CLUSTAL format seed alignment for MF_01874

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YTWI_BACSU       -------MFTQANLFLILLLAIALIAKNQSLLFAVSVLLIIKIVGL-DQKLFPTIQSKGI
Y2620_BACVZ      -------MFTQANLFLLLLLAIALVAKNQSLLFAVGFLIVIKAVGL-DQKLFPVIQSKGI
Y400_BACLD       -------MFTQANLFLILLLAIALIAKNQSLIIAVSVLLLIKLIGL-DQKLFPAIQSKGI
Y2558_BACP2      -------MFTQANLFLVLLLVIALIAKNNSLILAVSVLIGIKLIGL-DQKIFPVLQSKGI
Y4489_BACAN      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4596_BACCR      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4726_BACC1      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4324_BACHK      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4336_BACCZ      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4851_BACAA      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4871_BACAC      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4705_BACC3      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4710_BACC0      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y533_BACC2       -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4721_BACC7      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4425_BACMK      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4179_BACAH      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4399_BACCQ      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y4705_BACC4      -------MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFL-GDKVFPYLQTKGI
Y3279_BACCN      -------MISQSTLFLFILLIIGLIAKNQSLIVAICVLFVLKWTFL-GDKILPYLQTKGI
Y3161_BACHD      -------MISQATIFMLVLLVIALLAKNQSLLIAVLVLLVIKFIGV-GDKVFPFFQQKGI
Y2716_BACSK      -------MLSQSTLFLLLLMAIALIAKNQSLIIAISVLLLIKWTGL-GDKVFPLMQAKGI
Y503_ANOFW       ---------MQPFIFLFILLVIGMMAKNQSLIIAVLFLLIVKSIGL-SSKVLPYLEQKGI
Y2737_GEOKA      --------MNEPVLFLLLLLALGFLAKNKSLIVAIVVLLAIKLVGL-DQKVLPIIQSKGI
Y2661_GEOTN      --------MNEPVLFLLLLLAIGVIAKNQSLIIAIAVLLAIKLFGL-EARLLPAIQAKGI
Y2680_GEOSW      --------MGEPILFLLILFIIGFIAKNQSLMIAVAILLIIKMVGM-GEKWLPIVHEKGI
Y1090_PEDPA      ---------MESWLFLIGIFIVALLGKNQSLIIASIVVLFLKLIPY-SDKIFPLLNKQGI
Y1246_ENTFA      ---------MESWLFLLLIALIAFVAKNQSLLIASVVVLALKALPN-SAKIMSWLSDKGI
Y1894_LACPL      ---------MESWLFLLAILVVAWLGKNQSLQIATVVVLLIKLIPN-TSKLLTTIGQKGI
Y1594_LACPJ      ---------MESWLFLLAILVVAWLGKNQSLQIATVVVLLIKLIPN-TSKLLTTIGQKGI
Y1366_LACP3      ---------MESWLFLLGILAIAIVGKNKSLIIGVSAVMVLKLIPQ-TQNFLKLLQTQGI
Y1586_LACCB      ---------MESWLFLLGILAIAIVGKNKSLIIGVSAVMVFKLIPQ-TQNFLKLLQTQGI
Y1031_LACSS      ---------MESWLFLAAILIVALLAKNQSLIIATAVVLVLKALPI-SEKVLPVIQAKGI
Y919_LACAC       ---------MESWLFLALILVVALLGKNMSLIIATAVVMLFKLLPF-TGKWLPTIQAKGI
Y995_LACH4       ---------MESWLFLALVLVVALVGKNMSLIIATGVVMALKLIPF-ASKWLPVIQAKGI
Y892_LACRJ       ---------MESWLFLALVLLIAIFGHNSSLIIATVIVMVLKLIPY-TAKWLPLIQHKGI
Y946_LACRD       ---------MESWLFLALVLLIAIFGHNSSLIIATVIVMVLKLIPY-TAKWLPLIQHKGI
Y936_LACS1       ---------MESWIFLGLILLIAYLGKNSSLLIAGAVVIVIKLFPFLSQKLYPVIQAKGI
Y1590_LISMF      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKAMEMIQAKGI
Y1579_LISMC      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKAMEMIQAKGI
Y1001_LISMH      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKAMEMIQAKGI
Y1603_LISIN      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKAMELIQAKGI
Y1568_LISMO      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKVMEIIQAKGI
Y1581_LISW6      -------MFTESMLFLLLFLLLGLIAKNNSLIIAVAVVILLKLFHV-DGKVMEMVQAKGI
Y2210_EXIS2      ---------MEAYLFLIGLVLIGVIAQNKSLIIAAAFLLIIKAIGL-DGRLFPSLQAKGI
Y668_EXISA       ---------MSAYLFLLMLVLIGVISNNQSVIIASSVLLIIKAIGF-GDQLFPTLASKGI
Y1209_CLONN      ---------MSSKIILLILMFLSFISKNKSLGIATIVMLFISFFNT--EKCITFMENHFM
YEAL_SHIB3       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEQQGL
