CLUSTAL format seed alignment for MF_01872

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRMN6_BACFN       ---------------------------------MSQPFFQFKQFTVWHDKCAMKVGTDGV
TRMN6_BACFR       ---------------------------------MSQPFFQFKQFTVWHDKCAMKVGTDGV
TRMN6_BACTN       ---------------------------------MANPFFQFKQFTVWHDKCAMKVGTDGV
TRMN6_BACV8       ---------------------------------MPNPYFSFKQFTVYHDRCAMKVGTDGV
TRMN6_PARD8       ---------------------------------MANPYFQFKKFTVWHDKCAMKVGTDGV
TRMN6_FLAJ1       -------------------------------------MFQFKQFSVKQDKTAMKVGTDGV
TRMN6_FLAPJ       -------------------------------------MFSFKQFSVQQDKTAMKVGTDGV
TRMN6_GRAFK       ---------------------------------MSNQPFKFKQFSIDQDRCAMKIGTDGV
TRMN6_PORGI       ---------------------------------MPTDIFSFKQFDIDQTGCAMRVGTDGV
TRMN6_PORG3       ---------------------------------MPTDIFSFKRFDIDQTGCAMRVGTDGV
I3YQ37_ALIFI      -------------------------------------MFRFKRFTIRQDRCPMKVGTDGV
F2KTM2_PREDF      ------------------------------------MGFTFKNFHISQEHTAMKVGTDGV
TRMN6_TRIEI       ---------------------------------MGGNQFRFKQFTIRQDRCAMKVGTDGT
TRMN6_YERP3       -----------------------MGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPA       -----------------------MGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPP       -----------------------MGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPG       -----------------------MGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPN       -----------------------MGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPB       -------------------MVTNVGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPE       -------------------MVTNVGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPS       -------------------MVTNVGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERPY       -------------------MVTNVGEQLKKQPVLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_YERE8       --------------------MTNVGEQLKKKPMLRGGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_PROMH       -----------------------MKQKKVKKAGLRKGGFTFKQFFVAHDKCEMKVGTDGV
TRMN6_PHOLL       -----------------------MKQKRL----LRRDGFTFKQFFVGHDRCAMKVGTDGV
TRMN6_SERP5       ------------MLRQFCIQVVIVSTQSKANFTPRRGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_PECAS       -----------------------MSHQADYKLTLRRDGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_PECCP       -----------------------MSHQADNKLTLRRDGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_DICC1       -----------------------MTFQ-QHTPALRTGGFTFKQFFVAHDRCAMKVGTDGV
TRMN6_DICP7       -----------------------MSAR-QHTPDLRADGFTFKRFFIAHDRCAMKVGTDGI
TRMN6_ECOLU       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOSM       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOBR       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOBW       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECODH       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOHS       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOLC       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOLI       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO7I       -----------------------MSQS---TFVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHIDS       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO27       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO45       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOUT       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOK1       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOL6       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO81       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOL5       -----------------------MSQS---TSVFRRNGFTFKQFFVAHDRCAMKAGTDGI
TRMN6_ECO8A       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECOSE       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHIF8       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHIFL       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHIB3       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHIBS       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SHISS       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO24       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO55       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ESCF3       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ECO5E       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKAGTDGI
TRMN6_ECO5T       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKAGTDGI
TRMN6_ECO57       -----------------------MSQS---TSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALEP       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALG2       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALCH       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALPC       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALTY       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALPA       -----------------------MSQS---GSALRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALPK       -----------------------MSQS---GSALRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALPB       -----------------------MSQS---GSALRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALTI       -----------------------MSQS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_SALAR       -----------------------MSHS---GSVLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_CITK8       -----------------------MSQS---TSTLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_KLEP3       -----------------------MSQS---KFALPRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_KLEP7       -----------------------MSQS---KFALPRNGFTFKRFFVAHDRCAMKVGTDGI
TRMN6_CROS8       -----------------------MSQP---KTPLRRNGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ENT38       -----------------------MSQP---KALLRRDGFTFKQFFVAHDRCAMKVGTDGI
TRMN6_ERWT9       -----------------------MSPY---KAILRPNGFTFKQFFIAHDRCAMKVGTDGV
TRMN6_EDWI9       -----------------------MPHPPSAALSLPRNGFTLKRFFVAHDRCEMKVGTDSI
TRMN6_AERHH       --------------------------------MGRNSGFTFKQFHVDHDRCAMKVGTDGI
TRMN6_AERS4       --------------------------------MGRNSGFTFKQFHVEHDRCAMKVGTDGI
TRMN6_TOLAT       --------------------------------MGGHS-FTFKQFHIDQDRCAMKVGTDSI
TRMN6_HAES1       --------------------------------MAKKQEFTFKQFHINQDQCAMKVGTDGI
TRMN6_HISS2       --------------------------------MAKKQEFTFKQFHINQDQCAMKVGTDGI
TRMN6_MANSM       -------------------------MTTFMNNKTKSAGFTFKQFHVSHDKCAMKVGTDGI
TRMN6_HAEIE       -----------------------------------MSGFTFKQFHINQNSCAMKVSTDGI
TRMN6_HAEIG       -----------------------------------MSRFTFKQFHINQDSCAMKVSTDGI
TRMN6_HAEI8       -----------------------------------MSGFTFKQFHINQDSCAMKVGTDGI
TRMN6_HAEIN       -----------------------------------MSRFTFKQFHINQNSCAMKVGTDGI
TRMN6_AGGAN       ---------------------------------MSNTGFRFKQFQVNHDRCAMKVGTDGI
TRMN6_PASMU       -------------------------------MSAKQNGFTFKQFHIDHHRCAMKVGTDGI
TRMN6_ACTSZ       --------------------------------MKAGNGFTFKRFHINHDRCAMKVGTDGI
TRMN6_ACTP7       --------------------------------MTKSQGFQFKQFFIAHDKCAMKVNTDGI
TRMN6_ACTP2       --------------------------------MTKSQGFQFKQFFIAHDKCAMKVNTDGI
TRMN6_HAEPS       -----------------------------------MSGFQFKQFFIAHDCCAMKVNTDGI
G2D941_9GAMM      MWCAHQRRWANAWQSCSANQPLPPGRPAAVVRLPIMSTFQFQQFSVAQAHSAMKVCTDAT
TRMN6_SHEB9       ------------------------------------MAFTFKQFHIDDMNCGMAVGTDSV
TRMN6_SHEB8       ------------------------------------MAFTFKQFHIDDMNCGMAVGTDSV
TRMN6_SHEB2       ------------------------------------MAFTFKQFHIDDMNCGMAVGTDSV
TRMN6_SHEB5       ------------------------------------MAFTFKQFHIDDMNCGMAVGTDSV
TRMN6_SHESW       ------------------------------------MAFTFKQFHIDDLNCGMAVSTDAV
TRMN6_SHEPC       ------------------------------------MAFTFKQFHIDDLNCGMAVSTDAV
TRMN6_SHESR       ------------------------------------MAFTFKQFHIDDLNCGMPVSTDGV
TRMN6_SHESM       ------------------------------------MAFTFKQFHIDDLNCGMPVSTDGV
TRMN6_SHESA       ------------------------------------MAFTFKQFHIDDLNCGMPVSTDGV
TRMN6_SHEON       ------------------------------------MAFTFKQFHIDDLNCGMPVSTDGV
TRMN6_SHEFN       ------------------------------------MSFTFKQFHIDDQQCGMAVSTDAV
TRMN6_SHEHH       ------------------------------------MPFTFKLFHVDDSRCGMPVSTDGV
TRMN6_SHEPA       ------------------------------------MPFTFKLFHVDDSRCGMPVSTDGV
TRMN6_SHEPW       ------------------------------------MPFSFKQFHIDDRRCGMPVSTDGV
TRMN6_SHELP       ------------------------------------MPFTFKQFHVDDSHCGMPVSTDGV
TRMN6_SHESH       ------------------------------------MAFTFKQFHIDDFGCGMPVSTDAV
TRMN6_SHEWM       ------------------------------------MAFTFKQFHIDDHGCGMPVSTDGV
TRMN6_SHEDO       ------------------------------------MAFTFKQFHIDDGQCAMAVSTDGV
TRMN6_SHEAM       ------------------------------------MGFSFKAFHVDDFGCGMPVSTDAV
TRMN6_ALIF1       ----------------------------------MSKSFTFKQFHIDIGSCGMPVSTDGV
TRMN6_ALIFM       ----------------------------------MSKSFTFKQFHIDIGSCGMPVSTDGV
TRMN6_ALISL       ----------------------------------MNKGFTFKQFHINIGLCGMPVSTDGV
TRMN6_VIBCB       ----------------------------MKSERIQTKGFKFKQFSIHGGESGMPVSTDGV
TRMN6_VIBPA       ----------------------------MKSGKFQTKGFKFKQFCIEGGESGMPVSTDGV
TRMN6_VIBVY       ----------------------------MKSGTLKTKGFKFKQFSIASSNSGMPVSTDGV
TRMN6_VIBVU       ----------------------------MKSGTLKTKGFKFKQFSIASSNSGMPVSTDGV
TRMN6_VIBCH       ----------------------------MKTNKLINKSFRFKQFSIEEGTCGMPISTDGV
TRMN6_VIBCM       ----------------------------MKTNKLINKSFRFKQFSIEEGTCGMPISTDGV
TRMN6_VIBA3       ----------------------------MKDKTINTKSFNFKRFSIYGGQSGMPVSTDGV
TRMN6_PHOPR       ----------------------------------MAKGFTFKQFHVDDGGCGMAVSTDGV
K0D841_ALTMS      -------------------------------------MFRCKQFTVAQDKCAMKVNTDSL
K0EDN1_ALTMB      ----------------------------------------------------MKVNTDSL
F5Z9A3_ALTNA      -----------------MVALEHHVLENTNKNIKRTTMFRCKQFVVNQTNCAMKVNTDSM
TRMN6_PSEA6       ---------------------------------MKRQGFQFKQFFIEHQDCAMKVGTDSI
TRMN6_PSET1       -----------------------------------MSGFAFKQFKVAHEQCAMKVSTDGI
TRMN6_FLAB3       -----------------------------------MKPFRFKKFTVQQHKEVFRVGTDGV
E4TCC0_RIEAD      -------------------------------MPKDLKPFRFKNFSIKQNTSVFRVGTDAV
F4KL19_PORAD      ----------------------------------MDKPFCMRHYALMQGACAMRISTDAL
C2MCX0_9PORP      ----------------------------------------MRHYALMQGACAMRISTDAL
H6L1S6_SAPGL      -----------------------------------MQDFQFKQFVVRQRLAAMKVGTDGT
I2EVX2_EMTOG      ---------------------------------MPKNSFTFKQFTVYQDQCGMKVCTDAC
D2QFQ7_SPILD      -------------------------------------MFSFKQFTIQQDRTAMKVCTDAC
E4RZ66_LEAB4      -------------------------------------MFRFKQFMVRQERSAMKVCTDSC
TRMN6_DYAFD       --------------------------------MPRNAHFRFKQFTVRQDQCAMKVCTDAC
F8EKV6_RUNSL      --------MNCRSNPAFQNNCLGEAKPFWKMPRIPSPFFRFKQFAVWHDRSALKVCTEAC
F0S552_PSESL      -----------------------------------MSIFRFKEFVVSQESCPMKINTDGV
H1YF68_9SPHI      ------------------------------------MVFRFKQFDVDQSGCAMKINTDGV
F4C8A2_SPHS2      ------------------------------MDTKSPVLFRFKQFHVEQTNATMKINTDGV
TRMN6_PEDHD       ----------------------------------MKNAFRFKQFEIDQTGCAMRINTDGV
H8KTG5_SOLCM      ---------------------------------MSKAYFEFKQFKVYHDKCAMKVGTDGL
G0IX66_CYCMS      ------------------------------MGRRPNTYFQFKQFRIEQERCAMKVSTDAV
E4TQK5_MARTH      -----------------------------------MSIFQFKEFSVEQKNSPAKITTDAT
I3Z4H8_BELBD      ---------------------------------MSNTFFKFKQFIVNQDRCGMKVSTDAV
C7PS46_CHIPD      ---------------------------------MPNHYFSFKQFTVYQDACAMKVCTDAC
TRMN6_CYTH3       ---------------------------------MSNSWFQFKQFTVQQDKTAMKVCTDSC
                                                                          *:. 

