDGVQTSLDAAQTLIRGAVSHLNTGGELRIVANAFLPYP
RSMC_YERPE      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPP      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPY      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPG      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPA      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPN      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERP3      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPS      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERPB      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_YERE8      -SNVYSDIKGRFEMIISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYP
RSMC_SERP5      -SNVYSDITGRFDLIISNPPFHDGLQTSLTAAETLIRGALKHLGVGGKLRIVANAFLPYP
RSMC_PECAS      -SNVYSDIDGRFDMIVSNPPFHDGLQTSLQAVEMLIRGAVTHLPIGGQLRIVANAFLPYP
RSMC_SODGM      -GDVYSAISGRFDMIISNPPFHDGMQTNLKAAETLIRGALNHLRIGGELRIVANAFLPYP
RSMC_PHOLL      -SNVYSNIEDKFDWIISNPPFHEGLKTSLLATDDLIRQAPNHLKPGGKLRIVANAFLPYP
RSMC_PROMH      -SNVYSAVEETYDWIVSNPPFHDGLGTSYQAAEDIIRLAPNFLKKGGKLRIVANAFLPYQ
RSMC_ALIF1      -SDVYSDTKENYQFIVSNPPFHAGLKTHYSSTEELLEKAPQNLTHEGQLILVANSFLQYP
RSMC_ALIFM      -SDVYSDTKENYQFIVSNPPFHAGLKTHYSSTEELLEKAPQNLTHEGQLILVANSFLQYP
RSMC_ALISL      -SDVYSDTKQNYQFIVSNPPFHAGLKTHYSSTEELLQKAPQNLTHSGQMIFVANSFLQYP
RSMC_VIBCB      -SDIYSDTAKDYRFIVSNPPFHSGLDTNYNAAETLLGQAPKYMTANGEMIIVANSFLQYP
RSMC_VIBPA      -SDIYSDTANDYRFIISNPPFHSGLDTNYNAAETLLGHAPQHLSNHGEMIIVANSFLKYP
RSMC_VIBVU      -SDIYSDTADDYRFIISNPPFHSGLDTNYKAAETLLGQAPQYLNKQGELIIVANSFLKYP
RSMC_VIBVY      -SDIYSDTADDYRFIISNPPFHSGLDTNYNAAETLLGQAPQHLNNQGELIIVANSFLKYP
RSMC_VIBCH      -SDMFSDTGHHYNYIVTNPPFHSGLETSYSATERLLAESVDHLASGGSIWVVANSFLKYP
RSMC_VIBC3      -SDMFSDTGHHYNYIVTNPPFHSGLETSYSATERLLAESVDHLASGGSIWVVANSFLKYP
RSMC_PHOPR      -TDVYSELKGPYNYLISNPPFHAGLKTFYTATENFIAQAPNYLFSDGQLIIVANSFLKYP
RSMC_AERHH      -SDVYSDIQGKFGRIVSNPPFHAGLKTFYAATETFLAKAPDHLQSQGSLTIVANAFLRYQ
RSMC_AERS4      -SDVYSDITGKFDHIVSNPPFHAGLKTFYAATETFLAKAPEYLSANGGLTIVANAFLRYQ
RSMC_PSYIN      -SNVFSDIKEKYNILLSNPPFHSGKNTDYTAAETFINQSTNHLKSKGKLSIVANRFLNYE
RSMC_ALTMD      -ADGLHGMTNKVQHIVTNPPFHTGIKTDYTVTKRFISDAKARLTRGGTMQMVANRFLPYP
RSMC_PSEA6      -SNGLGALTGKFAQVFTNPPFHTGIKTDYSVTEGFMQQLKNHLQDRGSLILVANKFLRYA
RSMC_MARMS      -SNGLDEVKGRFNYVVTNPPFHSGVNTDYSIAESFFMMVKQHLTLNGELFVVANDFLRYP
RSMC_PSET1      -SDGLTNITGKFDLIISNPPFHTGIATDYTVAETFLANAKQHLTKAGKLNIVANSFLKYP
RSMC_COLP3      -SNSLSDVNEHYQHVVSNPPFHQGVKTHYQASEDFLAGINKKLNKQGNITIVANSFLRYQ
RSMC_HAHCH      -SDGLAEVQPGVDAIITNPPFHQGVKQDTRVTQQFLRDCARVLKPGGSLTLVANRFLPYP
RSMC_MARHV      -ADGLAVVQGNWPAVISNPPFHTGVKTDTSMTEQFLAQVAAHLAHGGELRLVANSFLPYE
RSMC_SHEB5      -SDGLAQTTGKFNGIISNPPFHDGLASTTSIAQNFVTDSAKQLQHNGIWQIVANRHLPYS
RSMC_SHEB8      -SDGLAQTTGKFNGIISNPPFHDGLASTTSIAQNFVTDSAKQLQHNGIWQIVANRHLPYS
RSMC_SHEB9      -SDGLAQTTGKFNGIISNPPFHDGLASTTSIAQNFVTDSAKQLQHNGIWQIVANRHLPYS
RSMC_SHEPC      -SDGLAQTTGKFNGIISNPPFHDGLTSTTNIAKNFVTDSAKQLQHNGIWQIVANRHLPYS
RSMC_SHESW      -SDGLAQTTGKFNGIISNPPFHDGLTSTTNIAKNFVTDSAKQLQHNGIWQIVANRHLPYS
