CLUSTAL format seed alignment for MF_01873

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0E1KW04_CLOBO      --MKQTKTKYGKMKQIVSNLKLPDYRYKQLIKAIFHQRIDNFDDMHILPKALRMSLVNEF
C1FV44_CLOBJ          --MKQTKTKYGKMKQIVSNLKLPDYRYEQLIKAIFHQRIDNFDDMHILPKALRMSLVNEF
CFR_CLOBL             --MKQTKTKYGKMKQIVSNLKLPDYRYEQLTKAIFHQRIDNFDDMHILPKVLRMSLVNEF
CFR_CLOBM             --MKQTKTKYGKMKQMVSNLKLPDYRYEQLTKAIFHQRIDNFDDIHILPKALRMSLVNEF
CFR_CLOBK             --MKQTKTKYGKMKQMVSNLKLPDYRYEQLTKAIFHQRIDNFDDIHILPKALRMSLVNEF
CFR_CLOB1             --MKQTKTKYGKMKQIASNLKLPDYRYEQLTKAIFHQRIDNFHDMHILPKALRIALVNEF
CFR_CLOBH             --MKQTKTKYGKMKQIASNLKLPDYRYEQLTKAIFHQRIDNFHDMHILPKALRIALVNEF
CFR_LACP7             ----MNYSKYETMKQLIADMKLPDYRYEQIIKAIFSQHTSTFEKMSTLPLELKKSLINTF
C0ZJA6_BREBN          ---MKLTSKYETIRRILSECKQPEYRYAQIMDAIFKQNIGEYERMTILPKFLRDELNRIL
CFR_STAAU             -MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNF
CFR_STASC             -MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNF
CFR_STAWA             -MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNF
CFR_BACVZ             ---MQQKNKYIRIQEFLKQNKFPDFRMNQIKNAVFQGRINHFNEITVLPKSLRKLLIEEF
CFR_BACSK             MKVVNHATKYERLKHFLNALNEPTYRYKQITEAIFKHRIGAFNKMTTLPKALRESLINEF
                             .**  ::.:    : * :*  *: .*:*  . . :. :  **  *:  * . :

A0A0E1KW04_CLOBO      GKNVSSVIPVFSQDSKQAQKLLIELTDGERIEAVGLKYKQGWESFCISCQCGCSFGCRFC
C1FV44_CLOBJ          RKNVSSVIPVFSQDSKQAQKLLFELTDGERIEAVGLKYKQGWESFCISCQCGCGFGCRFC
CFR_CLOBL             GKNVSSVIPVFSQDSKQAQKLLFELTDGERIEAVGLKYKQGWESFCISSQCGCGFGCRFC
CFR_CLOBM             GKNVSSVIPVFSQDSKQARKLLFELTDGERIEAVGLKYKQGWESFCISSQCGCGFGCRFC
CFR_CLOBK             GKNVSSVIPVFSQDSKQAQKLLFELTDGERIEAVGLKYKQGWESFCISSQCGCGFGCRFC
CFR_CLOB1             GKNVSSVTPIFSQDSKQAQKLLFELTDGERIEAVGLKYKQGWESFCISSQCGCSFGCRFC
CFR_CLOBH             GKNVSSVTPIFSQDSKQAQKLLFELTDGERIEAVGLKYKQGWESFCISSQCGCSFGCRFC
CFR_LACP7             GPSVCCTVPVACQTSGQADKILFSLPDGNRVETVNLHYKKGWESFCISSQCGCGFGCQFC
C0ZJA6_BREBN          GPNVCSIAPVKELTSKQVSKVLFAIPGDEQVEAVRLTYERGWKSYCISTQCGCGFRCKFC
CFR_STAAU             GETVLNIKLLAEQNSEQVTKVLFEVSKNERVETVNMKYKAGWESFCISSQCGCNFGCKFC
CFR_STASC             GETVLNIKLLAEQNSEQVTKVLFEVSKNERVETVNMKYKAGWESFCISSQCGCNFGCKFC
CFR_STAWA             GETVLNIKLLAEQNSEQVTKVLFEVSKNERVETVNMKYKAGWESFCISSQCGCNFGCKFC
CFR_BACVZ             GESILNIAPLKVQHSEQVTKVLFEISGDEKIETVNMKYKAGWESFCISSQCGCHFGCKFC
CFR_BACSK             GPSILTVEPVLETTSQQVTKVLLKVAGNNQVEAVRMHYEAGWESFCISSQCGCGLGCTFC
                        .:     :    * *. *:*: :. .:::*:* : *: **:*:*** **** : * **