TRMN6_BACFN       LLGAWTPVESSA------RILDIGTGTGLVALMLAQRC----------------------
TRMN6_BACFR       LLGAWTPVESSA------RILDIGTGTGLVALMLAQRC----------------------
TRMN6_BACTN       LLGAWASVQGAH------RILDIGTGTGLVALMLAQRSLP--------------------
TRMN6_BACV8       LLGAWADVVSAR------NILDIGTGTGLISLMMAQRC----------------------
TRMN6_PARD8       LLGAWASTERCQ------RILDVGTGTGLIALMLAQRS----------------------
TRMN6_FLAJ1       LLGSWAPVFHNP-----FSILDIGAGTGIIALMLAQRTH---------------------
TRMN6_FLAPJ       LLGAWTPINHNP-----ISILDIGAGTGLIALMLAQRTS---------------------
TRMN6_GRAFK       LLGAWASLEHFP-----DSILDIGTGTGLIALMLAQRSD---------------------
TRMN6_PORGI       LLGAWAGEDAAGS--IPQHCLDIGTGTGLIALMLAQRFP---------------------
TRMN6_PORG3       LLGAWAGEDPAGS--IPQHCLDIGTGTGLIALMLAQRFP---------------------
I3YQ37_ALIFI      LLGAWAGVRPSD-----RRILDVGTGTGLIALMMAQRAP---------------------
F2KTM2_PREDF      LLGAWAEGGAD--------ILDIGTGTGLIALMMAQRFP---------------------
TRMN6_TRIEI       LLGAWVDVSGAE------KILDIGTGTGLIALMLAQRSSQL-------------------
TRMN6_YERP3       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPA       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPP       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPG       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPN       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPB       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPE       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPS       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERPY       LLGAWVPVLH------ARRVLDIGCGSGLIALMIAQRSL---------------------
TRMN6_YERE8       LLGAWVPVEK------ARKVLDIGCGSGLIALMIAQRST---------------------
TRMN6_PROMH       LLGAWAPITK------AKTVLDIGTGSGLIALMLAQRAP---------------------
TRMN6_PHOLL       LLGAWTPVSD------KKAILDIGCGSGLIALMLAQRTD---------------------
TRMN6_SERP5       LLGAWAPLAQ------AQRVLDIGSGSGLIALMLAQRTA---------------------
TRMN6_PECAS       LLGAWAPVSS------ATRVLDIGSGSGLLALMLAQRSE---------------------
TRMN6_PECCP       LLGAWAPLSS------VTRILDIGSGSGLLALMLAQRSD---------------------
TRMN6_DICC1       LLGAWVPLRE------ETRILDIGCGSGLLGLMLAQRSG---------------------
TRMN6_DICP7       LLGAWAPLRH------ESRILDVGCGSALISLMLAQRCE---------------------
TRMN6_ECOLU       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOSM       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOBR       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOBW       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECODH       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOHS       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOLC       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOLI       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO7I       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_SHIDS       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO27       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO45       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOUT       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOK1       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOL6       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO81       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECOL5       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO8A       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_ECOSE       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SHIF8       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SHIFL       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SHIB3       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SHIBS       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SHISS       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_ECO24       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO55       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ESCF3       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTD---------------------
TRMN6_ECO5E       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_ECO5T       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_ECO57       LLGAWAPVAG------VKRCLDIGAGSGLLALMLAQRTS---------------------
TRMN6_SALEP       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALG2       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALCH       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALPC       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALTY       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALPA       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALPK       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALPB       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALTI       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_SALAR       LLGAWAPVAD------VKRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_CITK8       LLGAWAPVAG------VTRILDIGTGSGLLALMLAQRTD---------------------
TRMN6_KLEP3       LLGAWAPIAG------VKHVLDIGAGSGLLALMLAQRTD---------------------
TRMN6_KLEP7       LLGAWAPIAG------VKHVLDIGAGSGLLALMLAQRTG---------------------
TRMN6_CROS8       LLGAWAPVAK------AQRVLDIGAGSGLLTLMLAQRTE---------------------
TRMN6_ENT38       LLGAWAPVAG------VKRILDIGSGSGLLALMLAQRTE---------------------
TRMN6_ERWT9       LLGAWAPVTS------VKRVLDIGSGSGLIALMLAQRTS---------------------
TRMN6_EDWI9       MLGAWLPLRGD-----ERHILDIGSGSGVLALMMAQRS----------------------
TRMN6_AERHH       LLGAWAPVTN------ARRVLDIGSGSGLIALMLAQRSP---------------------
TRMN6_AERS4       LLGAWAPVAE------TRRVLDIGTGSGLVALMLAQRSR---------------------
TRMN6_TOLAT       VLGSWTPVRG------AKRILDIGTGTGILALMLAQRTA---------------------
TRMN6_HAES1       LLGAWANINQ------ANTLLDLGTGTGLIALMLAQRSP---------------------
TRMN6_HISS2       LLGAWANINQ------ANTLLDLGTGTGLIALMLAQRSP---------------------
TRMN6_MANSM       LLGAWASL-Q------GNRYLDLGTGSGLIALMLAQRTQ---------------------
TRMN6_HAEIE       LLGAWADVKH------CKNILDMGSGTGLLALMLAQRTE---------------------
TRMN6_HAEIG       LLGAWADVKH------CKNILDMGSGTGLLALMLAQRTE---------------------
TRMN6_HAEI8       LLGAWADVKH------CKNILDMGSGTGLLTLMLAQRTE---------------------
TRMN6_HAEIN       LLGAWADVKH------CKNILDMGCGTGLLALMLAQRTE---------------------
TRMN6_AGGAN       LLGAWADVMQ------AKQILDLGSGSGLIALMLAQRSS---------------------
TRMN6_PASMU       LLGAWADVSQ------SERILDLGTGTGLIALMLAQRST---------------------
TRMN6_ACTSZ       LLGAWADLAN------SRSILDLGTGSGLIALMLAQRSD---------------------
TRMN6_ACTP7       LLGAIADIRH------KRQILDLGTGTGLVAIMLAQRTD---------------------
TRMN6_ACTP2       LLGAIADIRH------KRQILDLGTGTGLVAIMLAQRTD---------------------
TRMN6_HAEPS       LLGSIADPSN------ARHILDLGTGTGLIAIMLAQRT----------------------
G2D941_9GAMM      LFGAMAPVQK------DDRVLDIGAGTGLLSLMLAQLG----------------------
TRMN6_SHEB9       VLGAWAQLTA------AKTVLDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEB8       VLGAWAQLTA------AKTVLDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEB2       VLGAWAQLTA------AKTVLDIGAGSGLLSLMAAQRC----------------------
TRMN6_SHEB5       VLGAWAQLTA------AKTVLDIGAGSGLLSLMAAQRC----------------------
TRMN6_SHESW       VLGAWAPLTN------AKQILDIGAGSGILGLMAAQRS----------------------
TRMN6_SHEPC       VLGAWAPLTN------AKQILDIGAGSGILGLMAAQRS----------------------
TRMN6_SHESR       ILGAWAPLAE------AKNILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHESM       ILGAWAPLAE------AKNILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHESA       ILGAWAPLSR------AKHILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEON       ILGAWSPLSQ------AQQILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEFN       LLGAWAELTQ------SSHILDIGAGSGLLSLMAAQRSP---------------------
TRMN6_SHEHH       LLGAWAPLVQ------AKTILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEPA       LLGAWAPLVQ------AKTILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEPW       LLGAWAPLSN------SKNILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHELP       LLGAWAPLTQ------AKTILDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHESH       ILGAWAPLSD------AQNILDIGAGSGLLSLMATQRS----------------------
TRMN6_SHEWM       LLGAWAPLSK------AENLLDIGAGSGLLSLMAAQRS----------------------
TRMN6_SHEDO       LLGAYAPLTQ------AKSVLDIGAGSGLLSLMAAQRTQ---------------------
TRMN6_SHEAM       LLGAWANLDG------ADAVLDLGAGSGLLALMAAQRC----------------------
TRMN6_ALIF1       LLGAWADIRA------CSQILDIGAGTGLLSLMSAQRNSD--------------------
TRMN6_ALIFM       LLGAWTNISE------CSQILDIGAGTGLLSLMSAQRNSN--------------------
TRMN6_ALISL       LLGAWANIEQ------SKNILDIGCGTGLLSLMSAQRNEN--------------------
