CLUSTAL format seed alignment for MF_01876

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSUG_ECOLI       ------------MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPFPQNAQTA
PSUG2_PHOLL      ------------MKNHAISNKYLDISPEVTEALENNRPVVALESTIIAHGMPYPQNVKTA
PSUG_HAHCH       ------------------MNAYLDISPEVQTALAAGEPVVALESTIISHGMPWPQNAETA
PSUG_CLOBL       -----------------MLEKYLEISKEVSEALKENKPVVALESTIISHGMPYPKNAETA
PSUG_ALKMQ       ---------------MKNVEKYLEYAPEVKKAIAEGRPIVALESTIISHGMPYPQNVETA
PSUG_BRAHW       ---------------MNNLEEFLDISEEVKEALHEKKAVVALESTIISHGMPYPENVESA
PSUG_PETMO       ----------------MNTTPYLEIKEEVYQALKENRPIVALESTIISHGMPYPQNVEVA
PSUG_CALS4       ------------------MNRFIDLSEEVKSALEERRPVVALESTIISHGMPYPQNIETA
PSUG_MYCAP       --------------------MNIVFSKEVESALKHKRPVVALESTIITHGMPYPKNVEMA
PSUG_ACHLI       ------------------MNQFIDIHPKVLDALRSGKPVVALESTIIAHGMPYPKNVETA
PSUG_GEOKA       ------------------MNDFLVFSEEVAQAKAEKKPIVALESTIISHGMPYPENVQTA
PSUG_CUPPJ       -------------MSTDLAQSWLTLSAPVAAARAAGRPLVALESTIIAHGMPYPENVRTA
PSUG_LYSSC       ------------------MKEFIVLSEEVKAGQAKGLPIVALESTIISHGMPYPQNVQTA
PSUG_HAEPS       ------------------MNNYLILSDEVQRGMAQGLPIVALESTIISHGMPYPQNVAMA
PSUG_STAAW       ---------------MANLQKYIEYSREVQQALENNQPIVALESTIISHGMPYPQNVEMA
PSUG_BREBN       ------------------MKQYLTFTEEVRHALENNLPVVALETTIISHGMPYPQNIEMA
PSUG_SORC5       ----------------MSIKDHLSISSEVRKALAGGRPVVALESTIITHGMPYPQNLEMV
PSUG2_RHIL3      ----------------MTLMKP-RLSREMAEAIAAGSPVVALESTIITHGMPYPANLETA
PSUG_LEGPH       -----------------MFHDLLEFNEEVLDAINDKNPIVALESTIISHGMPYPDNLTTA
PSUG_SOLUE       --------------------MHLKIDPEVRRALQGKRPVVALESTIITHGMPYPENLATA
PSUG_METNO       -----------------MPHPLLDFAPEVRSALDAGAPVVALESTIVTHGMPHPQNVETA
PSUG_JANSC       ------------------MTLPLTFSPEVAEARAAGAPLVALESTIITHGMPYPQNLDTA
PSUG_ROSDO       -----------------MTNLPLRHSAEVAAAKAAGRPIVALESTIITHGMPYPQNLEVA
PSUG_PARDP       ------------------MPPLIALSPETSQALADRQPLVALESTIITHGMPYPQNLEVA
PSUG_RHILO       -------------MSPETARPFIDIHAPVAQALAAGRPVVALESTIITHGMPYPDNGAMA
PSUG1_RHIL3      ---MLSRSQDKTMTKPISPLLPIAYSKEVASAKQRGAPLVALESTIITHGMPYPGNIEMA
PSUG_DINSH       ---------------MTHLPSFVDVHADVRNALETNAPVVALESTIITHGMPFPDNVEMA
PSUG_NOCSJ       ---------MTAP------HPLLTLTDEVADALRDGAPVVALESTIISHGMPYPQNVAMA
PSUG_DEIRA       ---------MTSKPSNDRLHSYLDLQPEVAAALSQGRPVVALESTIISHGMPYPQNVEMA
PSUG_RHOCS       ------------------MHDFLSIHPEVAAALKAGRPVVALESTLISHGLPAPANLETA
PSUG_SYMTH       ------------------MKYLLSYTPEVREALDRNRPVVALESTIISHGMPYPENLRTA
PSUG_COPPD       ---------------------MLQIAPHVKEAIETLKPVVALESTIITHGMPYPANLHTA
PSUG_RUBXD       -------------------MRPVQPAPEVAEALEGGRPVVALESTLISHGLPRPDNLRVA
PSUG_SALTO       MPGLLRARRTDAVRLDAVTTFHLRHGVEVADALRVGRPVVALESTIVSHGLPRPDNLRVA
PSUG_STRGG       MPQNPSDRRPAPRDNPGTNAYEPLLSAEVRAALSTGLPVVALESTIIAHGLPRPRNLSVA
PSUG_FRAAA       ----------------MAGRSNIVVSATVRDALAAGAPVVALESTLIAHGLPRPRNRDVA
PSUG_SACEN       -----------------MPLSLPVISTEVRQALDAGRPVVALESTIITHGLPRPRNLAVA