RSMC_SHESM      -SDGLAQTSGKFDGIISNPPFHDGLASTTSIAQSFVADSAKQLQSKGIWQIVANRHLPYS
RSMC_SHESR      -SDGLAQTSGKFDGIISNPPFHDGLASTTSIAQSFVADSAKQLQSKGIWQIVANRHLPYS
RSMC_SHESA      -SDGLAQTSGKFDGIISNPPFHDGLASTTSIAQRFVADSAKQLQSKGIWQIVTNRHLPYS
RSMC_SHEON      -SDGLAQTSGKFDGIISNPPFHDGLASTTNIAQRFVADSAKQLQSKGIWQIVANRHLPYS
RSMC_SHEDO      -SDGLTQVTGAFDAIISNPPFHDGLTSTTDIATQFVAMSEKQLKSKGIWQIVANRHLPYA
RSMC_SHEFN      -SDGFNQITGKFDGIISNPPFHDGLTSTTDIATQFVQQSAIRLTSNGIWQIVANRHLPYS
RSMC_SHELP      -SDGLTQTQGMFDAIISNPPFHDGLDSTTEIATRFVQESEAQLKSGGIFQIVANRHLPYS
RSMC_SHEHH      -SDGLAQAAGRYDGIISNPPFHDGLASTTNIATNFVKDSAANLTTGGLFHIVANRHLPYS
RSMC_SHEPA      -SDGLAQTSQRYDGIISNPPFHDGLASTTNIATNFVKDSANNLKAGGLFHIVANRHLPYS
RSMC_SHEPW      -SDGMAQTSGHYDGIISNPPFHDGLASTTNIATDFVKAASANLMRGGLFHIVANRHLPYS
RSMC_SHESH      -SDGLTQTKGLFNGIISNPPFHDGLRSTTDIAKNFVKDSVQKLKKGGVWHIVANRHLPYS
RSMC_SHEWM      -SDGLSQTQGHFDDIISNPPFHDGLKSTTDIAKSFVKESAQKLKSGGGWHIVANRHLPYS
RSMC_SHEAM      -SDGLAQTDGLFNAIVSNPPFHDGLSSTTDIATRFVADSYKQLHKGGNWQIVANRHLPYS
                              :.:***:*            :       :   *   .*:.  :   

RSMC_ACIB3      ILIEKHFGQCEIKTDLQGFKVLYACA-------------
RSMC_ACIBY      ILIEKHFGQCEIKTDLQGFKVLYACA-------------
RSMC_ACIBC      ILIEKHFGQCEIKTDLQGFKVLYACA-------------
RSMC_ACIBT      ILIEKHFGQCEIKTDLQGFKVLYACA-------------
RSMC_ACIBS      ILIEKHFGQCEIKTDLQGFKVLYACA-------------
RSMC_ACIAD      LLIEQTFGQCQVKTDQQGFKILYAKAT------------
RSMC_PSEAE      PLIERHLGPCRTLAEGDGFRIYSARRS------------
RSMC_PSEAB      PLIERHLGPCRTLAEGDGFRIYSARRS------------
RSMC_PSEA8      PLIERHLGPCRTLAEGDGFRIYSARRS------------
RSMC_PSEA7      PLIERHLGPCRTLAEGDGFRVYTARRP------------
RSMC_PSEMY      PLIERHLGPCRTLAEAEGFRIYSARR-------------
RSMC_PSEU5      PLIERHLGTCQTLAERDGFRIYRAVRG------------
RSMC_PSEP1      PLIEGALGNCQVRDEADGFRIYQATRG------------
RSMC_PSEPK      PLIEGALGNCQVRDEADGFRIYQATRG------------
RSMC_PSEPG      PLIEGALGNCQVRDEADGFRIYQATHG------------
RSMC_PSEPW      PLIEGALGNCRTCAEADGFRIYQATR-------------
RSMC_PSEE4      PLIEGALGNCEIRAEAQGFRIYRATRG------------
RSMC_PSEF5      PLIEEHLGPCAIKAEGQGFRIYRAKRG------------
RSMC_PSEPF      PLIEEHLGVCAIKAEGNGFRIYRAKRG------------
RSMC_PSE14      PLIEEHVGQCEVRAQGSGFKIYSAKRS------------
RSMC_PSEU2      PLIEEHVGQCEVRAQGNGFKIYSAKRP------------
RSMC_PSESM      PLIEEHVGYCHVKAQGNGFKIYSAKRS------------
RSMC_IDILO      EVIESVFGNCSVIADDGRYRVYHATCR------------
RSMC_ALCBS      QWLDDAFSHVQVASETTRFRVYRAVLS------------
RSMC_CHRSD      RWLEDAFGEFTVLADDRRFRVYQAVKTRR----------
RSMC_HAEIN      ELLRQHFNDYQVLAQTGKFKVYSVKN-------------
RSMC_HAEIG      ELLRQYFNDYQVLAQTGKFKVYSVKN-------------
RSMC_HAEIE      ELLRQHFNDYQVLAQTGKFKVYSVKN-------------
RSMC_HAEI8      ELLRQHFGDYEILAQTGKFKVYSVKN-------------
RSMC_PASMU      DLLDQHFGSHCVLAKTTKFKVYSVRG-------------
RSMC_ACTSZ      DLLDEHFGSHQVLAKTNKFKVYSVCA-------------
RSMC_MANSM      DLLDEYFGGHKVLAQTNKFKVYSVIG-------------
RSMC_ACTPJ      DLLDKAFGSHQVIAKSNKFKVYSAKA-------------
RSMC_ACTP2      DLLDKAFGSHQVIAKSNKFKVYSAKA-------------
RSMC_ACTP7      DLLDKAFGSHQVIAKSNKFKVYSAKA-------------