A0A0E1KW04_CLOBO      ATGSVGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
C1FV44_CLOBJ          ATGSVGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_CLOBL             ATGSAGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_CLOBM             ATGSAGFKRNLTADEITDQLLYFYFNNHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_CLOBK             ATGSAGFKRNLTADEITDQLLYFYFNNHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_CLOB1             ATGSAGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_CLOBH             ATGSAGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLF
CFR_LACP7             ATGTLGHKRNMTADEITDQLLYFHLNGHKLNSISFMGMGEPLANPNLFDALNILNDSSLF
C0ZJA6_BREBN          ATGTIGLKRNLTADEITDQLLYFRLNGHSLDSISFMGMGEALANPHIFEAMTILTDPYLF
CFR_STAAU             ATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEALANRQVFDALDSFTDPNLF
CFR_STASC             ATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEALANRQVFDALDSFTDPNLF
CFR_STAWA             ATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEALANRQVFDALDSFTDPNLF
CFR_BACVZ             ATGDIGLKRNLTSDEMTDQILYFHLKGHSIDSISFMGMGEALANVQVFDALHVLTNPELF
CFR_BACSK             STGAIGLKQNLSADEMTDQLLYFYLKGHSLDSVSFMGMGEALANVRIFDALNVLVDRQLF
                      :**  * *:*:: **:***:*** : .* ::*:*******.:** .:*:*:  : :  **

A0A0E1KW04_CLOBO      GLSQRRITISTIGIIPGIQRLTQKFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKT
C1FV44_CLOBJ          GLSQRRITISTIGIIPGIQRLTQKFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKT
CFR_CLOBL             GLSQRRITISTIGIIPGIQSLTQKFPQVNLAFSLHSPFESQRSDLMPINKRFPLNQVMKT
CFR_CLOBM             GLSQRRITISTIGIIPGIQRLTKKFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKT
CFR_CLOBK             GLSQRRITISTIGIIPGIQRLTKKFPQVNLAFSLHSPFESRRSDLMPINKRFPLNEVMKT
CFR_CLOB1             GLSQRRITISTIGIIPGIQRLTKEFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKT
CFR_CLOBH             GLSQRRITISTIGIIPGIQRLTKEFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKT
CFR_LACP7             GLSQRRITISTIGIIPGIKRLTHEFPQINLAYSLHSPFENQRSELMPVNRSFPLHEVMNA
C0ZJA6_BREBN          GLGHRRITISTIGLLPGIDKLTREFPQVNLTFSLHSPFDDQRSELMPINDRFPVRDVLIA
CFR_STAAU             ALSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNI
CFR_STASC             ALSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNI
CFR_STAWA             ALSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNI
CFR_BACVZ             ALSPRRLSISTIGIIPGIKKITQDYPQVNLTFSLHSPFNEQRSKLMPINERYPLLEVMDT
CFR_BACSK             ALSPRRITVSTVGIIPNIQRMTSSFPQMNLTFSLHSPFHDQRSELMPINNKYPLDQVMNV
                      .*. **:::**:*::*.*. :* .:**:**::*****: ..**.***:*  :*: :*:  