TRMN6_VIBCB       MLGAWVNCIP------QNKILDIGTGTGLLALMCAQRFPS--------------------
TRMN6_VIBPA       MLGAWMESPS------PAHILDIGTGTGLLALMCAQRFPD--------------------
TRMN6_VIBVY       LLGAWADFHH------SQNLLDIGTGTGLLSLMCAQRYAH--------------------
TRMN6_VIBVU       LLGAWADFHH------CQNLLDIGTGTGLLSLMCAQRYVH--------------------
TRMN6_VIBCH       LLGSWAFSLS------PTTILDIGCGTGLLSLMCAQRFPH--------------------
TRMN6_VIBCM       LLGSWAFSLS------PTTILDIGCGTGLLSLMCAQRFPH--------------------
TRMN6_VIBA3       LLGSWINLAP------ESLVLDIGTGTGLLALMAAQRFED--------------------
TRMN6_PHOPR       LLGAWATLPK------QGKLIDIGTGSGLLALMMAQRTAP--------------------
K0D841_ALTMS      ILGSWAEP------GTAKHILDVGTGSGILALMMAQKSEHFFHSSTDEQRVE--------
K0EDN1_ALTMB      ILGSWAQFRA--NFSHAPRILDIGTGSGILALMMAQKAAHFCNPNGEAQNVQSSSIDISS
F5Z9A3_ALTNA      ILGSWAKP------NQSAHILDIGTGTGILALMMAQQS----------------------
TRMN6_PSEA6       MLGSWVTGGDLINASETQRFLDIGTGSGLLAIMLAQKS----------------------
TRMN6_PSET1       LLGAWANL------SNANSLLDIGTGTGLLALMCKQRS----------------------
TRMN6_FLAB3       LLGALA-DVSDAK-----NILEVGTGTGLVALMTAQRNP---------------------
E4TCC0_RIEAD      LLGALA-TVDNIK-----TALEVGCGTGIISLMIAQRNP---------------------
F4KL19_PORAD      FLGAWARTAHTAS-----QVLDVGTGTGILSLMLAQTYP---------------------
C2MCX0_9PORP      FLGAWARTAHTAG-----QVLDVGTGTGILSLMLAQTYP---------------------
H6L1S6_SAPGL      LLGAWA--HCSGQ-----RILDIGAGTGLLALMLAQRFA---------------------
I2EVX2_EMTOG      IFGASIDTKN------AQRILDIGTGTGLLSLMLAQRT----------------------
D2QFQ7_SPILD      VLGAYADVKGDEITDRVINLLDIGTGTGLLALMVAQRNP---------------------
E4RZ66_LEAB4      LFGALIEASD------AKRALDIGTGTGLLSLMVAQRNP---------------------
TRMN6_DYAFD       VLGAWADVED------ADRILDIGAGTGLLSLMVAQRNT---------------------
F8EKV6_RUNSL      ILGAYADVAG------AERALDIGTGTGLLALMAAQRNT---------------------
F0S552_PSESL      LLG-ALANVSN-----AKHICDIGTGTGVIALMLAQRNK---------------------
H1YF68_9SPHI      LLG-AMVKADE-----PHYILDIGTGTGVIALMMAQKFP---------------------
F4C8A2_SPHS2      LLG-ALADHPS-----PNRILDIGSGTGVIAMMMAQRFP---------------------
TRMN6_PEDHD       LLG-AVAGKNE-----AANILDIGTGTGVIALMLAQRFP---------------------
H8KTG5_SOLCM      LLG-TLTDCSK-----AAQILDIGAGTGLIALILAQR-S---------------------
G0IX66_CYCMS      VLG-SLAKANS-----PASILDIGTGTGVLALMMAQKYP---------------------
E4TQK5_MARTH      VFAASLQISSN-----VRAVLEVGTGTGVLSLMLAQRFS---------------------
I3Z4H8_BELBD      VLG-ALAGKKS-----PLSILDVGVGTGVISLMLAQRFD---------------------
C7PS46_CHIPD      VQGAYTAAWLRE-QSPVSRILDIGTGTGLLSLMLAQQ-S---------------------
TRMN6_CYTH3       VFGATVPV-----TTSTYTILDIGTGTGLLALMLAQR-S---------------------
                  . .                  ::* *:.:: ::  *                        

TRMN6_BACFN       ----SASVIALEIDGTAAQQAAENITRSPWGSRIEVVCQDFRLYSNKNN-----------
TRMN6_BACFR       ----SASVIALEIDGKAAQQAAENITRSPWGSRIEVVCQDFRLYSNKNN-----------
TRMN6_BACTN       ----DANIVALEIDEAAAGQAKENVARSPWKDRIEVVKQDFLFYQSPD------------
TRMN6_BACV8       ----NARIRAVDIDADAVEQARGNVAASPWQDRIEVELQDICHFTSET------------
TRMN6_PARD8       ----TAILDAIDIDSDACLQAQENIAKSPFANRIQVYQTSLSEYMPDEN-----------
TRMN6_FLAJ1       ----AEQIDALEIDEDAYEQAVENFEASPWGDRLFCFHAGLDEFIEEP------------
TRMN6_FLAPJ       ----AVQIDALEIDEEAYEQATDNFENSPWSDRLFCYHAGLDEFVEEP------------
TRMN6_GRAFK       ----AELIDALEIEENAYEQSVENFENSDWGDRLFCYHAAFDEFVEEM------------
TRMN6_PORGI       ----QARVQGIEIDPIAAECARANAAASPFSDRIVIASGDILDSSLESL-----------
TRMN6_PORG3       ----QARVQGIEIDPIAAECARANAAASPFSDRIVIASGDILDSSLESL-----------
I3YQ37_ALIFI      ----EARITGVDVEKVSQ--ARENAAASPWGGRVAFEQCPVQEFAPD-------------
F2KTM2_PREDF      ----SAHIDAVEMDEGAVADAHLNIVRSPFRDRINIIHTSLQDYHPQN------------
TRMN6_TRIEI       ----KVDIDAVEIDINSSIQARENVERSRWSDRVKVENYSIQKYIDIC------------
TRMN6_YERP3       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPA       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPP       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPG       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPN       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPB       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPE       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPS       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERPY       ---PQVQIDGVELEPAAAQQASSNVELSPWAERIHIHQQDIHQFAEN-------------
TRMN6_YERE8       ---PEVMIDGVELEPEAAQQASSNAAQSPWAERVHIYQQDVHQFAEN-------------
TRMN6_PROMH       ---QVERIDGIELDEDAALQASENAQQSQWSSLIHIYHHDIYQYAQQ-------------
TRMN6_PHOLL       ---ENTKIDAVELDTEAALQAQDNAEQSPWQRKIDVYQQDIGDFAEQ-------------
TRMN6_SERP5       ---ENVQIDAVELDEAAAAQAHDNVLESPWSLRIQVHAQDIHHFAQH-------------
TRMN6_PECAS       ---PHVRIDAVELDSAASQQAKENSAASPWADRITVYAEDIVSFSAM-------------
TRMN6_PECCP       ---THVRIDAVELDSAASQQAKENISASPWADRIAVYAEDIIDFADT-------------
TRMN6_DICC1       ---GRFPIDGVELDAAASTQAADNAAASPWADCIRIYPADIVGYAQT-------------
TRMN6_DICP7       ---GRVPVDAVELDIAASVQAAENVAASPWRDTVVVHQADIVEFSCT-------------
TRMN6_ECOLU       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOSM       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOBR       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOBW       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECODH       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOHS       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOLC       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOLI       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECO7I       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_SHIDS       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECO27       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECO45       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECOUT       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECOK1       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECOL6       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECO81       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECOL5       ---DSVMIDAVELESEAAAQAQENINQSPWAERINVHTADILQWITQ-------------
TRMN6_ECO8A       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECOSE       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_SHIF8       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_SHIFL       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_SHIB3       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWLTQ-------------
TRMN6_SHIBS       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWLTQ-------------
TRMN6_SHISS       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWLTQ-------------
TRMN6_ECO24       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ECO55       ---DSVIIDAVELESEAAAQAQENINQSPWAERINVHTADIQQWITQ-------------
TRMN6_ESCF3       ---DSVMIDAVELESEAATQAQENINQSPWAERINIYPADIQQWITQ-------------
TRMN6_ECO5E       ---DSVIIDAVELESEAATQAQENVAQSPWLERINVHTADIQQWVTQ-------------
TRMN6_ECO5T       ---DSVIIDAVELESEAATQAQENVAQSPWLERINVHTADIQQWVTQ-------------
TRMN6_ECO57       ---DSVIIDAVELESEAATQAQENVAQSPWLERINVHTADIQQWVTQ-------------
TRMN6_SALEP       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQSWAPR-------------
TRMN6_SALG2       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQSWAPR-------------
TRMN6_SALCH       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALPC       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALTY       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALPA       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALPK       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALPB       ---DNVPIDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALTI       ---DSVPVDAVELDAGAAMQAQENVAHSPWPHRITVHTDDIQRWAPR-------------
TRMN6_SALAR       ---DNVPVDAVELDAEAAMQAQENVAHSPWAHRITVHTDDIQRWAPR-------------
TRMN6_CITK8       ---ESVTIDAVELDSEAATQAQENIAHSPWPQRITVHTEDVRQWVPR-------------
TRMN6_KLEP3       ---HDVQVDAVELDEEAAAQARENALASPWSSRIEVCQADIHQWQPS-------------
TRMN6_KLEP7       ---DDVHVEAVELDEEAAAQARENALASPWASRIEVWQADIHQWQPS-------------
TRMN6_CROS8       ---DTVTLDAVELDAQAAEQARENIDASPWAARIQVHSADIQTWTQQ-------------
TRMN6_ENT38       ---QHVTIDSVELDAQAANQASENAAESPWAERVQVQCADILAWAPE-------------
TRMN6_ERWT9       ---EPVQIDAVELDEEAATQAQENVAASPWAHRVHVQQADVVEWAQR-------------
TRMN6_EDWI9       ----TAQVDGVEIEPGAATQGQENFLASPWPTRLTMHTLSLQAFSAG-------------
TRMN6_AERHH       ---ADCRIDAVELDSNAARQARENAAASPWHERVTVIESAIQTY----------------
TRMN6_AERS4       ---SDCIIDAVDLDMNAATQARENVAASPWETRINIMEGAIQDY----------------
TRMN6_TOLAT       ---QQVQIDAVELDKDAVKQAEENINASPWRERIRVIRHDIRTF----------------
TRMN6_HAES1       ---EHCHISAVELDPQAYLQAKDNIQQSPWANKIKIFQQDIIVFAQD-------------