RSMC_HAEDU      DLLDKAFGSHQVVTKSNKFKVYSARV-------------
RSMC_BUCAI      FLLNKFFQKYYVIKETSQYKVYQAFYK------------
RSMC_BUCAP      FYLKKVFSEFHIMKKDNKYKVYQAFLK------------
RSMC_ECOLI      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHIDS      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO45      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECODH      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO81      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOL5      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOUT      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOK1      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOL6      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO7I      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO57      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO5E      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOLC      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHIBS      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHISS      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHIB3      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO55      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOSE      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO24      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECO8A      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOHS      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOLU      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHIFL      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SHIF8      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ECOSM      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_ESCF3      DVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG------
RSMC_SALA4      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALSV      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALPA      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALPK      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALTI      KILDETFGFHEVIAQTGRFKVYRIVMTRQAKK-------
RSMC_SALHS      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALPB      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALDC      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALEP      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALTY      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALG2      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALCH      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALNS      KILDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_SALAR      KILDETFGFHDVIAQTGRFKVYRTVMTRQAKK-------
RSMC_ENT38      KLLDEIFGFHEVLAQTGRFKVYRTVMTRQAKK-------
RSMC_CITK8      KVLDETFGFHEVIAQTGRFKVYRTVMTRQAKK-------
RSMC_KLEP3      QVLDETFGFHEVIAQTGRFKVYRTIMTRQAKK-------
RSMC_KLEP7      QVLDETFGFHEVIAQTGRFKVYRTIMTRQAKK-------
RSMC_CROS8      NVLDETFGNHEVLAQTGRFKVYRAVMGRNAKR-------
RSMC_ERWT9      QVLDETFGSHEVLLQNGRFKVYRAVKSRAAKK-------