PSUG_HERA2       -------------------MTKLILAPEVQAAFANGQPVVALESTVISHGLPYPHNREIA
PSUG_ROSS1       -----------MTLEHDRKGISIAVSAEVQAALDAGQPVVALESTVISHGLPYPHNLELA
PSUG_CHLSY       ---------------------MLRIAEEVTTALEEGRAVVALESTLISHGLPYPHNLAVA
PSUG_MYXXD       --------------------MDLRFSEEVRRALEAGQPLVALETSVVAQGLPYPDNLAAA
PSUG_ANAD2       ------------------MNPPVRLAEEVRAALAAGGPVVALETSVVAQGLPPPHNLEAA
PSUG_GEMAT       ---------------MSERLLRPRATSTVFEALERGAALVALESSVLAQGLEPPYNREAA
PSUG1_PHOLL      --------------MNISNKVPFKFSLEVKEALESGKPVVALESNVITHGLDYPDNVTTA
PSUG_SERP5       --------------MMQANLLPLVIHPEVKAALESRHAVVALESNVITHGLNYPANVETA
PSUG_DICC1       ------------MSKTDFSHELLRFSDEVKDALHTGKPVVALESTVIAHGLPYPDNVATA
PSUG_CORA7       -----------------MHNVPIEYSDEVQNALSNGLPILGLESNVLSHGLPYPRNLEMF
PSUG_THET2       ----------------------------------MREPRVALESAVLTHGLPYPLNLEVA
PSUG_THEMA       --------------------------MIIESRIEKGKPVVGMETTVFVHGLPRKEAIELF
PSUG_THESQ       --------------------------MIIESRIEKGKPVVGMETTVFVHGLPRKEAIELF
PSUG_THEP1       --------------------------MIIESRIEKGNPVVGMETTVFVHGLPRKEAIELF
PSUG_THENN       --------------------------MVVENRLEKEKPAVGMETTVFVHGLPRKEAIELF
PSUG_KOSOT       ---------------------------------MKKQPIVALESTVIAHGLPWPTNFETA
PSUG_PSELT       ---------------------------------MEK--ILALESTVIAHGLPFPINIDTA
PSUG_FERNB       ----------------------MIISEKVKKALEDGIPVIALESTVIAHGLPYPHNVETA
PSUG_THEAB       ----------------------MFISEKVQKALEENKPIVALESTVIAHGLPYPENLKVA
                                                        :.:*: :. :*:         

PSUG_ECOLI       IEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGRE-GHN-VTKVSRRDLPFVVAAG
PSUG2_PHOLL      LQVEQKIRENGAVPATIAVINGMMKAGLSHEEIAFLARK-GDE-ITKVSRRDLPFVIAAG
PSUG_HAHCH       LQVEQIVRDNGAVPATIAIIKGRLKVGLSKEEIEYLGKA-GLN-VTKASRRDIPFIIARG
PSUG_CLOBL       LNVEKIIRDKGAIPATIAILNGKLKVGLTKDEIEYLGKK-GKE-VVKTSRRDIPFILAKK
PSUG_ALKMQ       KKVEDMIREGGAVPATIAIVKGKIKVGLTEEELMFLGQ--SKD-VVKASRRDLPLIIAKE
PSUG_BRAHW       LNSEKNIRENNAVPATIAIIKGRIKVGLNKEELEYMGS--NKN-IAKSSRRDLPVMLALK
PSUG_PETMO       KNVEETIRERGAVPATIAIIDGKMKVGLSKEELEFMAT--SKN-ILKASRMDLPVILAKG
PSUG_CALS4       RALEEIVRENGAVPATIAIIGGKIKIGLNEEELEFMGT--SKE-ILKASKRDLPVVLAKG
PSUG_MYCAP       LNVENIIRKQGAVPATIAIINGIIHVGLENDEINELAK--LKD-VIKTSKRDFGYVLANK
PSUG_ACHLI       LNVEKIVEQNGAIPATIAIIDGRIKVGLNPNELTSLGK--LSN-VLKVSKRDIPYCVIKK
PSUG_GEOKA       KDVERIIRDRGAVPATIAIFNEKIKIGLTEGELEQLGT--SHD-VEKVSRRDLPYVVAMK
PSUG_CUPPJ       HEVEALILELGAEPATIALIDGRIRVGLSDDELERLGR--SGK-AHKVSRRDLPAVLTSG
PSUG_LYSSC       REVEQIIRDNGAVPATIALIDGKIKIGLSDEELEMFGN--AQG-VAKASRRDLGYLLATK
PSUG_HAEPS       REVEQIIRDNGAVPATIAIIDGKIRIGLSDDELELFGS--SKG-IAKVSRRDLPQIIASK
PSUG_STAAW       TTVEQIIRNNGAIPATIAIIDGKIKIGLESEDLEILAT--SKD-VAKVSRRDLAEVVAMK
PSUG_BREBN       KEVEQIIRDNGAVPATIGIMDGKIKIGLTDSELEEFAT--NKN-VAKVSRRDFAYILASG
PSUG_SORC5       RRVEAVVRRNGAVPATIAIMDGKLRVGVKGEDLERLARG-GGK-AAKASRRDVAALLVLG
PSUG2_RHIL3      LGVETVIRENGAIPATIAVVKGELRVGLEHDELEELAQS-KG--IVKASGRDLAVAMIRG