TRMN6_HISS2       ---EHCQISAVELDQLAYLQAKDNIQQSPWANKIKIFQQDIIVFAQD-------------
TRMN6_MANSM       ---TDCHITGVEIDPSAYRQATENVRQSPWADKIQLEQQNIVDFTRT-------------
TRMN6_HAEIE       ---ENCQIQAVELDPIAAKQAQENINNSVWKNRIQLIQTDIQHFLQT-------------
TRMN6_HAEIG       ---ENCQIQAVELDPIAVKQAQENINDSVWKNRIQLIQTDIQHFLQT-------------
TRMN6_HAEI8       ---ENCQIQAVELDPIAAKQAQENINNSVWKNRIQLTQADIQHFLQT-------------
TRMN6_HAEIN       ---ENCQIQAVELDPIAAKQAQENINNSVWKNRIQLTQVDIQHFLQT-------------
TRMN6_AGGAN       ---AESRICAVEIDPAAAQQARENALASPWKEKIQVYQQDIDSFCTQ-------------
TRMN6_PASMU       ---KESEIHAVELDQAAYLQAQANVHASPWAQRVHVYQQDAAEFCRN-------------
TRMN6_ACTSZ       ---EDVQIHGVERDPAAARQAQENFRASPWAHRLYLHFGDIADFAQK-------------
TRMN6_ACTP7       ---ENTRISALELEPNAYRQAVENCRNSAFSDRLQVYQGDVLDY--H-------------
TRMN6_ACTP2       ---ENTQISALELEPNAYRQAVENCRNSAFSDRLQVYQGDVLDY--H-------------
TRMN6_HAEPS       ---ASAQITALELEENAFHQAQENAQRCPWNNRIDVLQADIMTW--K-------------
G2D941_9GAMM      ----AGSVTGVELTKEAFDECRDNFRNSPWAGRLQAVHQDIREFAAG-------------
TRMN6_SHEB9       ----QAHITSVELDTSAAEACQHNFHNSPWANRLTLVNSSIQDFCQQIE-----------
TRMN6_SHEB8       ----QAHITSVELDTSAAEACQHNFHNSPWANRLTLVNSSIQDFCQQIE-----------
TRMN6_SHEB2       ----QAHITSVELDTSAAEACQHNFHNSPWANRLTLVNSSIQEFCQQIE-----------
TRMN6_SHEB5       ----QAHITSVELDTSAAEACQHNFHNSPWANRLTLVNSSIQEFCQQIE-----------
TRMN6_SHESW       ----QANITCIELDDTAAIACQHNIAQSPWASRIRLVQGSIQQLSQAEE-----------
TRMN6_SHEPC       ----QANITCIELDNTAAIACQHNIAQSPWASRIRLVQGSIQQLSQAEE-----------
TRMN6_SHESR       ----QGQITAVELEEKAAAACRYNMTQSPWAKRCQLVHGDIQHVCQLAQ-----------
TRMN6_SHESM       ----QGQITAVELEEKAAAACRYNMTQSPWAKRCQLVHGDIQSVCQLAQ-----------
TRMN6_SHESA       ----QGQITAVELEEKAAAACQYNMTQSPWADRCKLIHGDIQHVCQQAE-----------
TRMN6_SHEON       ----LGRITAVELEEKAAAACLYNMVQSPWADRLSVIHCDIQDFCQQTQ-----------
TRMN6_SHEFN       ---HHTSIIAVEIDNAAAKACQFNIKQSPWSETVQLFHGAIQDFQQRHN-----------
TRMN6_SHEHH       ----QAKITAIELDNDAALDCQQNFDASHWSERLEIICCDIQAYCQR-------------
TRMN6_SHEPA       ----LAKITAIEVDTDAALDCQQNFNASPWFDRLEVICCDIQAYAQAHTQVHSQAH---N
TRMN6_SHEPW       ----KANITAIELDENAALDCQSNFNLSPWSKRLTLLTRSIQQFCTT-------------
TRMN6_SHELP       ----EAVIQALEIDPLAAQDCQHNIDQSPWSDRITLIQADLLQWYPL------------A
TRMN6_SHESH       ----NAKVTSIELDDTAVNACQKNFEASPWTSRLTVKHSSVQEFSKQHQ-----------
TRMN6_SHEWM       ----EAQITAVELDDTAFHACNKNFIASKWQSRLNLVYASVQEFCNQHT-----------
TRMN6_SHEDO       ---ADCQIVAIELDQNAANACQNNVNNSPWSKRIKVVNSSIQAYCDDLASLSSQVDNQTA
TRMN6_SHEAM       ----KAPITAIEIDPVAASACRSNFSASPWPDRINLIEADATDAEALAG-----------
TRMN6_ALIF1       ---A--HIDAIELMPIAADVARLNFYQSPWKERLTLIHHDFLTYQAPH------------
TRMN6_ALIFM       ---A--HIDAIELMPIAAEVARLNFSQSPWKERLVLIHQDFLSYQTAY------------
TRMN6_ALISL       ---S--HVDAVELMPLAAEVALQNFVQSPWKNRLHLIHQDILHYHPAH------------
TRMN6_VIBCB       ---A--QITALDIEITAIEAAKQNFAQSTWSDRLSLHHSDVLQFEPEH------------
TRMN6_VIBPA       ---A--KITAVDIETTAVEAASHNFSHSPWHDRLSVQHTDVLIFSPPQ------------
TRMN6_VIBVY       ---L--SITAVDIDAHAMEAAQENFSHSPWHSRLHLQHGDVLKLNFTH------------
TRMN6_VIBVU       ---L--SITAVDIDAHAMEAAQENFSHSPWHSRLQLQHGDVLKLNFTH------------
TRMN6_VIBCH       ---A--HITALDIEQTAYLAAEHNRQQSPWAERIECQHADILHWQPSK------------
TRMN6_VIBCM       ---A--HITALDIEQTAYLAAEHNRQQSPWAERIECQHADILHWQPSK------------
TRMN6_VIBA3       ---A--LISAIDIDQHAIDAATVNIEQSPWQDRISLHHDSVLTTDFSQ------------
TRMN6_PHOPR       ---APCSIIAIELDDSAADAAAKNFSNSPWSSSLHCVKQDIQQWNRTQP-----------
K0D841_ALTMS      -NQRAVRIDAIEIDEDAAAQAALNFKNSKWANQLFSRCCDVNSFISPY------------
K0EDN1_ALTMB      FDNGAARIDAIEIDEQAAAQAATNFKNAKWAKQLFIYCCDVTGYTSPH------------
F5Z9A3_ALTNA      --LASAKITAIDIDEGAALQASANVGASPWPTKIVVQHTKLSDLVADN------------
TRMN6_PSEA6       --SEQTHISGIDIDKDAIGQATRNMANSPWSHRLDAQQASVQSFTQNCD-----------
TRMN6_PSET1       ---PQLTITAVEVDKNAYQQALQNIAASPWPN-IEVHQQSIQTFNSAQ------------
TRMN6_FLAB3       ----TSNITAIDVNPVAAELAAKNFLESHFGHRMRAMHCDYKTFG---------------
E4TCC0_RIEAD      ----NCSIIAIDIDENASNLAQENFDNSVYQERLKSININFMEYQ---------------
F4KL19_PORAD      ----SAMVTAIDIDDEAVRTAQDNFSRSPYGDRLTALSCDITAPELAL------------
C2MCX0_9PORP      ----SAMVTAIDIDDEAVRTAQDNFSRSPYSNRLTALSCDITAPELAL------------
H6L1S6_SAPGL      ----QAQIDAVEINLQAAEEAQKNFAASPWADRLSLYAQGLQSFS---------------
I2EVX2_EMTOG      ----DAKIDAVEIDESAYQQAISNVEKSNFGQKISVFHQKIQDFES--------------
D2QFQ7_SPILD      ----MASIDAVEVDDAAYSQAIQNVGASPFANRIQVMQSRIQDYRP--------------
E4RZ66_LEAB4      ----SLIIDAVEIDSGAVQDATENVLDSPFASRIKVFYEDIKDFVP--------------
TRMN6_DYAFD       ----YAMIDAVEIDAEAFYQAGENVEQSPFHDRITLFHSAVQEFVS--------------
F8EKV6_RUNSL      ----ELYTDAVEIEEQNYIQAVNNVAHSPFAGRISVHHSSIQEWSDRKANTALY------
F0S552_PSESL      ----NAKIDALDIDYRAVDTATKNFENSLFHARLKCYHHSFVEFFEM-------------
H1YF68_9SPHI      ----GAVIDAVELDTAAAQTAGKNFGNSNFSNKLHVHPLGFEEYFNH-------------
F4C8A2_SPHS2      ----HAIIDAVEKDELAAQLSDKNFKNSIFFNRIRAHCTLFQEF----------------
TRMN6_PEDHD       ----NALVDAVEIDEQAALTATKNALNAPFSGRLKVLHSAIEDY----------------
H8KTG5_SOLCM      ----DAIIDAIEIDDDASEQAKSNFDFSPWSDRLTCFHSSVFDF----------------
G0IX66_CYCMS      ----VASIDAVEIDKEAFEQARQNVSFNKLGINIKVHQQAFQEF-EP-------------
E4TQK5_MARTH      ----DIKIDAVEINPIAYEEAQNNFKNSKWNARLKVVLEDFIEF-ET-------------
I3Z4H8_BELBD      ----NATVFGVEIEDSAFGQALENIQASKFAKRVSVKHQDFQTY-SD-------------
C7PS46_CHIPD      ----EAAITGIELDPAAAGQARTNFDASPWKERLQVIETDAKQLP---------------
TRMN6_CYTH3       ----NADIDAVELNKDAAQQATDNFFNSPWNERLHVHTCSIQDYFKF-------------
                            ::           *                                    

TRMN6_BACFN       --S--LKYDTIVSNPPYFTDSLK------CPDSQRNTARHNDNLSYEELLKGVSNLLSPN
TRMN6_BACFR       --S--LKYDTIVSNPPYFTDSLK------CPDSQRNTARHNDNLSYEELLKGVSNLLSPN
TRMN6_BACTN       ------KFDVIVSNPPYFVDSLS------CPDQQRSMARHNDSLTYEKLLKGVADLLKKE
TRMN6_BACV8       ------LFDVIVSNPPYFTDSLK------CPGKQRNIARHTDFLDFDKLAGSAARLLHPE
TRMN6_PARD8       -----IKYDLIVSNPPYFIDSLK------CPDTKRNLARHTDTLSLPDLLRDSRKLLAPE
TRMN6_FLAJ1       --EDE--YDLIVSNPPFYAEDYK------TNDEQRDLARFQDAMPFEEIVEAADLLLSEN
TRMN6_FLAPJ       --EDE--YDLIVCNPPFYAENYK------TNSEQRDLARFSDAMPFEELIEAADLLLSEN
TRMN6_GRAFK       --QDEEKYDLIISNPPFYSENYK------TGDEYRDQARFADALPLTELIQGASHLLSEN
TRMN6_PORGI       --IGNQRFDLIVSNPPFFKSSMH------APDRQRTMARHEETLPLEKLICRASELLSPQ
TRMN6_PORG3       --IGNQRFDLIVSNPPFFKSSLH------APDRQRTMARHEETLPLEKLICRASELLSPQ
I3YQ37_ALIFI      -----ERFDLIVSNPPFFVDSLT------CPDEGRTTARHAVRLPFDQLRDAVVRLLAAE
F2KTM2_PREDF      ----GCRYEAIVCNPPYFINSLK------SPLQQRSTARHADTLSCQELARHAERLLKEN
TRMN6_TRIEI       ----QKRYDLIVSNPPFFENASK------PVKKARTVARHTDFLSQADLLQAAVKLLSDT
TRMN6_YERP3       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPA       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPP       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPG       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPN       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPB       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPE       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPS       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_YERPY       ---HPHQYDLIVSNPPYFAPAIA------CRDEARDTARYTGSLTHDTLLNCAEKLITED
TRMN6_YERE8       ---HLHQYDLIVSNPPYFAPAVA------CRDEARDTARYTGSLTHDALLNCAEKLITED
TRMN6_PROMH       ---APTRYDLIVSNPPYFEPAVA------CRNQEREQARYTKTLTHEGLLDSAQQLITDE
TRMN6_PHOLL       ---YSQCYDLIVSNPPYFEPAVA------CRNEAREQARYTGSMTHQQLLQYAETLITAD
TRMN6_SERP5       ---HAGQYDLIVSNPPYFEPAVA------CRDQARHNARYTETLTHDALLASAEQLIVPQ
TRMN6_PECAS       ---RTADYSLIISNPPYFPPGIA------CGSAQREQARYTTLLTHEVLLRCAHQLLMPE
TRMN6_PECCP       ---RSADYSLIISNPPYFPPGIA------CGSAEREQARYTTLLTHETLLRCAHQLLMPD
TRMN6_DICC1       ---ATRRYSLIVSNPPYFSPGVD------CASAQRAQARYTTTLTHDALLDCAGRLLEPD
TRMN6_DICP7       ---TPHRYSLVVSNPPYFAAGVA------CASPQRTQARYTSSLSHEALLHSVSAVLMPE
TRMN6_ECOLU       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOSM       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOBR       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOBW       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECODH       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOHS       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOLC       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOLI       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO7I       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHIDS       ---QTVRFDLIISNPPYYQQGVE------CSTPQREQARYTTTLDHPSLLACAAECITEE