RSMC_YERPE      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPP      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPY      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPG      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPA      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPN      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERP3      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPS      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERPB      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_YERE8      ALLDAAFGSHEVLAQNGRFKVYQATVGRPPRDPKKKR--
RSMC_SERP5      DILDATFGSHEVLAQNGRFKVYQATVARAPRDAKKKK--
RSMC_PECAS      ALLDAAFGSHEVLAQTGRFKVYQATVGRPPRTGKGRRR-
RSMC_SODGM      DLLDAVFGNHQVLVQNGRFKVYQAIHQVKRSRDKGPKRR
RSMC_PHOLL      DLLDKTFGTHEVIAQTGKFKVYQATKKF-----------
RSMC_PROMH      DILDHVFGSHEVLASTGKFKVYQATKK------------
RSMC_ALIF1      PIIEKAFGECLTLAKNNKFKIYSAQK-------------
RSMC_ALIFM      PIIEKAFGECLTLAKNNKFKIYSAQK-------------
RSMC_ALISL      PIVEKVFGHCNTLAKNNKFRIYSAQK-------------
RSMC_VIBCB      PIIEKAFNNCETLNKTNKFSIYYAKKS------------
RSMC_VIBPA      PIIENAFNNCETLNKTNKFSIYYAKKS------------
RSMC_VIBVU      PIIEQAFSNCATLNKTNKFSIYHASK-------------
RSMC_VIBVY      PIIEQAFSNCATLNKTNKFSIYHANK-------------
RSMC_VIBCH      PILEQAFGHCDIAAKTNKFAIYHAKK-------------
RSMC_VIBC3      PILEQAFGHCDIAAKTNKFAIYHAKK-------------
RSMC_PHOPR      ELIEQSLETCNALANTNKFTIYSAKK-------------
RSMC_AERHH      PILETHFKRTEVISSDAKFKVYLSKV-------------
RSMC_AERS4      PILETHFKRTDIISSDAKFKVYLSKV-------------
RSMC_PSYIN      GLLFKAFSNVKIDQESNKFKVLSCITKT-----------
RSMC_ALTMD      GLLSEHFQTVYTTAQTSQFSVYQATL-------------
RSMC_PSEA6      DELDKQFKSVQTLTETTKFSVYCCRR-------------
RSMC_MARMS      PILDAALGSHTRLYRDRGFAIYHGRQPKKK---------
RSMC_PSET1      PILEAQFDNYQTVFKNNKFAVYSS---------------
RSMC_COLP3      PIMETHIGNTRVITKDKGFTIYRAQLS------------
RSMC_HAHCH      DWIEAHVGPVRVLFENSRFKVYHAVR-------------
RSMC_MARHV      ALIRQHIGPVEKLAQDRRFTVYRAFRKKSG---------
RSMC_SHEB5      DIIAAEFGQLKVVADNNKYKLYYFQHK------------
RSMC_SHEB8      DIIAAEFGQLKVVADNNKYKLYYFQHK------------
RSMC_SHEB9      DIIAAEFGQLKVVADNNKYKLYYFQHK------------
RSMC_SHEPC      DIIAAEFGQLTVPAENNKYKLYYFQQQ------------
RSMC_SHESW      DIIAAEFGQLTVPAENNKYKLYYFQQQ------------
RSMC_SHESM      DTIAAEFGQLTVPAENNKYKLYSFQQA------------
RSMC_SHESR      DTIAAEFGQLTVPAENNKYKLYSFQQA------------
RSMC_SHESA      DTIAAEFGQLTVPAENNKYKLYSFQQA------------
RSMC_SHEON      DTIAAEFGQLTVPAENNKYKLYYFQQS------------
RSMC_SHEDO      STIAQVFGNFDVPAENNKFKLYACRKK------------
RSMC_SHEFN      ETIATHFGKVNVVAENNKYKLYLHQR-------------
RSMC_SHELP      DTIAKFFKTVNVAAENNKYKIYANRKA------------
RSMC_SHEHH      DTIAEHFGSVDVTAENNKYKIYSNVK-------------
RSMC_SHEPA      DTIAEHFGSVNVLAENNKYKIYSNVK-------------
RSMC_SHEPW      DCIAENFGEVNVSAENNRYKIYSNIKR------------
RSMC_SHESH      DSISTHFKQVNVSAENNRYKVYSNKINS-----------
RSMC_SHEWM      DTINEFFGQVNVLAENNKYKIYSNKINQK----------
RSMC_SHEAM      DTIAKVFGEVNTVAENNKYKVYANKKR------------
                  :   .           : :