PSUG_LEGPH       IEVENIIRRQGAIPATIAMHQGKIRVGLTQEVMEHLALQ-KE--VIKASRRDISFVLSRK
PSUG_SOLUE       RSLESQVRAGGAVPATIAVIGGVICVGLSDKELEWLAG--AKN-VLKLSRNDLPYAIATQ
PSUG_METNO       RAVAAVVRANGAVPAIVAVVAGRIRIGLPEEILDWLGT--AKE-VLKLSRADLPHAVAAG
PSUG_JANSC       RAVEAEVRAAGAVPATIAIMDGRMHIGLTGTELEVLAQ--ADG-VAKLSRADLAACLARG
PSUG_ROSDO       RQVEDDLRAAGVTPATIAVMDGTLHIGLEAHQLEALAQ--AKG-VAKLSRADIAACMATG
PSUG_PARDP       QQVEAAVREEGAVPATIAVMGGRIRVGLDAEALEALASTPAEQ-VMKLSRADLAACLALG
PSUG_RHILO       ANVEKIISDGGAVPATIAVIGGRIKIGLSDGERESLAM--TGD-AMKLSRADLGFAVAQG
PSUG1_RHIL3      RSVEAIIREQGAVPATIAVIHGTLHIGLEAAELEQLAK--ATE-VMKVSRADLAFAIAER
PSUG_DINSH       KAVEEEIRARGAIPATIAVLDGVLKIGLGADELEALAK--VKD-ALKISRADIGYAISQG
PSUG_NOCSJ       TEVEGIIRAAGAVPATIAVLEGRPRIGLTADDLELLAS--DED-VAKVSVRDLPFVVARR
PSUG_DEIRA       RGVEQIVRDNGAVPATIAVLGGRLKVGLSADELELLAT--DKA-VQKISTRDLPVTVALG
PSUG_RHOCS       QAIEAAVRANGAVPATIAVLDGRIRVGLDAEDMQRLAA---PG-TAKVSRRDLPLVLAKG
PSUG_SYMTH       REVEEIVRSQGAVPATIAVIGGRCKVGLTDEELELLAT--SPE-AVKVSLRDLPVVLARK
PSUG_COPPD       LEVEQVIKEAGAVPATIGVINGIIKVGLSEEEITYLSQ--AKD-LHKISLKDLSVAAAKK
PSUG_RUBXD       RALEEAVRREGAVPATVGVVGGVARVGLGPEELELLAS---GE-VPKLSARDLPAAAATG
PSUG_SALTO       REIEQTVRDAGAVPATIGMVAGQLVVGLDDAELTRLATV--DD-VAKLSVRDLAVAAATD
PSUG_STRGG       RELEGLVRSAGAVPATVAVLDGRARIGLDGDQLERVAGD--PA-VRKLGHRDLAPALAAG
PSUG_FRAAA       VELEELARARGVTPATIAVIDGVPRVGLDEPDLRRIADD--AN-VIKLSVRDLPVACATG
PSUG_SACEN       RDAERQLRDAGVVPATIGVVAGTPTVGLTGEQIEELAAD--EA-AVKISTRDLPVAVARG
PSUG_HERA2       LQLEATVRAGGAVPATIAVIQGQVHVGLTNEQIEHFATATD---VLKLSRRDIGYAVAAG
PSUG_ROSS1       LAMEQEVRDQGAVPATVGIVAGVPTVGMDAAAIRRFAHPDPHHPPLKVSRRDIGYVVAAG
PSUG_CHLSY       EGLEAEVRAAGAVPATIGLIEGVPVIGLNGNELERLAVGGDR--VRKLSRRDIGAAIVDH
PSUG_MYXXD       RACEEAIRRAGAVPAATAIIDGQLCVGLEEPEMRRLAEGKER--LLKVASRDFAVAMATR
PSUG_ANAD2       RRCAAAVRAAGAVPAAVAVVAGAVVVGADDAALERLADPARR--PAKASARDLAALCAAG
PSUG_GEMAT       RRMTEAVTAVGAIPVITAISRGTPTLGLDDEDLERFLQ-RDG--VRKVSARDLGIAMADG
PSUG1_PHOLL      KNVEQAVRESGAIPATIGIDKGEFLIGMSDEQIEKFATASHV---PKVTSRDIPVVLASG
PSUG_SERP5       LAVEAAVRRSGAVPATIGICDGEILVGMHREQIERFATTPGI---AKVSSNNLPFVLAQK
PSUG_DICC1       QKIEAVVRAEGAIPATIGIENGRFLIGMSDADIERFGATNGI---PKASSRDIPVILAQG
PSUG_CORA7       NACDEIIRSNGVVPALTFIRDKRICIGASPKDVELLTDDPKP---IKVSARDIALCIAQG
PSUG_THET2       LALEEAVREEGATPKTIALVRGEVRVGLSPEEMEALAA----GGAEKASLWNLAALLAQG
PSUG_THEMA       RRAKEISREKGFQLAVIGILKGKIVAGMSEEELEAMMR----EGADKVGTREIPIVVAEG
PSUG_THESQ       RRAKEISREKGFQLAVIGILKGKIVAGMSEEELEAMMR----EGADKVGTREIPIVVAEG
PSUG_THEP1       RRAKEISREKGFQLVVIGILKGKIIVGMSEEELETMMR----EGADKIGTREIPIAVAKG
PSUG_THENN       RKAKKISEEMGFQLAVVGVLKGKIILGMNEDELTIMMN----EGSEKIGTREIPIALAKG
PSUG_KOSOT       VSMENKVKEKGAIPKTLGIINGEIKIGLTEKEIEHLAKA---KNVMKIGTAEIAAAIALR
PSUG_PSELT       VELEELAAETGCSAKTIGIIAGQIKVGLSREEIVQIASR---KDVLKIGTAEIPFALAKK
PSUG_FERNB       KMLEEMALENGVVPATIGILKGEIIVGMSQEQINEMLA----DEPLKIGTREIPYAVGMK
PSUG_THEAB       QEFEDIVYENGCVPATIGILKGKVIVGLSKEQLIELVD----DNPIKVGTREISYAIAMK
                           .       :       *        .          *    :.       