TRMN6_ECO27       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO45       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOUT       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOK1       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOL6       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO81       ---QTVRFDLVISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOL5       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO8A       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECOSE       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHIF8       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHIFL       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHIB3       ---QTVRFDLIISNPPYYQQGVE------CAIPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHIBS       ---QTVRFDLIISNPPYYQQGVE------CAIPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_SHISS       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO24       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ECO55       ---QTVRFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHPSLLTCAAECITEE
TRMN6_ESCF3       ---QTARFDLIISNPPYYQQGVE------CATPQREQARYTTTLDHQSLLTCAAECITEE
TRMN6_ECO5E       ---QTARFDLIISNPPYYEQGVE------CATPQREQARYTTSLDHQTLLTCAAECITEE
TRMN6_ECO5T       ---QTARFDLIISNPPYYEQGVE------CATPQREQARYTTSLDHQTLLTCAAECITEE
TRMN6_ECO57       ---QTARFDLIISNPPYYEQGVE------CATPQREQARYTTSLDHQTLLTCAAECITEE
TRMN6_SALEP       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALG2       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALCH       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALPC       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALTY       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALPA       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALPK       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALPB       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALTI       ---QTVRFDLIISNPPYYEPGVE------CSTPQREQARYTATLDHQTLLAIAADCITED
TRMN6_SALAR       ---QTVRFDLIISNPPYYEPGVE------CATPQREQARYTATLDHQTLLAIAADCITED
TRMN6_CITK8       ---QTARFDLIISNPPYYEQGVE------CATPQREQARYTTTLDHEALLTTAAECITEE
TRMN6_KLEP3       ---QTRRYELIISNPPFFAEGVP------CATSQREQARYTTTLDHASLLTCAAEHITEE
TRMN6_KLEP7       ---QTRRYELIISNPPFFAEGVP------CATSQREQARYTTTLDHASLLTCAAEHITEE
TRMN6_CROS8       ---QTQRYELIVSNPPYYDKGVA------CATPAREQARYTTTLDHGTLLACAAQLITEE
TRMN6_ENT38       ---QTARYDLIVSNPPYYEPGVD------CGTPEREQARYTGSLGHPALLAAAANLISEE
TRMN6_ERWT9       ---CEHSYSLIVSNPPYFSPGSQ------CASPERTTARYTTGLTHEMLLDCAEKLIDED
TRMN6_EDWI9       ---CGRRYDLIVSNPPYFAPGVA------CRTAARATARYTDSLDHAALLRHAAELSCED
TRMN6_AERHH       ---QATPYDLIVSNPPYFVAGQS------FRDPARALARHTGGLDSRDLLAACDRLLAPN
TRMN6_AERS4       ---QATPYDLIVSNPPYFGAGQS------LRDPARALARHTGSLDSRDLLAACDRLLTPV
TRMN6_TOLAT       ---QAPHYDLIISNPPYFVHGQT------LPDAARQLARHTGELDQTALLESAARLLTPF
TRMN6_HAES1       ---CEHKFDVITANPPYFKQGID------CASKQRNLARYTLTQSHLDWLNAAEKLLNLT
TRMN6_HISS2       ---CEHKFDVITANPPYFKQGVD------CASKQRNLARYTLTQSHLDWLNAAEKLLNLT
TRMN6_MANSM       ---CTKKFDTVLSNPPYFEQGVD------CRDKQRDTARYTQTLSHSDWLNLAADCLTNT
TRMN6_HAEIE       ---TAQTFDLIVANPPYFEQGIA------CKNEERELARYT-KQSHLNWLEWAATRLSEN
TRMN6_HAEIG       ---TAQTFDLIVANPPYFEQGIA------CKNEERELARYT-KQSHLNWLEWAATRLSEN
TRMN6_HAEI8       ---TEQTFDLIVANPPYFEQGIA------CKNEERELARYT-KQSHLNWLEWAATRLSEN
TRMN6_HAEIN       ---TEQTFDLIVANPPYFEQGIA------CKNEERELARYT-KQSHLNWLEWAATRLSEN
TRMN6_AGGAN       ---TAQRFDLIVANPPYFEAGIA------CRDDERNTARYF-TQSHLHWLQTAQRCLAPN
TRMN6_PASMU       ---AVNKFDLIVANPPYFPQGVD------CATPQRDLARYTATHRHVDWLNWASHCLSEQ
TRMN6_ACTSZ       ---CGQKFDNIVANPPYFAQGVD------CRNHARNAARYTAALSHAQWLEIASSLLTEQ
TRMN6_ACTP7       ---FHQKFDLIVSNPPYFSESLA------SRSYERDLARAA-TQSHLDWLLQAKKWLAEQ
TRMN6_ACTP2       ---FHQKFDLIVSNPPYFSESLA------SRSYERDLARAA-TQSHLDWLLQAKKWLAEQ
TRMN6_HAEPS       ---STKKFDLIVSNPPYFEHSLA------SRNKQRDLARAV-TYSHFDWLKQSQQWLTPN
G2D941_9GAMM      ---NPTRYDLIISNPPFFTDHTR------TADPLRATARHTDQLPYQQLLAIAAELIDAQ
TRMN6_SHEB9       -YQE--YFDHIICNPPYFEQGTQ------AIQSQRAMARHTDSLSFAALLDAIHVCLAPQ
TRMN6_SHEB8       -YQE--YFDHIICNPPYFEQGTQ------AIQSQRAMARHTDSLSFTALLDAIHVCLAPQ
TRMN6_SHEB2       -YQE--YFDHIICNPPYFEQGTQ------AIQSQRAMARHTDSLSFTALLDAIHVCLAPQ
TRMN6_SHEB5       -YQE--YFDHIICNPPYFEQGTQ------AIQSQRAMARHTDSLSFTALLDAIHVCLAPQ
TRMN6_SHESW       -YQG--YFDHIICNPPYFEHGPQ------AQLSQRAMARHTDQLSFNELLAAIEQCLSPN
TRMN6_SHEPC       -YQG--YFDHIICNPPYFEHGPQ------AQLSQRAMARHTDQLSFNELLAAIEQCLSPN
TRMN6_SHESR       -YQG--YFDHIICNPPYFEHGPK------ASEQHRAMARHTETLGFTPLLDAISQCLSFE
TRMN6_SHESM       -YQG--YFDHIICNPPYFEHGPK------ASEQHRAMARHTETLGFTPLLDAISQCLSFE
TRMN6_SHESA       -YQE--YFDHIICNPPYFEHGPK------ANEQHRAMARHTDTLGFTPLLEAISQCLSHE
TRMN6_SHEON       -YHG--FFDHIICNPPYFEHGPQ------ANDSHRAMARHTNTLGFAPLLDAIIQCLTPQ
TRMN6_SHEFN       -NNDEPLFDHIICNPPYFEQGTQ------AKNSARADARHTNTLSFAELQNVISQLLAPQ
TRMN6_SHEHH       --EQARQFDHIICNPPYFANGPQ------SSKFSRATARHTDSLSFDALLQAIKQLLAPE
TRMN6_SHEPA       HAEQSKQFEHIICNPPYFANGPQ------SSNVSRATARHTDSLSFDSLLAAIKQLLSPE
TRMN6_SHEPW       --AKKHSFDHIICNPPYFDNGPQ------SNSALRATARHTDSLSFDELLTAISSLLSPA
TRMN6_SHELP       QTQAQTQFDHILCNPPYFDNGPQ------SQCSKRAQARHTDSLAFDQLLSAIKQLLAPT
TRMN6_SHESH       -ESEESLFDHIICNPPYFKGGTQ------SQNRLRAQARHTDTLDFCALLEAIGSLLAPN
TRMN6_SHEWM       -DGNNAQFDHIICNPPYFKGGTQ------SSNRLRAQARHTDSLTFHALLEVITKLLAAT
TRMN6_SHEDO       AITPTSKFDYIISNPPFFENGPS------SQSPERAAARHTHNLPFSALFNAIKSLLSPL
TRMN6_SHEAM       -----KVFTHILCNPPYFETGPL------SEKPGRAQARHTGSLGFLALCKLITTHLSTE
TRMN6_ALIF1       ------KYDAIICNPPYFNNGEQ------SQKGERSTARHTDSLPFDKLLQHCKTLISPT
TRMN6_ALIFM       ------EYDAIICNPPYFNNGEQ------SLKGERSTARHTDSLPFDKLLQHCKTLISST
TRMN6_ALISL       ------LYDAIICNPPYFNNGEQ------SQKGERSIARHTDSLPFDKLLKCCKALMSSK
TRMN6_VIBCB       ------RFERIICNPPYFNSGEQ------SKQSQRATARHTDTLQHSALLNRCHELLTNE
TRMN6_VIBPA       ------RFQRIVCNPPYFNTGEQ------AKQSQRATARHTDSLRHDALLKCCYQLLDAE
TRMN6_VIBVY       ------RFDGIICNPPYFNSGEQ------AQATQRATARHTDTLAHDALLLRCRELLTPN
TRMN6_VIBVU       ------RFDGIICNPPYFNSGEQ------AQATQRATARHTDTLAHDALLLRCRELLTPN
TRMN6_VIBCH       ------RFAAIICNPPYFNSGET------AQHQVRATARHTISLQHQALIERLPQLLEPD
TRMN6_VIBCM       ------RFAAIICNPPYFNSGET------AQHQVRATARHTISLQHQALIERLPQLLEPD
TRMN6_VIBA3       ------RFDAIICNPPYFNSGEQ------AQQSQRATARHTDSLDHLQLAQRCFEITTDA
TRMN6_PHOPR       ----KNNIGNIICNPPYFNFGLQ------ADSQTRATARHTDTLTHDALLQSITHLLAPE
K0D841_ALTMS      ------LYDVVISNPPYFDSPAKRSNAYNQQSQPRNLARQTLALGTEEFFEVSYKLLELN
K0EDN1_ALTMB      ------LYDLVISNPPYFDTPATLSNAYSKQSQSRSVARQTSALGPDELFSASSKLLIEQ
F5Z9A3_ALTNA      ------TFDFIVSNPPYFEQVKGHSHAYNSQSDTREQARQTVSLTPAHLFSFVIEHLTST
TRMN6_PSEA6       ----NPKFALIISNPPYFNSPIL---THEKQAQKRVAARQTSELTHHTLLNNVVRLLAPS
TRMN6_PSET1       ------PFDVVIANPPYFNHSLK------GNNKARNIARHTDGLSFAELISAFKKLSHAG
TRMN6_FLAB3       ---TQKKFDLIISNPPYFETNPSE----KDA--TARQQRE---LSFKTLISKTAEILATE
E4TCC0_RIEAD      ---PNQKFDLIFSNPPYFETNTSD----KDK--IARQRLT---LDFEDLIRKSSQLLSKE
F4KL19_PORAD      ---PPRTYDLIISNPPYYDGLQPA----TAP--LRQARHTEEGFAPHLLFRYLEAFVAPE
C2MCX0_9PORP      ---PLRHYDLIVSNPPYYDGLQPA----TAS--LRQARHTEEGFAPHLLFRYLEPLVAPE
H6L1S6_SAPGL      ---ARAPYDLIVSNPPFYPEAQFS----KALDQDRRQARSTLSLRFEELLEHSLALLAPA
I2EVX2_EMTOG      ----SFRYDLIISNPPFYQKSLKS------ADAQTNKALHAVELSLEELVDVVIRLLNPN
D2QFQ7_SPILD      ----AIRYDRILTNPPFYTNHLRS------PDAAVNRALHTGDLPFPELVETVVRLMQPT
E4RZ66_LEAB4      ----KEKYEVIFCNPPFYENRLSS------PDPKKNLAHHASLLKWKEVSECAKRLLAED
TRMN6_DYAFD       ----EHRYDVIITNPPFFQSDLLS------PIDKKNIAHHAKSLDFEELLTAIERLLKPE
F8EKV6_RUNSL      --TYDLAYDLIISNPPFFANHLRS------PDQARNRALHSDTLTLEELAISVNRLLSKK
F0S552_PSESL      --NPLKKYDVIVSNPPFFLNALKA------DSEMKNLARHTDISFFLDLLRVAATHLEVR
H1YF68_9SPHI      --HPEKKYDLIVANPPFYINSLEA------AGDKMNLAKHTDQTFFEVLIKAVSAHLASK
F4C8A2_SPHS2      --APPALYDLIVSNPPFFLNALQN------PDKRKSIARHTDASFYRELIQKAWSWLNDG
TRMN6_PEDHD       --LPEKYYDLIVSNPPYFVNDLKN------PEHRKGVARHTDAHFFEQLLERVAAMLSRD
H8KTG5_SOLCM      --TTEKKYDVIVSNPPYFINSLKS------NLHKKQTARHIDEDFFPKLSLKISELLNDN
G0IX66_CYCMS      --GNIEQYDLIITNPPYYSRHLQS------SKQNINLARHEQGLNFTDLWTGIDRLLKTE
E4TQK5_MARTH      --D--HKYDLIFSNPPFFKDNLQSK-----TNHGKNTAYHTNQLSFEALAKGIDLNLAEN
I3Z4H8_BELBD      --KSDQQFDMIVSNPPYFPDHIKT------NDAQRNKALHNDSLSFEDLVAGVIKCLDES
C7PS46_CHIPD      ---AGEPYDFIVTNPPFYEGDLKS------VDQLRNQAMHAITLDYSELLQVIATQLSAA
TRMN6_CYTH3       ---TTKQYDLIVCNPPFFSASLKT------GNTSKDMALHQSHLLIDELIQVVSFMLKQS
                            :  ***::                                          

TRMN6_BACFN       GTFTVVIPMDASDSFKDIASSQ-GLYPSRQLLVITKPGAPPKRTLISFTFI---------
TRMN6_BACFR       GTFTVVIPMDASDSFKDIASSQ-GLYPSRQLLVITKPGAPPKRTLISFTFI---------
TRMN6_BACTN       GTFTIVIPTDVADRVKTAASEY-HLYATRQLNVITKPGGTPKRMLITFTFN---------
TRMN6_BACV8       GVFSVIIPADGKESFLMAATRY-GLHLSHQTFIHTKPGSEPKRVLLAFKFS---------
TRMN6_PARD8       GNIALVLPFEQRESLIDIAREE-SLSPSREAHVSPIPDAPPKRLLIELSATP--------
