CLUSTAL format seed alignment for MF_01863

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y580_STAA8       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y556_STAAE       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y550_STAAN       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y548_STAAW       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y593_STAAM       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y591_STAA1       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y552_STAAS       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y631_STAA2       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y616_STAA9       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y543_STAAB       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y639_STAAC       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y586_STAAT       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y575_STAA3       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALT
Y599_STAAR       MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFAFVNNRPLAALT
Y364_STAES       MKNKFLICDECQAVNLKSLKRKLEKLDPEAEIEIGCQSYCGPGRRKTFAFVNNRPLAALT
Y241_STAEQ       MKNKFLICDECQAVNLKSLKRKLEKLDPEAEIEIGCQSYCGPGRRKTFAFVNNRPLAALT
Y2399_STAHJ      MKNKFLICDECQAVNIKTLKRKLEKLDPEAEIEIGCQSYCGPGRRKTFAFVNNRPLAALT
Y2119_STAS1      MQNKFLICDDCQGVNCKSLEKKLTKLDPEAEIEIGCQSYCGPGRRKTFAFVNNRPLAALT
Y950_LYSSC       MANEFKVCDECQAVNLKTLIPKLKEIDPDATIEIGCHSYCGPGRKKTFTFVNSRPVAALT
Y3472_BACVZ      MANEFRVCDDCQATNIKTLLPRLKEADPDAKVEVGCQSYCGPGRKKSFAFVNNRPLSAPT
YWZC_BACSU       MANEFRVCDDCQATNIKTLLPRLKEVDPDAKVEVGCQSYCGPGRKKSFAFVNNRPLSAPT
Y3913_BACLD      MANEFRVCDDCQATNLKTLLPRLKEIDPDAKVEIGCQSYCGPGRKKSFAFVNNRPLSAPD
Y3395_BACP2      MANEFRVCDDCDATNLKTLLPRLKSVDPDAKIEIGCQSYCGPGRKKAFAFVNNRPLSAPT
Y2757_ANOFW      MQNEFRVCDDCQATNLKTLLPRLKKLDPNATIEIGCQSYCGPGRKKVFAFVNNRPVSAMT
Y4882_BACAH      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5064_BACHK      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5632_BACAN      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5476_BACC0      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5513_BACC1      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5224_BACCQ      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5081_BACCZ      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5177_BACMK      MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVACQSYCGPGRKKSFAFVNNRPVAAPT
Y5562_BACC7      MGNEFRMCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5507_BACC4      MGNEFRVCDDCQATNVKTLVPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5444_BACC2      MGNEFRVCDDCQATNVKTLVPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y5384_BACCR      MGNEFRVCDDCQATNIKTLVPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT
Y3905_BACCN      MGNEFRVCDDCQATNIKTLIPKLKKIDSCASIEIGCQSYCGPGRKKSFAFVNNRPVAAPN
Y3412_GEOKA      MANEFRVCDDCKAPNLKTLIPRLKKLDPDAVIKIGCQSYCGPGRKKTFAFVNNRPVAALT
Y3358_GEOTN      MANEFRVCDDCKAPNLKTLLPRLKKLDPDAVIKIGCQSYCGPGRKKTFAFVNNRPVAALT
Y3821_BACHD      MANEFRICDECQATNIKTLIPKLKKLDPNATIDIRCQSYCGPGRKKSFTFVNNRPVAAPD
                 * * * :**:*.. * ::*  :* . *. * : : *:*******:* *:***.**::*  

Y580_STAA8       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y556_STAAE       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y550_STAAN       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y548_STAAW       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y593_STAAM       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y591_STAA1       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y552_STAAS       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y631_STAA2       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y616_STAA9       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y543_STAAB       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y639_STAAC       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y586_STAAT       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKVEQDRKLKEKLEKRKAQQ
Y575_STAA3       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKVEQDRKLKEKLEKRKAQQ
Y599_STAAR       EEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKEKLEKRKAQQ
Y364_STAES       EEELMEKVTKQLKKPRDPEEEERLRKRNEERKRRKEEQDRKLKEKLKKRKAEK
Y241_STAEQ       EEELMEKVTKQLKKPRDPEEEERLRKRNEERKRRKEEQDRKLKEKLKKHKAEK
Y2399_STAHJ      EDELLEKVTAQLKKPRDPEEEERLRKRNEERKRRKEEQDRKLKEKLAKRKAIK
Y2119_STAS1      EDELMEKVEKQLQKPRDHEEEERLRKRNEERKRRKEEQDRKLKEKLAQRKHK-
Y950_LYSSC       EEELMEKVLTKLKNK--------------------------------------
Y3472_BACVZ      EDELIEKVKKKIKK---------------------------------------
YWZC_BACSU       EDELIDKVKKKIKK---------------------------------------
Y3913_BACLD      EDELIEKVKKKLKK---------------------------------------
Y3395_BACP2      EDELLEKVQKKVK----------------------------------------
Y2757_ANOFW      EDELIEKIAAKLKK---------------------------------------
Y4882_BACAH      EDELIVKIEAKLNK---------------------------------------
Y5064_BACHK      EDELIVKIEAKLNK---------------------------------------
Y5632_BACAN      EDELIVKIEAKLNK---------------------------------------
Y5476_BACC0      EDELIVKIEAKLNK---------------------------------------
Y5513_BACC1      EDELIVKIEAKLNK---------------------------------------
Y5224_BACCQ      EDELIVKIEAKLNK---------------------------------------
Y5081_BACCZ      EDELIVKIEAKLNK---------------------------------------
Y5177_BACMK      EDELIVKIEAKLNK---------------------------------------
Y5562_BACC7      EDELIVKIEAKLNK---------------------------------------
Y5507_BACC4      EDELIVKIEAKLNK---------------------------------------
Y5444_BACC2      EDELIVKIEAKLNK---------------------------------------
Y5384_BACCR      EDELIVKIEAKLNK---------------------------------------
Y3905_BACCN      EDELIKKIEAKLNK---------------------------------------
Y3412_GEOKA      EDELIDKIAERLKKR--------------------------------------
Y3358_GEOTN      EDELIDKIAERLKSR--------------------------------------
Y3821_BACHD      EDQLIEKIKKKLKK---------------------------------------
                 *::*: *:  :::