PSUG_ECOLI       KNGATTVASTMIIAALAGIKVFATGGIGGVHR-----GAEHTFDISADLQELANTNVTVV
PSUG2_PHOLL      KNGATTVASTMIIAAMAGIRIFATGGIGGVHR-----GAEQTFDISADLQELAKTSVAVV
PSUG_HAHCH       GDGATTVASTMILAAMAGVKVFATGGIGGVHR-----GAQETFDISADLQELAHTNVAVI
PSUG_CLOBL       LDGATTVASTMIVANLAGIKVFGTGGIGGVHR-----GAQESFDISADLQELANTNVAVV
PSUG_ALKMQ       LNGATTVASTMIIAALAGIKVFVTGGIGGVHR-----GAQETLDISADLMELAQTNVAVV
PSUG_BRAHW       KDGATTVTTTMIGASLAGIKVFATGGIGGVHR-----YAQETFDISADLQELSKTNVAVV
PSUG_PETMO       FNAATTVAATMIIAELAGIKVFVTGGIGGVHR-----NAQETFDISADLQELAKTNVAVI
PSUG_CALS4       LNAATTVSATMICANLAGIKVFVTGGIGGVHR-----GAEETFDISADLQELANTNVAVV
PSUG_MYCAP       KNGGTTVSGTVLVAQKVGIPVFATGGIGGVHR-----GAEITFDISRDLDELSTNNVLVV
PSUG_ACHLI       YSGATTVSATILIADMVGIKVFATGGIGGVHK-----DAAATFDISRDLEEISEKQVAVV
PSUG_GEOKA       KHGATTVAGTMICAEMAGIRVFATGGIGGVHR-----GAEQTMDISADLQELARTNVAVV
PSUG_CUPPJ       ELGATTVAGTMICAALAGIEVFVTGGIGGVHR-----GAQETFDISADLQELARTSVAVV
PSUG_LYSSC       KLGATTVAATMICAELAGIEIFVTGGIGGVHR-----GAETTMDVSADLEELAQTNVAVI
PSUG_HAEPS       KLGATTVASTMICAHLAGIKFFVTGGLGGVHK-----GWETTLDISADLDELAQTSVTVI
PSUG_STAAW       CVGATTVATTMICAAMAGIQFFVTGGIGGVHK-----GAEHTMDISADLEELSKTNVTVI
PSUG_BREBN       KIGATTVAATMIAAEMAGIHMFATGGIGGVHR-----EGEITWDVSADLTELAQTDVAVV
PSUG_SORC5       GMAGTTVATTMMAAAWAGIQVFATGGIGGVHR-----GAETTFDISADLEELSQTQVAVV
PSUG2_RHIL3      QSAGTTVSATMLMADLAGIDVFATGGVGGVHR-----GAEQTFDISADLTELGRTKTAVV
PSUG_LEGPH       VTASTTVAATMFCAHMAKLPLFVTGGIGGVHQ-----DVTMSFDISADLIELSNTPVTVV
PSUG_SOLUE       KIGATTVAATMIAANLAGIRIFATGGIGGVHR-----GAETTFDISADLEEFARTSVAVV
PSUG_METNO       LHGSTTVAATMICAHRAGIRVFATGGIGGVHR-----GVEETLDISADLDELARTPVAVV
PSUG_JANSC       GVGATTVAATMICAALAGIHVFATGGIGGVHK-----GAEDTFDISADLRELAHTPVTVI
PSUG_ROSDO       GTGATTVSATMIAAHLAGISVFATGGIGGVHR-----GAESSFDVSADLLELAQTPVTVV
PSUG_PARDP       RTGATTVAATMICAHLAGIEVFATGGIGGVHR-----GAETSFDISADLQELAQSPVTVV
PSUG_RHILO       RTGGTTVAATMIAAEMVGIKVFATGGIGGVHK-----GAEKSFDISADLDELARTPVIVV
PSUG1_RHIL3      RTGATTVAATMIAAARAGIRVFATGGIGGVHR-----GAEESFDISADLEELARTGVIVV
PSUG_DINSH       KSAGTTVAATMIVAQMAGIRVFATGGIGGVHK-----GVETSFDISADLTELGRTDVIVV
PSUG_NOCSJ       SHGATTVAATMRLAALAGIRVFVTGGLGGVHR-----GAQQSFDESADLTELGSTDVAVI
PSUG_DEIRA       GHGATTVASTMRIAALAGIRVFATGGTGGVHR-----GAGETMDISADLLELARTDVCVV
PSUG_RHOCS       ADGATTVAATMIAADLAGIAVFATGGIGGVHR-----GVETTGDISADLEELATTSVAVV
PSUG_SYMTH       SLGATTVATTATIAAAAGIEVFVTGGIGGVHRKSPG-DPAQMWDVSADLTVLGRTDITVV
PSUG_COPPD       LSGGTTVSATMFASYKAGIQVFATGGIGGVHR-----DARESFDVSTDLEALGSIPITVV
PSUG_RUBXD       SSGATTVAATAHLAALCGIKLFATGGLGGVHR-----GARESWDVSADLAALSRAPVAVV
PSUG_SALTO       ADGATTVAATSAVAAAAGIRVFATGGLGGVHR-----EAAQSFDESADLTTLARTPIAVV
PSUG_STRGG       ADGATTVSATAFLAARAGIGVFATGGLGGVHR-----EWAENQDESADLRLLARTGITVV
PSUG_FRAAA       WTGATTVASTALLAARVGIRLFATGGLGGVHR-----GAGDSFDESADLVTLAAMPITVV
PSUG_SACEN       ASGGTTVAATAFLARKAGIRVFATGGLGGVHH-----GAATTFDESADLVTLASTPLVLV