YEAL_ECOBR       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO27       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_SHIDS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO81       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECODH       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO24       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_SHISS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO5E       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOUT       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO7I       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO8A       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOLC       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOLI       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_SHIBS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO57       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOL5       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOLU       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOSE       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOHS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOL6       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_SHIFL       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOSM       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO45       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECOBW       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO55       -------MFDVTLLILLGLAALGFISHNTTVAASILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ECO5T       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_ESCF3       -------MFDVTLLILLGLAALGFVSHNTTVAVSILVLIIVRVTPL--STFFPWIEKQGL
YEAL_SALTI       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALTY       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALPA       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALCH       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALPC       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALG2       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALEP       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALDC       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALA4       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALPK       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALSV       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALHS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALNS       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALPB       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
Y1811_CITK8      -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
YEAL_SALAR       -------MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPL--NTFFPWIEKQGL
Y3307_KLEP3      -------MFDTTLLILLGLAALGFISHNTTVAISILVLIIVRVTPL--NTFFPWIEKQGL
Y1150_KLEP7      -------MFDTTLLILLGLAALGFISHNTTVAISILVLIIVRVTPL--NAFFPWVEKQGL
Y1667_ENT38      -------MFDPTLLILLALAALGFISHNTTVAISILVLIIVRVTPL--NTFFPWIEKQGL
Y2180_CROS8      -------MFDITLLILLALAGLGFVSHNMAVTVSVLVLIVIRMTPL--SAWFPWVEKQGV
Y1746_ERWT9      -------MFDLTLAIMLFLAALSYFSHNITVTIALLVLIVIRMTPL--QQTFPWIEKQGM
Y1722_SODGM      -----MNFSDPTLLILLGLAALGIISHNNIVTVAILVLLIIRLTPM--EQYFPWVEKQGL
Y1142_PECCP      -----MAYLDPTLLILLVLAGLGIISHNMTVTLAILVLLAIRITPL--NSYFPWVEKYGL
Y1265_PECAS      -----MAYIDPTLLILLVLAGLGIISHNMTVTLAILVLLAIRITPL--NSYFPWVEKYGL
Y2981_DICC1      -----MGVFDPTLLILLALAALGIISQNMTVTLAILFLVAVRITPL--NHYFPWVEKYGL
Y1075_DICP7      -----MASLDSPLLILLVLAVLGIVSHNMTITLAVLFLLVVRFTPL--NHFFPWVEKYGL
Y2726_PHOLL      -----MSHLDPTLLVLLVLAALGIISHNMTVTLAMLLLLVIRITPL--NHFFPWVEKYGL
Y1560_PROMH      -----MSNVDPSLLILLVLAGLGIISHNMTVTLAMIFLLVIKITPL--NQYFPLVEKYGM
Y3057_YERPE      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y2779_YERPS      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y2162_YERPP      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y1328_YERPN      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y2248_YERPA      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y2884_YERPB      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y1367_YERPY      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y3137_YERPG      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y1251_YERP3      -----MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPL--NSFFPWVEKYGL