TRMN6_FLAJ1       GILAVIIPFKEEAKFTALAKDF-ELYPIKITRVKGTPKSEIKRSLLAFSRNE--------
TRMN6_FLAPJ       GILSVIIPYKEEEKFVTLANEF-ELYPIKITRVKGTPTSETKRSLLVFSRN---------
TRMN6_GRAFK       GHLDLIIPFSEERKALEITSSH-NLFPNKITRVKGTANSPIKRSLISFNFQ---------
TRMN6_PORGI       GRLALITPRDRLKDLRLYAATY-RLVSSRLTEVRTLPHKEPKRLLSEWRPAD--------
TRMN6_PORG3       GRLALITPRDRLKDLRLYAATY-RLVSSRLTEVRTLPHKEPKRILSEWRPAD--------
I3YQ37_ALIFI      GRFAVILPTDEARRFVDVCRGF--LALTRSTGVRTTPRRPVKRLLMEFAHEN--------
F2KTM2_PREDF      GKLSVIIPAENKETLESEALFC-GLSIRKIVYVRTKEAKPVKRCLMEFTKAF--------
TRMN6_TRIEI       GKLAVIYPVEQAHNFQEKAEYL-GLFCQRKLDVKPMPKIPTKRILMELSKKK--------
TRMN6_YERP3       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPA       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPP       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPG       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPN       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPB       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPE       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPS       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERPY       GMFCVVLPHELGIEFARLAGQQ-GWFVRCQVDIRDRPGKPLHRMLLTLSRQ---------
TRMN6_YERE8       GIFCVVLPHDLGEELSRLAVQQ-NWFIRCQVDIRDRPGKPLHRILLTLSRQ---------
TRMN6_PROMH       GLFCVVLPYLIGEQFIEISQRK-GWNVVQRVNIKDSADKPYHRILLAFQRQYQ-------
TRMN6_PHOLL       GLFCVVLPYAIGEEFETMACHQ-GWFSHHRVNIRDRQGKPLHRMLLAFSRK---------
TRMN6_SERP5       GTFCVVLPHDIGEAFETNAHRR-GWHTAQRLNVSDRADTPMHRVLLALTRQ---------
TRMN6_PECAS       GLFCVVLPVQVAEHFIPLAQQH-NWHVQQQLRVSEQEDKPAHRVLLALSRQ---------
TRMN6_PECCP       GLFCVVLPIQVAENFIPLAQQH-NWYVHQQLRVSEQEDKPAHRVLLALSRQ---------
TRMN6_DICC1       GRFCVVLPAVSAEDFLALAQRS-AWRADIRVDVADSASRPVNRVLLSLRRG---------
TRMN6_DICP7       GRFCVVLPSQIVGDFLFLAESL-QWHLALRVDVADNPRRPVHRVLLALT-----------
TRMN6_ECOLU       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOSM       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOBR       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOBW       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECODH       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOHS       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOLC       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOLI       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO7I       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHIDS       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPK---------
TRMN6_ECO27       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO45       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOUT       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOK1       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOL6       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO81       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOL5       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO8A       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECOSE       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHIF8       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHIFL       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHIB3       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHIBS       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SHISS       GFFCVVLPEQVGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO24       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO55       GFFCVVLPEQIGNGFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ESCF3       GFFCVVLPEQIGNGFTELALRM-GWHLRLRTDVAENETRQPHRVLLAFSPQ---------
TRMN6_ECO5E       GFFCVVLPEQIGNSFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO5T       GFFCVVLPEQIGNSFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_ECO57       GFFCVVLPEQIGNSFTELALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALEP       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALG2       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALCH       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALPC       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALTY       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALPA       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALPK       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALPB       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALTI       GFFCVVLPEQIGNAFTQQALNM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_SALAR       GFLCVVLPEQIGNAFTQQALSM-GWHLRLRTDVAENEARLPHRVLLAFSPQ---------
TRMN6_CITK8       GFFCVVLPEQTGNTFTQQALSM-GWHLRLRTDVAETESRLPHRVLLAFSPR---------
TRMN6_KLEP3       GFFCVVLPVDIGNAFIERATAM-GWHLRLRTDVAETELRPPHRVLLAFSPT---------
TRMN6_KLEP7       GFFCVVLPVDIGNAFIERARAM-GWHLRLRTDVAETELRPPHRVLLAFSPT---------
TRMN6_CROS8       GFFCVVLPESSGEAFSRLAGEQ-GWHLRLRTDVAENAGKLPHRVLLAFSPS---------
TRMN6_ENT38       GFFCVVLPENTGNTFIKTALDI-GWFLRLRTDIADTDGKLPHRVLLALSPK---------
TRMN6_ERWT9       GFFCVILPASAGSKLLEQALQR-GWHLRFRTDIADNDTRPANRVLLALSPQ---------
TRMN6_EDWI9       GRLALVLPVEAAESVVSKGMTH-GWHLLRRTAVRDRADKPVRRTLLLFGRI---------
TRMN6_AERHH       GEVALVVPTAMADEILCISADY-DLHAVCYTAVITRAGKEANRVLLRLGRG---------
TRMN6_AERS4       GQVALVLPTAMADEILCISADY-DLHGVCYTAVINRAGKEANRVLLLLGRG---------
TRMN6_TOLAT       GKLALVLPVEEGEQLVALATAG-GWYLQRRCRVETKRGKAPNLVLLLLSRK---------
TRMN6_HAES1       GEIHLILPFEEGKSLQKKC----GLFCIRECKIITKAGKTPQRLLLSFSRE---------
TRMN6_HISS2       GEIHLILPFEEGKSLQKKC----GLFCIRECKIITKAGKTPQRLLLSFSRE---------
TRMN6_MANSM       GRIHLILPYAAGKNLQKQT----ALFCARCCEVITKSGKIPQRLLLTFSKQ---------
TRMN6_HAEIE       GRISFVLPYDAGKTLIKST----ALFCIKQTNVITKIGKTPQRMLLTFAKQ---------
TRMN6_HAEIG       GRISFVLPYEAGKTLIKST----ALFCIKQTNVITKIGKTPQRMLLTFAKQ---------
TRMN6_HAEI8       GKISFVLPYDAGKTLTKST----ALFCIKQTNVITKIGKTPQRMLLTFAKQ---------
TRMN6_HAEIN       GRISFVLPYEAGKTLTKST----ALFCIKQTNVITKIGKTPQRMLLTFAKQ---------
TRMN6_AGGAN       GKISFVLPLAAGETLLKTT----ALYCIARCDVRTKAGKAPQRVLLTFAMQ---------
TRMN6_PASMU       GKISMVLPFEAGETLLKQT----ALYCIARCEVITKKGKAPQRLLLTFSLQ---------
TRMN6_ACTSZ       GTIHFVLPAEQGKTLKQST----ALYCVRQCDVISKQGKAAQRVLLSFMKE---------
TRMN6_ACTP7       GEISFILPFEAAEKLVEQSRTS-GLFCTKICKIITKQGQAAKRMIVSFSAQ---------
TRMN6_ACTP2       GEISFILPFEAAEKLVEQSRTS-CLFCTKICKIITKQGQAAKRMIVSFSAQ---------
TRMN6_HAEPS       GRISFILPCDAGKKLLEQSHLL-GLYCIEYWEICTKVGLSPKRVILTFSPQ---------
G2D941_9GAMM      GRLYLLLPSHAVAAIIKQAACH-QLYLVGRTDLRGHAYKQAKVSALLFSHT---------
TRMN6_SHEB9       GNASLILPMQSMARFNEILAHS-QLSLIEITNLISIVGKSANRVLCVLAH----------
TRMN6_SHEB8       GNASLILPMQSMARFNEILAHS-QLSLIEITNLISIVGKSANRVLCVLAH----------
TRMN6_SHEB2       GNASLILPMQSMARLNEILAHS-PLSLIEMTNLISIVGKSANRVLCVLAH----------
TRMN6_SHEB5       GNASLILPMQSMARLNEILAHS-PLSLIEMTNLISIVGKSANRVLCVLAH----------
TRMN6_SHESW       GLASLILPIQSLHNFNHLLSQS-RLEWVERVDIKSVEGKRANRVLCLLTA----------
TRMN6_SHEPC       GLASLILPIQSLHNFNHLLSQS-RLEWVERVDIKSVEGKRANRVLCLLTT----------
TRMN6_SHESR       GYASLILPIQSLARFKACLNDT-ALFLVREVWVKSVENKAANRALLLLSK----------
TRMN6_SHESM       GYASLILPIQSLARFKACLNDT-ALYLVREVWVKSVENKAANRALLLLSK----------
TRMN6_SHESA       GHASLILPIQSLTRFKACLHQT-QLYLVKEVRVKSMENKDANRVLLLLAKI---------
TRMN6_SHEON       GYASLILPSQSMPRFKACLTSS-KLHLTEEVLVKSVENKAANRVLLLLSK----------
TRMN6_SHEFN       GTASVILPLQSLASFIQQLNAY-GLFVAKQLDIISIEGKVANRSILAIQHNP--------
TRMN6_SHEHH       GQASLILPTESVSLLEAILSTY-NLRLCHKLLAASVEGKAPNRQILVL---------GHD
TRMN6_SHEPA       GCASLILPTESVSLFETKLSTY-QLELSQKLLAASVEGKEANRQILVLRHTSAL---AHD
TRMN6_SHEPW       GQASLILPITGANQLLQQLEQH-QLTCQHAVLVASVEGKKPNRQLLLI------------
TRMN6_SHELP       GKASLILPNASLGRFLPLLAEF-KLKLSARVDITTAPNKAPQRHLLCL------------
TRMN6_SHESH       GTASLILPSQSMSEFGLVLADS-SLEFSQVTDISDSQRKTPHRHLFTL------------
TRMN6_SHEWM       GTASLILPSQSMTPFIEEVEKS-ELWMNQLTNISDSRFKAPHRHLFTL------------
TRMN6_SHEDO       GLSTIILPVQSLESATLAYQEA-GLKLSCQRFIASVQGKSPYRVILCLQHLS-------A
TRMN6_SHEAM       GIASLVLPVESEQAFRQALTHL-GLGIRQRVEVSTVEGKAPRRLLLAVSQ----------
TRMN6_ALIF1       GRASFILPVFEGELFIKVAKND-DFHLTKITKVKTTEKKSPTRLLIELSL----------
TRMN6_ALIFM       GRASFILPVFEGEIFIKIAKGC-DFHLTKITKVKTTEKKSPTRLLIELSL----------
TRMN6_ALISL       GRASFILPFIEGNQFIEIAKKH-SFHLTKLTKIQTTEKKDVSRLLIELSI----------
TRMN6_VIBCB       GTASFVLPITEGEQFITMALQQ-GWHLSRLCRVQPSQKKPVHRLLFELAK----------
TRMN6_VIBPA       GKASFVLPITEGELFIELALTQ-GWSLSRLCRVQPSEKKPVHRLLFELAK----------
TRMN6_VIBVY       GKANFVLPLTEGEQFLQLAQQQ-GWHLHRLCRVKPSPNKPVHRLLFELGL----------
TRMN6_VIBVU       GKANFVLPLTEGEQFLQLAQQQ-GWHLHRLCRVKPSPNKPVHRLLFELGL----------
TRMN6_VIBCH       GVASFILPKAEGEDFIALARQA-GLFVGRYCQVQPTTDKPVHRLLFELHL----------
TRMN6_VIBCM       GVASFILPKAEGEDFIALARQA-GLFVGRYCQVQPTTDKPVHRLLFELHL----------