PSUG_HERA2       RDGATTVAATMAIAELAGIQVFATGGIGGVHRGA-----RDTWDVSADLGELGKSSVLVV
PSUG_ROSS1       GDGATTVAATMALAHLAGVQVFATGGIGGVHRGA-----RETWDVSADLTELERTPVLVV
PSUG_CHLSY       ADGATTVAATMALAAAAGIEVFATGGIGGVHRGA-----THSWDVSADLTELGRTPVLVV
PSUG_MYXXD       ATGGTTVSATCEMAAAAGIRVFSTGGIGGVHRGA-----SEHFDISQDIAALARFPVAVV
PSUG_ANAD2       RDAGTTVAATAAVAALAGIRVFATGGIGGVHRLAPGEPAAGAADVSADLAELARAPVCVV
PSUG_GEMAT       ADGATTVAATLALCALGGLEVFATGGIGGVHRDA-------PFDESADLIELSRTPVIVV
PSUG1_PHOLL      GMGATTVASSILAAEIAGIKFFCSAGIGGVHRGA-----ETSMDISADLTQLTRSRVAVV
PSUG_SERP5       SMGATTVASSLMLAELAGIGFFASAGIGGVHRGG-----EDSMDISSDLIQFTRTNVTVV
PSUG_DICC1       GKGATTVASSLVAADLAGIPFFASAGIGGVHRGA-----EKSMDISADLVQFTRSRVAVV
PSUG_CORA7       KVGATTASASIAICELAGIRIFSTAGLGGVHRDF-----SETLDVSADLHEISSRKTIVV
PSUG_THET2       RSAGTTVAATVHLAHLHGIPVFATGGIGGVHP--------EPYDESADLVALSRTPILVV
PSUG_THEMA       KNAATTVSATIFLSRRIGIEVVVTGGTGGVHP--------GRVDVSQDLTEMSSSRAVLV
PSUG_THESQ       KNAATTVSATIFLSRRIGIEVVVTGGTGGVHP--------GRVDVSQDLTEMSSSRAILV
PSUG_THEP1       KNAATTVSATIFLSRRIGIEVVVTGGTGGVHP--------GRVDVSQDLTEMASSRTILV
PSUG_THENN       MNAATTVSATIFLCKRFGIDVVVTGGTGGVHP--------GGVDISQDLTEMASSRIILV
PSUG_KOSOT       RNAATTVSATMRLAKNAGIDVFATGGIGGVHRN-------VPWDVSQDIMELSKTRMIVV
PSUG_PSELT       MWAATTVSATMRIAHLNNIKVFATGGIGGVHKI-------DQWDVSQDLAELSRTRMIVV
PSUG_FERNB       KSAATTVSATMRIAKIAGIDVFATGGIGGVHI--------GDWDVSQDITEMAKSDVIVV
PSUG_THEAB       KSAATTVSSTAKIASLAGIKVFATGGIGGVHR--------GEWDVSQDIIELSKTNIIVV
                   ..**.: :   .    : .. :.* ****            * * *:  :      ::

PSUG_ECOLI       CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV
PSUG2_PHOLL      CAGAKSILDLGLTTEYLETHGVPLIGYQTHALPAFFCRTSPFSVNIRLDSPEQIAQAMAV
PSUG_HAHCH       CAGAKSILDLGLTREYLETHGVPLVGYQTSTLPAFYTRDSDFDVDYQLDTPEQIAQALQA
PSUG_CLOBL       CAGAKSILDIGLTLEYLETQGVPVVGFGTEELPAFYTRKSGFKVDYRVDTAKELAEALKA
PSUG_ALKMQ       CAGVKSILDIGLTLEVLETHGVPIVGYQTEDFPAFYTRKSGYGVDYAVANVEELARALKA
PSUG_BRAHW       CAGAKSILDIGLTIEYLETFGIPVLGYKTENFPAFYTRESGYKVDYKIDTTKDIANILDT
PSUG_PETMO       SAGPKAILDLQLTKEYLETFGVPVIGYQTDELPCFFSRESGINVPYRVETPKEIASIMKT
PSUG_CALS4       CAGAKAILDLPRTLEYLETFGVPVIGFRTEEFPAFYTRESGLKVDYRVEDEVEAAKVIKT
PSUG_MYCAP       CAGAKLILDLGLTLEYLETKGVEVLGYNSDKLPAFYSSSSEFNVTYNVHSASEVAAIMKA
PSUG_ACHLI       SAGAKAILDLDLTLEYLETKGVEVIGYKTSEFPAFFSNASGLNTTFQLDEASQIAQLMYT
PSUG_GEOKA       CAGAKSILDLGLTLEYLETHGVPVIGYQTDVLPAFYSRTSPFRVDYRLDSAKEIAQFLET
PSUG_CUPPJ       CAGAKSILDIGLTLEYLETQGVPVLTCEQENFAAFYKRDSGFRADYRLDDPAEQARFIRT
PSUG_LYSSC       CAGAKSILDIGLTLEYLETKGVPVVGYGTDELPAFYTRQSGFDVNFQLDTPEEIAEMLSA
PSUG_HAEPS       CAGAKSILDLDATLEYLETKGVPVVGYKTKNLPAFFTRDSGLPLALSCEELTEIAEMIKV
PSUG_STAAW       CAGAKSILDLPKTMEYLETKGVPVIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLT
PSUG_BREBN       CAGAKSILDIGRTLEYLETQGVPVVGYRTDEFPSFFARKSGFGVDMRIDTPEEVGKMMNT