Y1142_YERE8      -----MAALDPTLLILLVLAGLGIISHNMTVTLAILTLIAVRITPL--NQFFPWIEKYGL
Y1344_ACIB3      ----MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPL--NQFFPYIQAHGL
Y2121_ACIBT      ----MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGILIVIKITPL--NQFFPYIQAHGL
Y1616_ACIBS      ----MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPL--NQFFPYIQAHGL
Y1440_ACIBY      ----MLAQFDVNLVVLLVLLICGLLSQNAAVTIAADVLIVIKITPL--NQFFPYIQAHGL
Y2320_ACIBC      ----MLAQFYVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPL--NQFFPYIQAHGL
Y2455_ACIB5      ----MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPL--NLIFPYIQAHGL
Y2383_ACIAD      ---MLMSQFDVNLLVLLVLLACGIFSQNAAVTIAAGVLIVFKLTPL--SEFFPFLQQHGL
Y364_HAMD5       -----MMFFSSTFFVLLLFAILGLISKNMTLSISVVCLFFLSFIYP--NLIFPWVEKYAL
Y1074_HAEIN      ----MTLQLNTIALLLVILLILGVLSNNSTITISAAVLLIMQQTFL--SSHIPLLEKYGV
Y8995_HAEIG      ----MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFL--SSHIPLLEKYGV
Y1233_HAEI8      ----MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFL--SSHIPLLEKYGV
Y6715_HAEIE      ----MTLQLNTIALLLVILLILGVLSNNSTITISAAVLLIMQQTFL--SSHIPLLEKYGV
Y561_AGGAN       ----MSLQFNMIALLLVILILLGIFSHNSSITISAAVLLIMQQTLL--AKYIPYLEKYGL
Y993_HAES1       ----MSLQFNSIALLLVSLILLGVLGNNSSITISATILLLMQQTFL--AKYIPFTEKYGV
Y1471_HISS2      ----MSLQFNSIALLLVSLILLGVLGNNSSITISATILLLMQQTFL--AKYIPFMERYGV
Y1151_ACTSZ      ----MSLHFNSIGFLLVVLALLGVLGNNSSITISATVLLLMQQTFL--SKYIPVMEKYGL
Y771_PASMU       ----MSLQFNTVALLLVVLILLGVLSNNSSVTISAAILLLMQQTFL--AKYIPFMEKHGI
Y1439_MANSM      ----MSLQVNSVAIMLVVLILLGVLSNNNSITISALILLLMHQTFL--GKYIPFLEKNGL
Y388_ACTP7       ----MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFL--SKYLPFLDKHGL
Y384_ACTPJ       ----MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFL--SKYLPFLDKHGL
Y366_ACTP2       ----MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFL--SKYLPFLDKHGL
Y1071_HAEDU      ----MSLQFNPIGLFLVALILLGVLGNNNSITISATLLLLMQQTAL--NKYIPMLEKYGL
Y2160_NEIMA      ------MNFSFAPLFLVTLILLGVVSNNNSITISATILLLMQQTAL--IQFVPLVEKHGL
Y1816_NEIM0      ------MNVSFAPLFLVTLILLGVVSNNNSITISATILLLMQQTAL--IQFVPLVEKHGL
Y1845_NEIMF      ------MNFSFVPLFLVTLILLGVVSNNNSITISATILLLMQQTAL--VQFVPLVEKHGL
Y1674_NEIG1      ------MNFSFVPLFLVTLILLGVVSNNNSITVSATILLLMQQTAL--VQFVPLVEKHGL
Y2061_NEIG2      ------MNFSFVPLFLVTLILLGVVSNNNSITVSATILLLMQQTAL--VQFVPLVEKHGL
Y1649_HAEPS      ----MSLQFNSVALLLVALILLGIFSQNSAVTISAAVLLIMQQTLL--SKYVPYLEQYGI
Y3276_BREBN      --------MDWISIILLVLLALGVIGNNATVSIAVAILLLMRLLSL--ERYFPLLEQHGL
Y2648_SYMTH      --------MPGDQVILLSLMALGVVARNALIVTAAGVVLILRVLAL--ERFFPLLERRGL
Y2290_PAESJ      --------MMTGELILVGLIVIGLIGRS-PIIATAACVLLAVKLLHLSRF-LPSIERRGL
Y2317_BREBN      --------MMSGEVMLVILIVIGLIGRS-PIIATAASILLVLKLTALERF-FPTVERRGL
Y1817_PELTS      --------------MLVVLLLIGMAAHS-SLIVIAACILLILKLTNVNFI-FSLLERRGL
Y1310_DESAP      -------MPVTSELILAALLLVGVLAKS-HLIAAAACILLFIKLARFDLA-FNFLEQKGL
Y1676_DESRM      --------MYSGEMTMVILLLIGLVAQS-NLIAICASVLLIVQFSKMDFL-FPYLETHGL
Y1097_DESRM      --------MQRANIILLSLILMGYLAES-ALLATAGCILLVMRLSKLNRL-MFLLERRGL
Y120_MOOTA       --------MSAATVILILLMLLGILGRS-NVIAAAAAFLLLLQFTSLQRF-YPILERRAL
Y993_HELMI       --------MRGGTVLLILILLLGVIARS-PMTALAAASILALSYLGWGGL-LEWIEQNGV
Y2177_HALOH      ---------MNIKYFLLIITILGFLARS-RVLVIAGLLLLTIYEFEIDFV-FEFLGNKGI
Y1668_PELTS      MSTNFFFAFESSEMILITLLFLGLFGRS-NLVVSSSCILLCLKYFKLDQLVFPVLESRGL
Y1957_NATTJ      --------MFHEIVVLLFIFLIALIGKN-DLVATAGALLFVMKFSPLSNV-FPFLTERGI
Y092_CLOAB       ---------MESNIILVVILGISIVGKA-TSVAISVAALLILKLLGLDKYIFPYLNDKGM
Y1028_CLOK1      ---------MESTIILIIILTASVLGRA-NSVALATCFLLILKLLNADKFIFPYLQENGL
Y1009_MOOTA      ---------MESTLIILAVLVVAVLGRA-NTVALAASLLLVLKLLQVDQYIFPFIEKGGT
Y1234_BREBN      --------MLHTTIILLVIALLSLVAKD-LVLVYASLLLLGLSLLKAVP-VMDAIQKPMF
                                :  .   .  ..           .                     