TRMN6_VIBA3       ATASFILPTPEGEGFIKLAEQC-GWYLAKRLDVKTTDKKPASRILFELSK----------
TRMN6_PHOPR       GIVSLILPEYEGRQLIQAAEKY-GLQCQRLCEVKSTEKKPVSRLLIELTS----------
K0D841_ALTMS      GHLYCVYPFSLEARVIQIAASH-GFALEKQLYVRHESNSAPYLCAFHFRKLA------IT
K0EDN1_ALTMB      GQMYCVYPASMEASVIETAEGY-GLSLADILYVKHTSNKSPYLCAFHFKKVMKGASDNLK
F5Z9A3_ALTNA      GEFYCLYPFARESEITDLAAEI-GLATNRILRVQHNDQHSPYVTVFCMSKQH--------
TRMN6_PSEA6       GVFYCVLPSDVSQAFIELADPL-GLSLIKQLTVFSKPDTNALRELLAFRFND------PS
TRMN6_PSET1       STFSLILPTTEVAVFIELATQN-GLFLNTHCQVKATPNKAISRSLMTFSYIN--------
TRMN6_FLAB3       GRFCVIIPFPAGPTFEKTCEEN-KLFLLRRITVYGNANVEPKRLILEFSSNKNI------
E4TCC0_RIEAD      GIFAVIIPSEYEGLFIETCKTH-SLFLQRRVNIKGIEHNPKKRVILEFSFSKN-------
F4KL19_PORAD      PTLCLVTPVEALPLLRREAVLH-RYNLTRLCGLHHHVGQPAIRLLTQWHRSATPP-----
C2MCX0_9PORP      PTLCLVTPVEALPLLRREAVLH-RYNLKRLCGLYHHVGQPAIRLLTQWHRSDTPS-----
H6L1S6_SAPGL      GQLAIILPTAQALYFHELAQEA-GLFLHRRCDFISRLGKAPKRLLLQWGQAPIEK-----
I2EVX2_EMTOG      GQFIVLLPPFEIEKLIQFAQKK-GLYLSKKIMIRHNASKPVFRVIATFSNTQI-------
D2QFQ7_SPILD      GQWWVLLPPYETDLLAELARKA-GLYAFKRLSLRHNAQKPAFRVVSGYSYTE--------
E4RZ66_LEAB4      GKLWLLLPPFEMEQFRSQSPE---WQTEKQYLIRHRKDKPIFREIACYSLKKP-------
TRMN6_DYAFD       GKFNILFPVDEGSRFAEKAAHA-GWKLTRKLTLFHQEDKKAFRLLMRFERAEVAH-----
F8EKV6_RUNSL      GRFVVLLPAYETQLLTVIAARE-GLWPTRQLEVFQRPDRPLFRMITTFERHFA-------
F0S552_PSESL      GSIQLIIPLDVSQAIQQLASDY-HLSISEVINIKSFVDKEAFRQIIRLSK-EQA------
H1YF68_9SPHI      GLCWLVLPVATASLVKKLILPY-QLYVHHTINIHSFTDVDAHREVVVLGT-IPV------
F4C8A2_SPHS2      GQLQLVLPPVISTSVREYADKLTDFHPAKAIHIKSFESEDAFRQIICLRKGERM------
TRMN6_PEDHD       GRFWFILPLKQAQNIVDMAKFY-GLGMAVVLHIHSDENKPEIRQIVCLDY--SG------
H8KTG5_SOLCM      GSCWIVLPVNEMHQFTKHAKSA-GLQPSKLIHIHSFDHSPEKRRIVAFRK--EK------
G0IX66_CYCMS      GMLWLILPPKEMEAFKRLGTEK-GFYANTQTLLQDRETSKVHRVITSFVRIKP-------
E4TQK5_MARTH      GEAHIMLPFYEMSLFEKEMNKV-GFQCKRITELRHQAGSKVIRLFTVYDRREEG------
I3Z4H8_BELBD      GEFWVILPPRQMQDLEEICKIH-QLLPFHKVNLKDKQETKVIRVIQGFSYGSE-------
C7PS46_CHIPD      GRFSVLLPYKPFAEFKALAETT-GFSLQEVLHVKQSEQHDYFRSVGIFGRKVTVT-----
TRMN6_CYTH3       GDAYLLISIYEEVNFFQAANRV-GLNVKRFQEMYDNE-TKLIRYV-LHLRKDTEH-----
                       : .                                                    

TRMN6_BACFN       -------KQDCK--------EEKLLTEVSRHRYSDEYIKLTREFYLKM------------
TRMN6_BACFR       -------KQDCK--------EEKLLTEVARHRYSDEYIKLTREFYLKM------------
TRMN6_BACTN       -------NEGCI--------KEELLTEVARHQYSEEYKELTREYYLHLK-----------
TRMN6_BACV8       -------VDKCV--------IDDLTIELSRHVYSEEYIALTKEFYLNM------------
TRMN6_PARD8       -------VAKPK--------SSHLTLEIERHRYSEEFTAIAKDFYLKM------------
TRMN6_FLAJ1       -------VSEIE--------IDELVIEIDRHIYTPEYIDLTKEFYLKM------------
TRMN6_FLAPJ       -------KQNCE--------QDILVIETDRHVYTKEYIALTKGFYLKM------------
TRMN6_GRAFK       -------KSETV--------IDELTLEISRHHYTEEFKELVQDFYLKL------------
TRMN6_PORGI       -------TAIDR---SP--FTDTLIIHPATGYYSPEYVRLTEPFYTTSFRILAVG-----
TRMN6_PORG3       -------TAIDR---SP--FTDTLIIHPATGYYSPEYVRLTEPFYTTSFRILAVG-----
I3YQ37_ALIFI      -------ACSGLRSDSPPVCSELVVGTGEHEQYTPEYRALTRDFYLKF------------
F2KTM2_PREDF      -------PAHCD-------VHEAVLALPD-GRRTEWYRQLTEDFYIR-------------
TRMN6_TRIEI       -------LPLQK---------NTLTIEVKQYTYTPEFITLIKDFYLKY------------
TRMN6_YERP3       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPA       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPP       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPG       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPN       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPB       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPE       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPS       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERPY       ------AGETVY---------QHLALRQSEGVYSPEFCQLISDFYLNY------------
TRMN6_YERE8       ------AGETEF---------QQLDLRQSEGVYSPEFCALISDFYLNY------------
TRMN6_PROMH       ----GETKPCNI---------EELIIRNNDGHYTTQFQSWVTDFYLYY------------
TRMN6_PHOLL       ------EKTGLI---------SELTIRQPDGAYTQEFQQLVTDFYLYY------------
TRMN6_SERP5       -----PAEEATE---------QKLAIKLADGSYTDDFRRLITDFYLFY------------
TRMN6_PECAS       ------EKECVN---------FLLAIRDAERCYSTDFQQLTKDFYLFM------------
TRMN6_PECCP       ------KKECVN---------ASLAIRDEERRYSTAFQQLTKDFYLFM------------
TRMN6_DICC1       ------GESEINAIALSR---TSLIIRDDDRRYSSSFQALTRDFYLSM------------
TRMN6_DICP7       -------QAPID--PVYS---SALLIRDELQQYSPDYRALTQDFYLSM------------
TRMN6_ECOLU       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOSM       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOBR       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOBW       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECODH       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOHS       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOLC       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOLI       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO7I       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHIDS       ------AGECFS---------DRLIIRGSDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO27       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO45       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOUT       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOK1       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOL6       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO81       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOL5       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO8A       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECOSE       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHIF8       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHIFL       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHIB3       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHIBS       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SHISS       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO24       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO55       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ESCF3       ------AGECYS---------DRLVIRGPDQSYSEAYTALTQAFYLFM------------
TRMN6_ECO5E       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO5T       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_ECO57       ------AGECFS---------DRLVIRGPDQNYSEAYTALTQAFYLFM------------
TRMN6_SALEP       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALG2       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALCH       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFMWGVNGERIDGPD
TRMN6_SALPC       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALTY       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALPA       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALPK       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALPB       ------AGECFS---------DRLVIRGSDQHYSESYTALTQAFYLFM------------
TRMN6_SALTI       ------AGECFS---------DRLVIRGSDQNYSESYTALTQAFYLFM------------
TRMN6_SALAR       ------AGECFS---------DRLVIRGPDQHYSESYTALTQAFYLFM------------
TRMN6_CITK8       ------TGECFS---------DRLVIRGPDQLYSEGYTALTQAFYLFM------------
TRMN6_KLEP3       ------AGECFC---------DRLAIRGPEQQYSEGFTALTGDFYLFM------------
TRMN6_KLEP7       ------AGECFS---------DRLAIRGPEQQYSEGFTALTEDFYLFM------------
TRMN6_CROS8       ------PGECFC---------DDLLIRGPDQHYSPAYCALTEAFYLFM------------
TRMN6_ENT38       ------EGECFS---------DRMVIRGPDQRYSEDYTALTQAFYLFM------------
TRMN6_ERWT9       ------PGERLL---------DSMTIRGPDRQYSAAHCRLTRDFYLFR------------
TRMN6_EDWI9       ------PAAVQS---------NTLDIRDDSSEYSCIFRNMTKDFYLFF------------
TRMN6_AERHH       ------LNKCEQ---------GEIVIHSADGTYSDRYIQLTSPFYLKM------------
TRMN6_AERS4       ------LNRCEQ---------GEIVIHSAGGAYSDRYIQLTHPFYLKM------------
TRMN6_TOLAT       ------PAETEE---------EQLCLRETDNRYSPEFIALADEFYLRMSA----------
TRMN6_HAES1       ------ERKCEE---------SQLVIYDRNNQYSTEFKTLTQDFYLNF------------
TRMN6_HISS2       ------ERKCEE---------SQLVIYDRNNQYSTEFKTLTQDFYLNF------------
TRMN6_MANSM       ------PCTTEQ---------SRLVVYNEQNQYTEQFIALTRDFYLNF------------
TRMN6_HAEIE       ------PQVLMQ---------DQLVIYDADNQYTEAFIELTKDFYLKF------------
TRMN6_HAEIG       ------PQVLMQ---------DQLVIYDADNQYTEAFIKLTKDFYLKF------------
TRMN6_HAEI8       ------PEVLMQ---------DQLVIYDADNQYTEAFIELTKDFYLKF------------
TRMN6_HAEIN       ------PEVLMQ---------DQLVIYDADNQYTEAFIELTKDFYLKF------------
TRMN6_AGGAN       ------PQPLKH---------SELIIYDAQNQYHEDFVTLTQDFYLNF------------