PSUG_SORC5       CAGAKSILDIPKTLETLETHGVPVLGYKTEDFPAFWARQSGQKVDHRIESAEEAARVIAL
PSUG2_RHIL3      CAGVKSILDIAKTLEYLETQRVPVIAYGTEDFPAFFTRRSGFKADHRLDTPEEIAKAMWL
PSUG_LEGPH       CSGAKSILDLPKTLEVLETFGVPVIGYATDEFPAFYSRSSGIPVPQRLNSAEEVANLMSI
PSUG_SOLUE       CAGAKAILDLPKTLEYLETRGVPVIAYGTDEFPAFWSRQSGLKAPLRLDTPAEIARFLEV
PSUG_METNO       CAGAKAILDLPRTLEYLETRGVPVVGYRTDRFPAFWSRDSGLPAPLRLDTPEAIAALMRT
PSUG_JANSC       AAGAKAILDLPKTLEVLETLGVPVIAHGQDAFPAFWSRDSGLPAPLRADSATEIARAHLM
PSUG_ROSDO       AAGAKAILDVAKTLEVLETQGVPVITVGQDSFPAFWSAESVFKSPLRMDDPVGIAAAHQM
PSUG_PARDP       AAGAKAILDLPKTLEVLETLGVPVIAFGQDQLPAFWSRESGLAAPLRMDDPAQIAASARL
PSUG_RHILO       SAGAKAILDIEKTLEVLETRGVPVVGHGCETMPAFWSRQSPFRAPLTLYKPEEIAHFFRT
PSUG1_RHIL3      CAGAKAILDIPKTLEVLETRGVPVVTYESEEFPAFWSRSSGIRSPLSLNSPAAIANFQTV
PSUG_DINSH       AAGAKAILDVPKTLEVLETQGVSVVGYRTDTLPAFWTSGSDLDIPLRLDSAAEISEFQKV
PSUG_NOCSJ       SAGVKSILDIGLTLERLETLGVPVLAYGSDEFPSFYSRSSGHAAPMRVDSAAEVAAVMAA
PSUG_DEIRA       SAGVKSILDIGLTLEVLETQGVPAITLGADEFPAFYSRRSGFSSPLTVQTPAEAARVLKV
PSUG_RHOCS       CAGAKAILDLPRTLEYLETRGVPVVGFGTDAFPAFYHRDSGLPVDGRCDTPEDAARVLNA
PSUG_SYMTH       CAGAKSVLDIGATLEVLETLGVTVLGYRTDRFPGFYTRDTGFGVDARVDTPEEAAAVIHA
PSUG_COPPD       CAGAKAILDLPATLEYLETKGVLVVGYKTDEFPAFYYGRSGLKLEHSVTTPGELAQIIRE
PSUG_RUBXD       CSGVKSILDVPATLEQLETLGVPVVGFRSRSFAGFYLTDSGCALDWSVEDEGEAAALIRA
PSUG_SALTO       CAGVKSILDSGATLERLETLGVGVVGYRTRRFPGFYLTDGGFDLDWSVDSPEQVAAALAA
PSUG_STRGG       CAGVKSILDVPATLQRLETLGVPVVGYGTGHFPGFYLSSSGEPVDWTVHSPEEVAEVIRA
PSUG_FRAAA       SAGVKSILDIGATLERLETLGITVVGYRTSTFPGFYLPHTTYDLDWRVGDAGQVAATMAA
PSUG_SACEN       SAGAKSILDLAATLERLETLNIPVVGYRTRRFPGFYVADSGHDLEHSVDTPQEVAALVEA
PSUG_HERA2       CAGAKSILDLPATLEVLETYGVPVVGYTTEELPAFYSAHSGLQLGRRVDDPTQAAAAWAA
PSUG_ROSS1       CAGAKAILDLPATLEYLETGGVPVLGWRTAEFPAFYSVSSGLPVAY-AQDASFVARAWKA
PSUG_CHLSY       CAGAKAILDLPATLEYLETQGVPVVGYQTVEFPAFYTPHSGLTVAAVAADALAAARMWRI
PSUG_MYXXD       CAGAKSVLDLPKTMELLETAGVPVIGVGTDELPSFYSRGSGIPLEHRADDVDTAARIARA
PSUG_ANAD2       SAGPKAILDLAATAEALETLGVPVLGWRTSELPAFYSDGSGIALEHRVEDAAAAARVLRL
PSUG_GEMAT       CAGAKSILDLPATLERLETLGVPVVGCGTDELPGFFSLSTGLRLTSRLDRPEQIARAWRA
PSUG1_PHOLL      CAGAKNILDIGLTLEFLETWNVPVISYQSDDFPAFYCRSSGFKSPQRLDELAVIAKAIEI
PSUG_SERP5       CAGAKNILDIGRTLEFLETQCVPVVTYQTDDFPAFYCRSSGYRSPQRLDSLEAIAQAIDI
PSUG_DICC1       CAGAKSILDLGLTLEYLETQCVPIISYQSDDFPAFYCRSSGFPSPHRLDDPAVVARSIEM
PSUG_CORA7       SAGVKKFLDIPKTSEVLESLGVPVVGFGTSEFPAFYCRKSGAFLESFSQDPIEIATAAAT
PSUG_THET2       SSGPKAILDLRATLERLETLGVSVVGYRTDRLPAFFSPDSPFPVPARVDTPMEAARVYLR
PSUG_THEMA       SSGIKSILDVEATFEMLETLEIPLVGFRTNEFPLFFSRKSG-RRVPRIENVEEVLKIYES
PSUG_THESQ       SSGIKSILDVEATFEMLETLEIPLIGFRTDEFPLFFSRKSG-RRVPRVENVEEVLKIYET
PSUG_THEP1       SSGIKSILDVEATFEMLETLEIPLVGFKTDEFPLFFSRKSG-RRVPRVESVEEVLKIYET
PSUG_THENN       SSGIKSILDVDATFEMLETLEIPVVGFMTDEFPLFFSRKSG-KKVKRVENVEEILRIYRT
PSUG_KOSOT       CAGFKSILDVERTIEFLETFQVTVVGYQTDYMPLFHTKESEYKVNIRADSPEEIVAIFNE