YTWI_BACSU       NWGVTIITIAVLVPIATGEIGFKQLGEAMRSSYAWIALGAGIAVALIAKNGLTLLEND--
Y2620_BACVZ      NWGVTVITIAVLVPIATGDIGFKQLGEAMKSYYAWIALGAGIAVALIAKNGLTLLEND--
Y400_BACLD       NWGVTVITIAVLVPIATGEIGFKQLGEAMKSYYAWIALGAGILVALIAKNGITLLAED--
Y2558_BACP2      NWGVTVITIAVLVPIATGDIGFKQLGEAVKSSYAWIALGAGILVALIAKNGIVLLEND--
Y4489_BACAN      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4596_BACCR      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4726_BACC1      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4324_BACHK      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4336_BACCZ      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4851_BACAA      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4871_BACAC      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4705_BACC3      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4710_BACC0      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y533_BACC2       NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4721_BACC7      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4425_BACMK      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4179_BACAH      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4399_BACCQ      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y4705_BACC4      NLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTD--
Y3279_BACCN      NLGVTVITIAVLVPIATGEIGFKQLGEATKSYYAWIALASGIAVALLAKGGLQLLTND--
Y3161_BACHD      SLGVTIITIAVLTPIATGEIGFKQMGEAIRSSYAWVALLSGVVVALIAASGIDLLKND--
Y2716_BACSK      NLGVTIITIAVLVPIATGDIGFKQLGEATKSLYAWVALGSGIAVALVAASGIDLLKND--
Y503_ANOFW       QLGVTIITIAVLVPIATGKIGFKELAESVRSIYAWIAMLSGIAVALLAKGGVALLAKD--
Y2737_GEOKA      NWGVTVITIAVLAPIASGEIGFRQLVGSLQSLSAWVALASGIFVALIAKNGVTLLAND--
Y2661_GEOTN      NWGVTVITVAVLAPIATGEIGFKQLIGSLQSASAWIALLFGIFVALIAKGGVMLLASD--
Y2680_GEOSW      HWGVTVITIAVLAPIATGEIGFRQLIASLQSLSAWIALLSGIFVALVAKGGVTLLATD--
Y1090_PEDPA      NWGVTIISITILVPIATGKIGFMDLVNSFKSPVGWIAVACGILVSLLSYQGVGFLSAS--
Y1246_ENTFA      NLGVTIISITILVPIATGQIGLKDLIQSFKTPMGWLGILCGILVAVLSSKGVGLINQS--
Y1894_LACPL      NWGVTVITVAILIPIATGQIGFRDLWHAFKSPVGWIAVACGVLVSVLSFHGVGLLSAT--
Y1594_LACPJ      NWGVTVITVAILIPIATGQIGFRDLWHAFKSPVGWIAVACGVLVSVLSFHGVGLLSAT--
Y1366_LACP3      NWGVTVISAAIMVPIATGEIGFKELLNVIKSPAGWIAIGCGVLVAVLSAKGVGLLAMS--
Y1586_LACCB      NWGVTVISAAIMVPIATGEIGFKELLNVIKSPAGWIAIGCGVLVAVLSAKGVGLLAMS--
Y1031_LACSS      NWGVTVISVAILVPIATGQIGFKELISAFKTPAGFIAVGCGVLVAVLSAKGVGLLAAS--
Y919_LACAC       NWGVTIISVAILIPIATGQIGFKDLIRTFKTPAGWIAILAGIAVAVLSRYGVNQLAAV--
Y995_LACH4       NWGVTVISVAILIPVATGQIGFKDLINTFKSPAGWIAILAGIAVAILSRYGVDQLAAV--
Y892_LACRJ       NWGVTVISVAILIPIATGQIGFNDLWAAFKTPAGWIAVGMGIAVAILSKYGVNQLAAV--
Y946_LACRD       NWGVTVISVAILIPIATGQIGFNDLWAAFKTPAGWIAVGMGIAVAILSKYGVNQLAAV--
Y936_LACS1       NWGVTIISVAILIPIATGQIQFKDLINAMKTPAGWIAVVCGILVAILSKHGVNLLSST--
Y1590_LISMF      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVD--
Y1579_LISMC      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVD--
Y1001_LISMH      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVD--
Y1603_LISIN      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVD--
Y1568_LISMO      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVGYMAVD--
Y1581_LISW6      NWGVTIITVAILIPIATGQIGFKDLIDSFKSAAGWIGLGAGIAVSILAKKGVSYMAVD--
Y2210_EXIS2      TWGVTLITAAILVPIATGDIGFRELLNSVRGHIGIISFLAGIFVAIIAAHGVGLMKED--
Y668_EXISA       SWGVTIITIAVLVPIATGDIGFKELWNSIKGPVGIVAFASGMFVAIAAGQGVQLMRVD--
Y1209_CLONN      NLGMTFLMIWMLIPIIKNP-EFTENIKNAFNLKGIVCFLCGAIVAVLASKGVGFLKGS--
YEAL_SHIB3       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOBR       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO27       SIGIIILTIGIMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_SHIDS       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVYWLGGRGVTLMGSQ--
YEAL_ECO81       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECODH       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO24       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_SHISS       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO5E       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOUT       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO7I       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO8A       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOLC       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOLI       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_SHIBS       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO57       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOL5       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOLU       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOSE       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOHS       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOL6       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_SHIFL       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOSM       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO45       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECOBW       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO55       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ECO5T       SIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_ESCF3       TIGIIILTIGVMAPIASGSLPPSTLIHSFFNWKSLVAIAVGVIVSWLGGRGVTLMGSQ--
YEAL_SALTI       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALTY       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALPA       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALCH       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALPC       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALG2       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALEP       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALDC       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALA4       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALPK       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALSV       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALHS       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALNS       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
YEAL_SALPB       TVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQ--
Y1811_CITK8      TVGIIILTIGVMAPIASGSLPPSTLIHSFVNWKSLVAIAIGVFVSWLGGRGVTLMGSQ--
YEAL_SALAR       TVGIIILTIGVMAPIASGTLPSSTLLHSFENWKSLVAIAVGVFVSWLGGRGVALMGNQ--
Y3307_KLEP3      TVGIIILTIGVMAPIASGTLPPSTLIHSFMNWKSLLAIAVGVFVSWLGGRGVSLMGTQ--
Y1150_KLEP7      TVGIIILTIGVMAPIASGTLPPSTLIHSFMNWKSLLAIAVGVFVSWLGGRGVSLMGSQ--
Y1667_ENT38      TIGIIILTIGVMAPIASGTLPASTLLHSFVNWKSLIAIAVGVFVSWLGGRGVTLMSSQ--
Y2180_CROS8      TVGIIILTISVMAPIASGTLPTSTLFHAFLNWKSLVAIAVGVFVSWLGGKGVALMGSQ--
Y1746_ERWT9      TVGIIILTIGVMAPIASGTIPSSTLMHSFLHWKSLTAIAIGIFVSWLGGRGVTLMSTQ--
Y1722_SODGM      TIGIIILTIGVMAPIASGTLSASTVLHSFLHWKSLLAIVIGVAVSWLGGRGVSLMSSQ--
Y1142_PECCP      SIGIVILTIGVMAPIASGKITASEVMHSFLHWKSLLAILIGVAVSWLGGRGVSLMSNQ--
Y1265_PECAS      SIGIVVLTIGVMAPIASGKITASEVMHSFLHWKSLLAILIGVAVSWLGGRGVSLMSNQ--
Y2981_DICC1      SFGVLVLTIGVMAPIASGKISAGDVLSSFLHWKSLMAVAIGVAVSWLGGRGVVLMSNQ--
Y1075_DICP7      SFGILVLTIGVLAPIASGKIAASEVVQAFLNWKSLLAVIIGIAVSWLGGRGVSLMSNQ--
Y2726_PHOLL      TIGVLILTVGVMAPIASGKITVQAVLNSFMNWKSLLAIVIGVLVSWLGSRGVSLMSNQ--
Y1560_PROMH      TIGILILTIGVMTPIATGRISAQEVFNSFLNWKSLLAIAIGIIVSWLGARGVSLMNNQ--
Y3057_YERPE      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y2779_YERPS      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y2162_YERPP      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y1328_YERPN      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y2248_YERPA      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y2884_YERPB      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y1367_YERPY      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y3137_YERPG      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y1251_YERP3      TIGVLILTIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y1142_YERE8      TIGILILTIGVMTPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQ--
Y1344_ACIB3      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y2121_ACIBT      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y1616_ACIBS      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y1440_ACIBY      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y2320_ACIBC      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y2455_ACIB5      NLGILILTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQ--
Y2383_ACIAD      NVGVIILTIGVLTPIASGKLSGETILKSFFSYKSILAITVGLLVAWLGGRGVKLMSSQ--
Y364_HAMD5       KAGILILTIAVLAPIASGKINARDIFNSFTHWQSILGILIGVFVSWLGGRGVSLMSHQ--
Y1074_HAEIN      KIGIIILTIGVLSPLVSGKIQLP-DLSGFLSWKMALSISVGVLVAWLAGKGVPLMGEQ--
Y8995_HAEIG      KIGIIILTIGVLSPLVSGKIQLP-DLSGFLSWKMALSISVGVLVAWLAGKGVPLMGEQ--
Y1233_HAEI8      KIGIIILTIGVLSPLVSGKIQLP-DLSGFLSWKMALSIAVGVLVAWLAGKGVPLMGEQ--
Y6715_HAEIE      KIGIIILTIGVLSPLVSGKIQLP-NLSGFVSWKMALSISVGVLVAWLAGKGVPLMGEQ--