TRMN6_PASMU       ------AQPLQP---------SQLIIYDESNRYHPDFIGLTKDFYLAF------------
TRMN6_ACTSZ       ------KKETAY---------SELTIYDEKNRYTLEFIQLTREFYLKF------------
TRMN6_ACTP7       ------NVPLEE---------QELVIYDADNQYTEAFKQLTKAFYLNM------------
TRMN6_ACTP2       ------NVPLEE---------QELVIYDADNQYTEAFKQLTKAFYLNM------------
TRMN6_HAEPS       ------YAEMAL---------HTLTIYDENQRYTADFTQFTEIFYLKVNSK---------
G2D941_9GAMM      ------ASPYVA---------RLLTIYRAERDYSAASSAYLSPFLLRFAQANFKIED---
TRMN6_SHEB9       --------KTHPQIATKI---SDITIRELSGQYTQTMVQLIRDFYLKY------------
TRMN6_SHEB8       --------KTHPQIAPKS---SDITIRELSGQYTQTMVQLIRDFYLKY------------
TRMN6_SHEB2       --------KTHPQIATKI---SDITIRELSGQYTQTMVQLIRDFYLKY------------
TRMN6_SHEB5       --------KTHPQIATKI---SDITIRELSGQYTQTMVQLIRDFYLKY------------
TRMN6_SHESW       --------QTHRTVEPKV---SELTLRDTSGQYSQAMVHLTQDFYLKL------------
TRMN6_SHEPC       --------QTHRTVEPKV---SELTLRDTSGQYSQAMVHLTQDFYLKL------------
TRMN6_SHESR       ----------TEVEPYQR---TDLTIRGEDGNYTEQMIELTKDFYLKL------------
TRMN6_SHESM       ----------TEVEPYQR---TDLTIRGEDGNYTEQMIELTKDFYLKL------------
TRMN6_SHESA       ------LLTQSQDEPCQH---TELTLRGEDGRYTEQMIALTKDFYLKL------------
TRMN6_SHEON       ----------NRQSDYRQ---SELTIRGIDGLYTKHMIELTRDFYLKL------------
TRMN6_SHEFN       -TTAEPQTLTNPAVETQY---HQMTIRDKQGRYSETMIDLCRPFYLKL------------
TRMN6_SHEHH       LKAKKIHNFGTELQAVAQ---QQLYIREKTGHYSLAFTLLSQDFYLKL------------
TRMN6_SHEPA       PKTETEPAVVAKLEDAAQ---QQLYIREKNGQYSQAFSLLSRDFYLKL------------
TRMN6_SHEPW       --TPCRSNFANQATTHPV---SNLVIRNTDGHYSDDFILLSKSFYLKL------------
TRMN6_SHELP       ---SHAVSSAESSEAIEA---EHLSIRDASGAYSQAMVALTQAFYLKL------------
TRMN6_SHESH       --CHKSTDASAKPNEGAT---EHFCIKELDGSYTEEMKLLITGFYLKY------------
TRMN6_SHEWM       --KHKATKLAED-DTVIT---NNLCIKEPDASYTPEMIALITGFYLKY------------
TRMN6_SHEDO       GDILLALGAGKSLNPLSE---TSLFIRDNQGQFGPEMASLCKDFYLKL------------
TRMN6_SHEAM       -----------GEDSYQH---EHLAIRDVHGCYTEAMTALTRDFYLKL------------
TRMN6_ALIF1       --------FPHIYQEST------LTIHDGNG-YSDDFIKLTRTFYLNMD-----------
TRMN6_ALIFM       --------FPHIYQEST------LTIHDGNG-YSDDFIKLTRMFYLNMG-----------
TRMN6_ALISL       --------FPYIYQETT------LIIHSKDG-YSNDFIQLTRHFYLNMA-----------
TRMN6_VIBCB       --------QACDTQETH------LIIHSSEG-YSDDFTQLTREFYLKM------------
TRMN6_VIBPA       --------QPCDTQESH------LIIHSSDG-YSDDFVRLTHEFYLKM------------
TRMN6_VIBVY       --------STATTSEEH------LTINDGST-YSAAFVKLCQDFYLKM------------
TRMN6_VIBVU       --------STATTSEEH------LTINDGST-YSAAFVKLCQDFYLKM------------
TRMN6_VIBCH       --------SPCLPVETR------LVIREQQG-YSEAFCQLTRDFYLKMS-----------
TRMN6_VIBCM       --------SPCLPVETR------LVIREQQG-YSEAFCQLTRDFYLKMS-----------
TRMN6_VIBA3       --------DPVCGQDLQR---ESLTIHHQGG-YSEAFIALTKDFYLKM------------
TRMN6_PHOPR       --------STVKSAPQK----EALCIHDSGQ-YSAQFIALTRDFYLKL------------
K0D841_ALTMS      STLSSIENVGVITEEASK---TTLTIRDAQGNYTSEYKALCQPFYLRF------------
K0EDN1_ALTMB      NVTAHREWPSLTAKNAIK---NELIIRDQKGEYTSEYKALCQPFYLKF------------
F5Z9A3_ALTNA      -------------KKSVI---ENLVIRDESGDYSSRFKALCRDFYLRF------------
TRMN6_PSEA6       CIRDTISRALTSPEPPTR---DTLTIYTQSHQYSDQYKALCKDYYLNF------------
TRMN6_PSET1       -------------QSIVE---SALCIKDNENNYSEDYIALCKAFYLKM------------
TRMN6_FLAB3       -------SVSEE----------IFVTEKAPRVYSEQYLKATADFHEFE------------
E4TCC0_RIEAD      -------GTKDE----------DFIIEKSPRQYSDQYLEATKDFHIFNS-----------
F4KL19_PORAD      ------PPCRSE----------SLAIRTAQQHYTAEAQDLLHPYLLDEYLT---------
C2MCX0_9PORP      ------APCLSE----------RLAIRTAQQRYTDEARDLLRPYLLDEYLD---------
H6L1S6_SAPGL      ------PQQQEI----------IMRQGPPDYAYADSYRQLLKDFLIIF------------
I2EVX2_EMTOG      -----QDIEESTLVIHE----------EDMKNYSAEFRELLKDYYLIF------------
D2QFQ7_SPILD      -----RNPEEEMLTIYERADVADQAKSQSKETYSSDFRALLRDFYLIF------------
E4RZ66_LEAB4      -----SSTLVEEWNIYE------------NEKYSGIFAEVLRDYYLLF------------
TRMN6_DYAFD       -----NVIVEPDLYIYE----------KDGVTHDPRFRELLKAFYLKF------------
F8EKV6_RUNSL      ------ESVPETLYIHH-----------SDGTYSDGFQTLLKEYYLIF------------
F0S552_PSESL      -----QICKNSDFVIYS-----------REKEHSMEYRAALKDFFTIF------------
H1YF68_9SPHI      -----QSTTER-FIIYN-----------SPKVYSKQYQEILKDFFTIF------------
F4C8A2_SPHS2      -----QPNEDTIFTIYK-----------ERGIYSNAYKELLKPFFVNF------------
TRMN6_PEDHD       -----QPAHHHNLYIYA-----------GKGLYTDAYKVLLKDFFLAF------------
H8KTG5_SOLCM      -----NEVIFEKFVIYE-----------SQGTHSHQYISIAKDFLTIF------------
G0IX66_CYCMS      -----EQPKKSVLVIKD-----------ANNAYTPEYIGLLKDYMLHF------------
E4TQK5_MARTH      -----VNIEKEVIIVRD-----------ENNDFHYSYINSMKDFLTIF------------
I3Z4H8_BELBD      ------FTLENELFIKN-----------PDGSFAKAYQKLLKDFLLIF------------
C7PS46_CHIPD      -----LPSTEQFMSIRE----------ADKKTYTAAFIGLLKPYYLFL------------
TRMN6_CYTH3       -----MDHETQNFIIRS----------ADKQ-YTAQFVEVLRAFYLNL------------
                                                             :                

TRMN6_BACFN       ------
TRMN6_BACFR       ------
TRMN6_BACTN       ------
TRMN6_BACV8       ------
TRMN6_PARD8       ------
TRMN6_FLAJ1       ------
TRMN6_FLAPJ       ------
TRMN6_GRAFK       ------
TRMN6_PORGI       ------
TRMN6_PORG3       ------
I3YQ37_ALIFI      ------
F2KTM2_PREDF      ------
TRMN6_TRIEI       ------
TRMN6_YERP3       ------
TRMN6_YERPA       ------
TRMN6_YERPP       ------
TRMN6_YERPG       ------
TRMN6_YERPN       ------
TRMN6_YERPB       ------
TRMN6_YERPE       ------
TRMN6_YERPS       ------
TRMN6_YERPY       ------
TRMN6_YERE8       ------
TRMN6_PROMH       ------
TRMN6_PHOLL       ------
TRMN6_SERP5       ------
TRMN6_PECAS       ------
TRMN6_PECCP       ------
TRMN6_DICC1       ------
TRMN6_DICP7       ------
TRMN6_ECOLU       ------
TRMN6_ECOSM       ------
TRMN6_ECOBR       ------
TRMN6_ECOBW       ------
TRMN6_ECODH       ------
TRMN6_ECOHS       ------
TRMN6_ECOLC       ------
TRMN6_ECOLI       ------
TRMN6_ECO7I       ------
TRMN6_SHIDS       ------
TRMN6_ECO27       ------
TRMN6_ECO45       ------
TRMN6_ECOUT       ------
TRMN6_ECOK1       ------
TRMN6_ECOL6       ------
TRMN6_ECO81       ------
TRMN6_ECOL5       ------
TRMN6_ECO8A       ------
TRMN6_ECOSE       ------
TRMN6_SHIF8       ------
TRMN6_SHIFL       ------
TRMN6_SHIB3       ------
TRMN6_SHIBS       ------
TRMN6_SHISS       ------
TRMN6_ECO24       ------
TRMN6_ECO55       ------
TRMN6_ESCF3       ------
TRMN6_ECO5E       ------
TRMN6_ECO5T       ------
TRMN6_ECO57       ------
TRMN6_SALEP       ------
TRMN6_SALG2       ------
TRMN6_SALCH       SASCCG
TRMN6_SALPC       ------
TRMN6_SALTY       ------
TRMN6_SALPA       ------
TRMN6_SALPK       ------
TRMN6_SALPB       ------
TRMN6_SALTI       ------
TRMN6_SALAR       ------
TRMN6_CITK8       ------
TRMN6_KLEP3       ------
TRMN6_KLEP7       ------
TRMN6_CROS8       ------
TRMN6_ENT38       ------
TRMN6_ERWT9       ------
TRMN6_EDWI9       ------
TRMN6_AERHH       ------
TRMN6_AERS4       ------
TRMN6_TOLAT       ------
TRMN6_HAES1       ------
TRMN6_HISS2       ------
TRMN6_MANSM       ------
TRMN6_HAEIE       ------
TRMN6_HAEIG       ------
TRMN6_HAEI8       ------
TRMN6_HAEIN       ------
TRMN6_AGGAN       ------
TRMN6_PASMU       ------
TRMN6_ACTSZ       ------
TRMN6_ACTP7       ------
TRMN6_ACTP2       ------
TRMN6_HAEPS       ------
G2D941_9GAMM      ------
TRMN6_SHEB9       ------
TRMN6_SHEB8       ------
TRMN6_SHEB2       ------
TRMN6_SHEB5       ------
TRMN6_SHESW       ------
TRMN6_SHEPC       ------
TRMN6_SHESR       ------
TRMN6_SHESM       ------
TRMN6_SHESA       ------
TRMN6_SHEON       ------
TRMN6_SHEFN       ------
TRMN6_SHEHH       ------
TRMN6_SHEPA       ------
TRMN6_SHEPW       ------
TRMN6_SHELP       ------
TRMN6_SHESH       ------
TRMN6_SHEWM       ------
TRMN6_SHEDO       ------
TRMN6_SHEAM       ------
TRMN6_ALIF1       ------
TRMN6_ALIFM       ------
TRMN6_ALISL       ------
TRMN6_VIBCB       ------
TRMN6_VIBPA       ------
TRMN6_VIBVY       ------
TRMN6_VIBVU       ------
TRMN6_VIBCH       ------
TRMN6_VIBCM       ------
TRMN6_VIBA3       ------
TRMN6_PHOPR       ------
K0D841_ALTMS      ------
K0EDN1_ALTMB      ------
F5Z9A3_ALTNA      ------
TRMN6_PSEA6       ------
TRMN6_PSET1       ------
TRMN6_FLAB3       ------
E4TCC0_RIEAD      ------
F4KL19_PORAD      ------
C2MCX0_9PORP      ------
H6L1S6_SAPGL      ------
I2EVX2_EMTOG      ------
D2QFQ7_SPILD      ------
E4RZ66_LEAB4      ------
TRMN6_DYAFD       ------
F8EKV6_RUNSL      ------
F0S552_PSESL      ------
H1YF68_9SPHI      ------
F4C8A2_SPHS2      ------
TRMN6_PEDHD       ------
H8KTG5_SOLCM      ------
G0IX66_CYCMS      ------
E4TQK5_MARTH      ------
I3Z4H8_BELBD      ------
C7PS46_CHIPD      ------
TRMN6_CYTH3       ------