PSUG_PSELT       SAGPKSILDLRSTVEMLETFQITVVGYKTDELPAFYCKSTSIHIN-RVDSFEEIASIFLF
PSUG_FERNB       SAGCKSILDVKKTIEFLETFQVTVVGYKTNKFPIFYEGLSDFNLEHRVDSPEDIAKIFRA
PSUG_THEAB       SAGCKSILDIKKTLEFLETFQVLTVGYKTEYFPIFYNRLSK-EKIYKVENADEIANIFNE
                 .:* * .**   * : **:  :  :      :. *                         

PSUG_ECOLI       KWQSGLNGG---LVVANPIPEQFAMPEHTINAAIDQAVAEAEAQGVIGKESTPFLLARVA
PSUG2_PHOLL      KWDTGLQGG---LVVANPIPEPYAMPEAEISAAIEQAVRESIEQRVNGKACTPFLLARVS
PSUG_HAHCH       KWEMGLQGG---VVIANPIPEAYAMDRGKIDAAISAALAEMDDKGVSGKDSTPFLLAKVA
PSUG_CLOBL       KWDLGLKGG---MVVGNPIPEEYQMDYDTITKAINDAVKEAEEKGIKGKESTPFLLAKVK
PSUG_ALKMQ       KWDLDLKGG---VVVANPIPEAYAMDEALITQAIDEAVQEAAAKGIQGKETTPFLLTKIK
PSUG_BRAHW       KWKLGLNGG---VLVCNPIPEEYEMDKDYINKIIDETVKEARDKNISGKDVTPYILAKLH
PSUG_PETMO       KWDLGLQGG---IFIANPIPKEYSLDFEEIDKTIENAIEEAKKRKIKGKELTPFLLSKIN
PSUG_CALS4       KWDLGLKGG---ILIANPIPEEYALDRAYIEKAIEEAIFEADRRGIRGKALTPFLLEKIK
PSUG_MYCAP       KWKF-TNGG---IILANPIPEQYGLEYEYILDNINKAIEQAKVEGISGKKTTPYLLSKVL
PSUG_ACHLI       KWNMGLSGG---IVVANPIPQNYAIDKDSLDKAISSAILSAKDNKITGKELTPYLLKMLH
PSUG_GEOKA       KWKLGLNGG---VVIANPVPKEEELEESYITAIIEQALKEAEKQHITGKSVTPFLLDRVK
PSUG_CUPPJ       KWDLGLAGG---VLLSTPVPEAAAMASEEIDALTQQALDEAQAQGITGKAVTPFLLARIK
PSUG_LYSSC       KWQLGLKGG---AVIANPIPEAEALEHGFITNIIEKALVEAEENGIQGKNVTPFLLGKVK
PSUG_HAEPS       KWQLGLEGG---VVVANPIPQEDELAPSYINGIIDTAVKEAEEKGIIGKDITPFLLGKIV
PSUG_STAAW       KQQLNLEGG---IVVANPIPYEHALSKAYIEAIINEAVVEAENQGIKGKDATPFLLGKIV
PSUG_BREBN       KWDLGLKGG---MIIANPVPESDALNHEEIEAVIQKALAEAKENNIAGKQVTPFMLDKVK
PSUG_SORC5       QFELGMG-G---VLVANPIPESHAMDARAIEARIEEAIRCAEAEGVSRKDLTPFLLKRIF
PSUG2_RHIL3      HHQLGTGTG---LLIANPIPEASALAPDFIDGTIADAVRDADERGIDRKELTPFLLARIN
PSUG_LEGPH       QQKLNMKNG---IVVANPIPVSAELSDEEISPYIKQA--HDEAKHMSGKSLTPFLLKRIA
PSUG_SOLUE       KWSLNLTGG---AVICNPVPAEDEIPFHEMRTFIDSAVDEAERYGIKGKAVTPYILARIV
PSUG_METNO       KEALDLGGG---ILVANPVPEADEIPAREIAALIATAVAQARAAGIAGKAVTPFLLSRLL
PSUG_JANSC       RSKLGLPGG---QLVANPIPEDAEIPASTLAPLIVQAQSEADAKGVARKAVTPFLLNRLF
PSUG_ROSDO       RVDLGLPGG---QLVANPIPHTDEIPATELAPIIATAQADAEKHGIKGKAVTPYLLQRIY
PSUG_PARDP       RRELGLSGG---QLVVNPIPPEAEIPRAEMIPVVEQALSEAEAQGIAAKAVTPFLLQRIF
PSUG_RHILO       RVALGLGGG---VLVANPVPENHEIPAEEMAGYIEAAQKAAEALNVTGKAVTPFLLGKIL
PSUG1_RHIL3      REQLGIDGG---MLVANPVPEADEIASEEMEIYIERALDSAERDEVTGKAVTPYLLSTIF
PSUG_DINSH       RDALRLGGG---MLVANPIPAGDEIPAEIINGYIATAQAEMAAQSISGKAVTPFLLQRIF
PSUG_NOCSJ       KWDLGIAGG---VVVANPIPEADEIPADEIGGIIEQALADMAARGIHGNEATPYLLGRIV
PSUG_DEIRA       KWDLGLTGG---VLLANPVPETAEIPAEEMETHITRALADMAALGLSGKDTTPYLLGRIV
PSUG_RHOCS       KWRLGLAGG---IVVAVPIPDEAALDAAQAEAAVQQAVAEAATGGVRGKALTPFLLHRLE
PSUG_SYMTH       RQQTMLPGG---VLVVNPVPEEHAMDPDEVERHIADALKAMAAEGVTGKAVTPYLLARLK
PSUG_COPPD       RDALEINKA---ILVGNPPPEEMALEKGKVEQLIEAALQQAKVNNIKGKDVTPFLLDYLA
PSUG_RUBXD       LPGLGLGCG---VVISNPLPPEEQLDPSLHERALRSGLEELARRGISGKEVTPFLLEHFR