Y561_AGGAN       SIGIVILTIGVLSPLVSGKIQLP-GLSAFVSWKMFVAIAVGVFVAWLAGKGVPLMGEQ--
Y993_HAES1       NIGIIILTIGVLSPIVSGKVQLP-NWTALIHWKMFLAMAVGVLVAWFGGRGVNLMGTQ--
Y1471_HISS2      NIGIIVLTIGVLSPIVSGKVQLP-NWTALIHWKMFLAMAVGVLVAWFGGRGVNLMGTQ--
Y1151_ACTSZ      NIGVIILTIGVLSPIVAGKVKIP-ALTELLHWKMFLSLVVGMLVAWLAGRGVSLMGSQ--
Y771_PASMU       TLGIIILTIGVLSPIVSGKIQLP-HLAVFLNWKMWLAVAVGLLVAWLGGRGVGLMGAQ--
Y1439_MANSM      KVGIIILTVGVLAPLVSGKVQLP-AFKEFLNWQMFLSIVIGIAVAWFAGRGVNLMSSE--
Y388_ACTP7       SIGIIILTIGVLSPIVSGKISLP-SFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQ--
Y384_ACTPJ       SIGIIILTIGVLSPIVSGKISLP-SFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQ--
Y366_ACTP2       SIGIIILTIGVLSPIVSGKISLP-SFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQ--
Y1071_HAEDU      TIGIIILTIGVLSPIVSGKINLP-NLSEILSWKMALAISIGIFVAWLGGRGINLMATQ--
Y2160_NEIMA      NLGIILLTIGVLSPLVSGKAQVP-PVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQ--
Y1816_NEIM0      NLGIILLTIGVLSPLVSGKAQVP-PVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQ--
Y1845_NEIMF      NLGIILLTIGVLSPLVSGKAQVP-PVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQ--
Y1674_NEIG1      NLGIILLTIGVLSPLVSGKAQVP-PVAEFLNFKMISAVFIGIFVAWLAGCGVPLMGRQ--
Y2061_NEIG2      NLGIILLTIGVLSPLVSGKAQVP-PVAEFLNFKMISAVFIGIFVAWLAGCGVPLMGRQ--
Y1649_HAEPS      KIGIIILTIGVLAPLVSGRIALP-ELVQLINWKMIVAIIAGIVVAWLGGRGVTLMGNQ--
Y3276_BREBN      QLGIIILTIGIMTPLASGKINPSSFLEIFTNWHSLLAVAVGMFVAYLAGKGTVLMSQN--
Y2648_SYMTH      EAGLIFLLIAVLVPFATGEVGWAEIRQSFTSWTGLAAILGGIIAAVLSGYGVTLLQVK--
Y2290_PAESJ      ELGLLFLTLSVLVPFASGKVQMKELIAAFNTWPGWLALIGGAVAAYMNAKGLDLLKLD--
Y2317_BREBN      ELGLLFLTISVLVPFASEKISWKDVTPLFTTVVGLTALAGGAIATWMNGKGLDLLRSE--
Y1817_PELTS      EMGLTFLLLSILVPLASGKASWQEIISSLASFSGLLAVAGGALATSLNTRGLNLLKAD--
Y1310_DESAP      ELGLLILLLTIMVPLANGKISERDIIYNLTSIPGLLAILGGALATHLNSQGLQMMQAD--
Y1676_DESRM      ELGLLFLLLSILVPIATDRVTTRDLLYNVSSLPGFLSIVGGILATHLNSEGLKLMQID--
Y1097_DESRM      EVGLIFLMLSVLVPLAHDNIVYKELVMKTLSPQGLLALIGGTLATHMNGEGLKLLKLD--
Y120_MOOTA       EAGLIFLVVSVLVPFASGRVAPRDMLQSFVSLPGLIAIASGIIATHMNCQGLELLQRF--
Y993_HELMI       DTGLIMLTLAMLAPFATGKVGLREVLLSFASLPGIIAVIGGVLATNLNKRGIDLLSGE--
Y2177_HALOH      EIGLIFLLMAILSSLVLSPVDGEVIKDNLLSWQGTVAIIAGVLATKFNGMGLDLLQES--
Y1668_PELTS      ELGLVLLMLHILSPVATEKLTIKDL-HSVTSLKGLFALAAGTLATKLNGDGLALMNAR--
Y1957_NATTJ      ELGILLLTLSVLTPFAAGDIMPRDLLSTLKSPAGLIAVFSGIVASYLTGHGVELLRSR--
Y092_CLOAB       FWGLVLLTAAILIPIAQGNVKAIDIKNNLVSFVGITALVLSFLTTYLSGVGLRYLTVQGH
Y1028_CLOK1      FLGLVILIASILIPIADGKVSYISIRNVFTSWLGIFALLVSLFTTYLSGLGMNYLTIQGH
Y1009_MOOTA      FWGLVLLIAAILVPLARGTVTLRDLGHVFLSWVGLSAFILSLITTYMSGQGLQYLTVQGH
Y1234_BREBN      HVGLFCLMVFLLIPIAKGKYDFISLGKEMVSWKATIAILAGFIISYVGGKGLSILPDQ--
                   *:  :   :: ..                      .  .         *   :     

YTWI_BACSU       PHITTALVIGTILAVALFGGVAVGPLIGAGIAYLAMQIVKLFTS----
Y2620_BACVZ      PHITTALVIGTILAVALFGGVAVGPLIGAGIAYLAMQIVKIFTS----
Y400_BACLD       PHITTALVFGTILAVALFKGVAVGPLIGAGIAYLVMQAVQHFTS----
Y2558_BACP2      PHITTALVFGTILAVSLFKGVAVGPLIGAGIAYLAMQAVKFFSG----
Y4489_BACAN      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4596_BACCR      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4726_BACC1      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4324_BACHK      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4336_BACCZ      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4851_BACAA      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4871_BACAC      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4705_BACC3      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4710_BACC0      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y533_BACC2       PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4721_BACC7      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4425_BACMK      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4179_BACAH      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y4399_BACCQ      PHITTALVFGTIIAVALFNGVAVGPLIGSGIAYAVMSIIQMFK-----
Y4705_BACC4      PHITTALVFGTVIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK-----
Y3279_BACCN      PHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMNIIQMFK-----
Y3161_BACHD      PHITTALVLGTILAVAVFNGVAVGPLIGAGIAYLTMKVVQWLGSFWG-
Y2716_BACSK      PHITAALVLGTIVAVSFLNGVAVGPLIGAGIAYLTMRAIQYIAQLWG-
Y503_ANOFW       PHVTTALVLGTILAVSLFKGVAVGPLIGAGIAYVIMKIVDVFS-----
Y2737_GEOKA      PHMTAALAFGTILAVSLFHGVAVGPLIGAGIAYTVIKMVEYF------