A0A0E1KW04_CLOBO      LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAVVG-LLKNRGSWEHLYHIDLIPYNSTDKT
C1FV44_CLOBJ          LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAVVG-LLKNRGSWEHLYHIDLIPYNSTDKT
CFR_CLOBL             LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAVVG-LLKNRGSWEHLYHIDLIPYNSTDKT
CFR_CLOBM             LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAVVG-LLKNRGSWEHLYHIDLIPYNSTDKT
CFR_CLOBK             LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAVVG-LLKNRGSWEHLYHIDLIPYNSTDKT
CFR_CLOB1             LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAIIG-LLRNRGSWEHLYHIDLIPYNSTDKT
CFR_CLOBH             LDEHIIHTGRRVFIAYIMLEGINDSKEHAEAIIG-LLRNRGSWEHLYHIDLIPYNSTDKT
CFR_LACP7             LDNHIRHTGRRLFLAYIMLNGVNDSVDHAKALVE-LLQDRGPWAHLYHVDLIPYNATDKT
C0ZJA6_BREBN          LDRHIRETGRKVYIAYILLRGVNDSTAHAEAVAE-LLRGRGAWEHLYHVNLIPFNSTEVT
CFR_STAAU             LDEHIRLTSRKVYIAYIMLPGVNDSLEHANEVVS-LLKSRYKSGKLYHVNLIRYNPTISA
CFR_STASC             LDEHIRLTSRKVYIAYIMLPGVNDSLEHANEVVS-LLKSRYKSGKLYHVNLIRYNPTISA
CFR_STAWA             LDEHIRLTSRKVYIAYIMLPGVNDSLEHANEVVS-LLKSRYKSGKLYHVNLIRYNPTISA
CFR_BACVZ             LDEHIRVTSRKVYIAYIMLPGVNDSIDHANEVVN-LLRSRYKRGNLFHVNIIRYNPTVSS
CFR_BACSK             LDQHIHETGRKVYIAYVMLRGVNDSEKHAEALVKRILNNRYP--HLYHVNLIRYNPTVGT
                      **.**  *.*::::**::* *:***  **: :   :*..*    :*:*:::* :*.*  :

A0A0E1KW04_CLOBO      TFKFQSSS--AIKQFCSTLKKAGISATVRTQFGSEISAACGQLCYENEL----
C1FV44_CLOBJ          TFKFQSSS--AIKQFCSTLKKAGISATVRTQFGSEISAACGQLCYENEL----
CFR_CLOBL             TFKFQSSN--AIKQFCSTLKKAGISATVRTQFGSEISAACGQLCYENEL----
CFR_CLOBM             TFKFQSSS--AIKQFCSTLKKAGISATVRTQFGSEISAACGQLCYENEL----
CFR_CLOBK             TFKFQSSS--AIKQFCSTLKKAGISATVRTQFGSEISAACGQLCYENEL----
CFR_CLOB1             TFKFQSSS--AIKQFCSTLKKASISATVRTQFGSEISAACGQLCYENEL----
CFR_CLOBH             TFKFQSSS--AIKQFCSTLKKASISATVRTQFGSEISAACGQLCYENEL----
CFR_LACP7             PRKFASSDKITMKRFRDILHANGISVATRTQFGSDISAACGQLLGEKDV----
C0ZJA6_BREBN          PDSYRQSDPSRIKAFVRILKSRGISVTVRTQFGSDINAACGQLYRSE------
CFR_STAAU             PEMYGEANEGQVEAFYKVLKSAGIHVTIRSQFGIDIDAACGQLYGNYQNSQ--
CFR_STASC             PEMYGEANEGQVEAFYKVLKSAGIHVTIRSQFGIDIDAACGQLYGNYQNSQ--
CFR_STAWA             PEMYGEANEGQVEAFYKVLKSAGIHVTIRSQFGIDIDAACGQLYGNYQNSQ--
CFR_BACVZ             PMRFEEVNEKQVVNFYKKLKSAGINVTVRSQFGIDIDAACGQLYGNYQKNKNQ
CFR_BACSK             PENYGQTIEEKLQTFYRVVKSARIPVTIRSQFGREIDAACGQLYGQYQAKKR-
                      .  : .     :  *   ::   * .: *:*** :*.******  .