Y2661_GEOTN      PHITASLVLGTVIAVSLFHGVAVGPLIGAGIAYVVIKMVEYF------
Y2680_GEOSW      PHMTAALVFGTIIAVSLFHGVAVGPLIGAGIAYMVMKVIEYF------
Y1090_PEDPA      PEVTVALVMGTIIGVVFMNGIAAGPIIASGIAYLIIQLLQIQIK----
Y1246_ENTFA      PEITVALVFGTILGVVFLKGIAAGPIIASGMMYVIITTFQAFQH----
Y1894_LACPL      PEITVALVFGTIMGVVLLKGIAAGPIIAAGITYCIIQVLHLSLQ----
Y1594_LACPJ      PEITVALVFGTIMGVVLLKGIAAGPIIAAGITYCIIQVLHLSLQ----
Y1366_LACP3      PEMTVALVFGTIIGVVFLKGIAAGPVIASGLTYVILTVFNLVPGH---
Y1586_LACCB      PEMTVALVFGTIIGVVFLKGIAAGPVIASGLTYVILTVFNLVPGH---
Y1031_LACSS      PEMTVALVFGTIMGVVFLKGIAAGPVIAAGITYTILTIFNLVPIH---
Y919_LACAC       PQVTVALVLGTIIGVVAFKGVAAGPVIASGMTYLVVTLFNLHF-----
Y995_LACH4       PQVTVALVLGTIIGVVVFKGVAAGPVIASGMTYLVITLFNLHF-----
Y892_LACRJ       PQVTVALVLGTIIGVVAFKGIAAGPVIASGMTYCIVTLLNLHF-----
Y946_LACRD       PQVTVALVLGTIIGVVAFKGIAAGPVIASGMTYCIVTLLNLHF-----
Y936_LACS1       PQVTVALVIGTIIGVVFLKGVAAGPVIAAGITYYLVTLLNLSFS----
Y1590_LISMF      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y1579_LISMC      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y1001_LISMH      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y1603_LISIN      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y1568_LISMO      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y1581_LISW6      PQVTVSLVFGTILAVVLFRGIAAGPVIAAGIAYMAMQLVAFIK-----
Y2210_EXIS2      PLVTTALLAGTILAVGLFRGVPVGPLIGAGIAALVIGMWDIIVKAISG
Y668_EXISA       PVVTTALLAGTILAVGFMKGIPVGPLVGAGIAALILGGYQVIEKWF--
Y1209_CLONN      TDTLTGIILGSIVGVSLLGGVPVGPLIASGIAYEVVFIINLIFKNNC-
YEAL_SHIB3       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOBR       SQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO27       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SHIDS       LQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO81       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECODH       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO24       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SHISS       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO5E       PQLVAGLLVGTVLGVALFRGVPVGPLIATGLVSLIVGKQ---------
YEAL_ECOUT       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO7I       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO8A       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOLC       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOLI       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SHIBS       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO57       PQLVAGLLVGTVLGVALFRGVPVGPLIATGLVSLIVGKQ---------
YEAL_ECOL5       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOLU       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOSE       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOHS       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOL6       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SHIFL       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOSM       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO45       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECOBW       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO55       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_ECO5T       PQLVAGLLVGTVLGVALFRGVPVGPLIATGLVSLIVGKQ---------
YEAL_ESCF3       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALTI       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALTY       PQLVAGLLVGTVLGVALFRGVRSAH-----------------------
YEAL_SALPA       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALCH       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALPC       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALG2       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALEP       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALDC       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALA4       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALPK       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALSV       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALHS       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALNS       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
YEAL_SALPB       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ---------
Y1811_CITK8      PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIIGKQ---------
YEAL_SALAR       PQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGRQ---------
Y3307_KLEP3      PHLVAGLLVGTVLGVALFRGVPVGPLIAAGIISLFIGKS---------
Y1150_KLEP7      PHLVAGLLVGTVLGVALFRGVPVGPLIAAGIISLFIGKS---------
Y1667_ENT38      PSLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLFIGKS---------
Y2180_CROS8      PSIVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLLIGRQ---------
Y1746_ERWT9      PTVVGGLLIGTIIGVSLFRGVPVGPLIAAGLLSLMLGKG---------
Y1722_SODGM      PSVVAGLLVGTVLGVALFRGVPVGPLIAAGLLSLLVGNT---------
Y1142_PECCP      PSVVAGLLVGTVMGVALFRGVPVGPLIAAGLLSLLIGKT---------
Y1265_PECAS      PSVVAGLLVGTVMGVALFRGVPVGPLIAAGLLSLLIGKT---------
Y2981_DICC1      PSVVAGLLVGTVMGVALFRGVPVGPLIAAGLLSLLIGKG---------
Y1075_DICP7      PSVVAGLLVGTVIGVALLRGVPVGPLIAAGLLSLLIGKG---------
Y2726_PHOLL      PSTVAGLLVGTVLGVALFKGVPVGPLIAAGILSLLIGKS---------
Y1560_PROMH      PSTVAGLLVGTVIGVALFRGVPVGPLIAAGILSLLIGKS---------
Y3057_YERPE      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y2779_YERPS      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y2162_YERPP      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y1328_YERPN      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y2248_YERPA      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y2884_YERPB      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y1367_YERPY      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y3137_YERPG      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y1251_YERP3      PSVVAGLLVGTVLGVALFKGVPVGPLIAAGLLSLVIGKS---------
Y1142_YERE8      PSVVAGLLVGTVLGVALFRGVPVGPLIAAGLLSLVIGKS---------
Y1344_ACIB3      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y2121_ACIBT      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y1616_ACIBS      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y1440_ACIBY      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y2320_ACIBC      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y2455_ACIB5      PDVVAGLLIGTVAGVALLRGVPVGPLIAAGLLSLFIGK----------
Y2383_ACIAD      PDIVAGLLIGTVAGVALLRGVPVGPLIAAGILSLVLWN----------
Y364_HAMD5       PSVVTGLLVGTILGVAFFKGVPVGPLIAAGLLSLALGKF---------
Y1074_HAEIN      PILVTGLLIGTIIGVAFLGGIPVGPLIAAGILALLLGKI---------
Y8995_HAEIG      PILVTGLLIGTIIGVAFLGGIPVGPLIAAGILALLLGKI---------
Y1233_HAEI8      PILVTGLLIGTIIGVAFLGGIPVGPLIAAGILALLLGKI---------
Y6715_HAEIE      PILVTGLLIGTIIGVAFLGGIPVGPLIAAGILALFLGKI---------
Y561_AGGAN       PVLVTGLVIGTIIGVSFLGGIPVGPLIAAGILAVLIGKF---------
Y993_HAES1       PSLLTGLLVGTILGVAFLGGVPVGPLIAAGILSLFIGKTG--------
Y1471_HISS2      PSLLTGLLVGTILGVAFLGGVPVGPLIAAGILSLFIGKTG--------
Y1151_ACTSZ      PVLLTGLLIGTILGVGLLGGIPVGPLIAAGILSLLLGKV---------
Y771_PASMU       PVLLTGLLVGTILGVAFVGGIPVGPLIAAGILSLFLGKS---------
Y1439_MANSM      PIVVTGLLIGTVLGVAFLGGIPVGPLIAAGILAVILGK----------
Y388_ACTP7       PLLVTGLLVGTIIGVALLGGVPVGPLIAAGILSLLIGKG---------
Y384_ACTPJ       PLLVTGLLVGTIIGVALLGGVPVGPLIAAGILSLLIGKG---------
Y366_ACTP2       PLLVTGLLVGTIIGVALLGGVPVGPLIAAGILSLLIGKG---------
Y1071_HAEDU      PLIITGLLIGTIIGIAFFGGIPVGPLIAAGIMSLLVGKL---------
Y2160_NEIMA      PVLITGLLIGTVIGVAFMGGIPVGPLIAAGILSFVVGKG---------
Y1816_NEIM0      PVLITGLLIGTVIGVAFMGGIPVGPLIAAGILSFVVGKG---------
Y1845_NEIMF      PVLITGLLIGTVIGVAFMGGIPVGPLIAAGILSFVVGKG---------
Y1674_NEIG1      PVLVTGLLIGTVIGVAFMGGIPVGPLIAADILSFVAGKV---------
Y2061_NEIG2      PVLVTGLLIGTVIGVAFMGGIPVGPLIAADILSFVAGKV---------
Y1649_HAEPS      PVLVTGLLIGTIIGVAFLKGVPVGPLIAAGILSLIIGKS---------
Y3276_BREBN      PLIVTGLLLGTIAGVTFFRGVAVGPLIAAGILAFILQFLPK-------
Y2648_SYMTH      PEVIVGMVVGTILGVVLFKGIPVGPLAAAGFTAILLALVRGH------
Y2290_PAESJ      PQMVVGLVIGSIFGIIFLRGIPVGPLMAAGITAILYKLFKLMSGG---
Y2317_BREBN      PHMIVGLVIGSIIGIVFFRGIPVGPLMAAGITAFVLKLWEWFGSR---
Y1817_PELTS      PEIVFGLLLGSILGIVFLHGIPVGPLMAAGITALLMQLARIFKP----
Y1310_DESAP      PAIIFGLIIGSIFGILFLGGMPVGPLMAAGIAALFMEFFKYTK-----
Y1676_DESRM      PSIIFGLIVGSVIGIIFFNGQPVGPLMAAGVAALFIEVLNWFH-----
Y1097_DESRM      PQLIFGMVIGSLIGIVFLGGIPIGPLMAAGLTALFLEVIYWFK-----
Y120_MOOTA       PQMMIGMVIGSIIGVAFFGGIPVGPLMAGGIAALLVHLMAWLR-----
Y993_HELMI       PQIIVGMIVGSLLGIVLFGGIPVGPLMAGGLTALILQIYGWLSK----
Y2177_HALOH      PQFILGIIMGSLVGIVFFGGIPVGPLMAAGIGAVLFKIIEIIKG----
Y1668_PELTS      PEIIFGLTVGTVLGILFLRGTPCGPVMAAAVTAVFLQIASLFS-----
Y1957_NATTJ      PEVMVGLIVGSIIGASFLKGVPAGPLVAAGLAAVLIKSLNL-------
Y092_CLOAB       SDVMPSLILGSVAAAAFLGGVPVGPLITSGILALLVKMVKKS------
Y1028_CLOK1      SEIMPALILGAVIAAAFLGGVPVGPMITSGLIALGLKLFNKIGS----
Y1009_MOOTA      SEVMPALILGAVIAAAFLGGVPVGPFITSGVLALLVKLIAKL------
Y1234_BREBN      PVVFIGVTIGTLLAVLLSNGLPAGLIIAAGCIALLSRIFNF-------
                      .:  *:: .     *   .