PSUG_SALTO       QEQHGLHSGG--LVVANPLPTDEQLDPALHDRTLAEGLMLLRREGVTGKAVTPFLLAHFH
PSUG_STRGG       REALGGPVGA--LIVANPVAERDQLDPVLHDRVLAQALDACRERGISGQGVTPFLLDQLT
PSUG_FRAAA       ADLLGLTSA---IVVANPLPTDQALDPALHDRVLADALAWATERGIRGKAVTPFLLETFH
PSUG_SACEN       RDALELRSA---LLVANPIPPERQLDPELHRRVLAEAWEEAERQGISGHDSTPFLLDHIR
PSUG_HERA2       HR---LYGGGSGMVLAVPPPVEKALDPQFVEAAIGRAIAQAEAAGIRGAAVTPFLLSAMA
PSUG_ROSS1       HR---ALGG-AGMVLAVPPPVEDAIDRAVVEAAIERALNRAVKEGVHGPAVTPFLLAALA
PSUG_CHLSY       QRRYHTFAAPGGMLLCVPPPERHALEREAVEAAIGRALARAEAEGVRGPAVTPFLLAAMA
PSUG_MYXXD       RF--ESLKQG-GVLYTVPPPEETSLPRNEVELHIAATLADADRQGIRGKAVTPFLLSEMA
PSUG_ANAD2       HW--DALGRREGVLLAVPPPE--AVPREVVEAAIAAALEDARGRGIRGKAVTPFLLEAVS
PSUG_GEMAT       H---RALGRESAMLVVQPPPADVAIPADIVDAATRAALQAASLAGIRGAAVTPYLLAQIQ
PSUG1_PHOLL      NW---MLPGGKGVLITTPTKPEDALDNQKIDIIIQEAVLEAKKKNIVGNSLTKYLMRMVD
PSUG_SERP5       NR---ALPGSAAMVVAAPTKPEDAIDSRDVQAAIQAAIENAAAKGVTGSQVTKFIMKAVE
PSUG_DICC1       HW---KLGNRSSVLITHPIHENDAIDKDEVESIIREAALQAEHEGIRGPGATPYLMRAVA
PSUG_CORA7       HI---ETVGPGGFLILVAPSKEIALDDELVEKAVQRSLINASSQGVRGKAITKFVMRAID
PSUG_THET2       ARALGLGGV----LLVNPVSQ--GLPYEQVALWVEEAGRMAAREGVFGKALTPYLLRKLS
PSUG_THEMA       MKEMELEKT---LMVLNPVPEEYEIPHDEIERLLEKIELEVE-----GKEVTPFLLKKLV
PSUG_THESQ       MKEIELEKT---LMVLNPVPEEYEVPHDEIERLLEKIELEVE-----GKEVTPFLLKKLV
PSUG_THEP1       MREIGFEKT---LMVLNPVPEEYEVPHDEIERLLEKIELEAE-----GKEVTPFLLKKLA
PSUG_THENN       MEELKLEKT---LMVLNPVPEEHEVPREEIEHLLENIELKVE-----GKDVTPYLLRKLV
PSUG_KOSOT       KEKLGIEGA---ILVANPIPEQSEIPREELEEYIKKAVAQAKENGISGKSLTPFLLSRLT
PSUG_PSELT       KEKFNLPGA---VLVFNPIPDEHAIEVEQFEEWYRLSEHDLDASSVKGKGVTPFLLSRLA
PSUG_FERNB       KKSLGIEGA---LLVANPIPQEFVISEQEVDGYMKQALSECFEKGITGKAVTPYLLSRIA
PSUG_THEAB       KNKLKLESA---ILVANPIPEDYVLDNNEIEGYIKTIEKEIAEKDIHGKEVTPYMLKRLV
                              .   .      :                          * :::  . 

PSUG_ECOLI       ELTGGDSLKSNIQLVFNNAILASEIAKEYQRLAG--------------------------
PSUG2_PHOLL      ELTGGNSLSSNIQLVLNNAELAAKIACCYWERHM--------------------------
PSUG_HAHCH       EITGGDSLKANIQLVFNNAALAARIAASYYA-----------------------------
PSUG_CLOBL       DITKGKSLEANIQLVYNNVAVASDLAIELSKLNK--------------------------
PSUG_ALKMQ       EITEGKSLESNIELVFNNAKIGAELAVALHRLS---------------------------
PSUG_BRAHW       SVTENKSLKANKELVYNNCRVAANIAYDYSNLSR--------------------------
PSUG_PETMO       ELTKGESLKANIELVYNNAQLGAEIAKEFNILS---------------------------
PSUG_CALS4       DLTEGKSLKANIELVKNNARVGAKIAVQLNKLYKEA------------------------
PSUG_MYCAP       ELTEGKSLEANIQLVYNNAKVAAQVAVEYAKQK---------------------------
PSUG_ACHLI       SNKDITSLESNIGLIYNNAKIAALIAVEFSKL----------------------------
PSUG_GEOKA       TLTGGKSLQANIALVKNNAALAADLARELS------------------------------
PSUG_CUPPJ       ALTGGRSLATNIALVKHNAEVGARLALALAQAARGAVA----------------------
PSUG_LYSSC       ELTEGKSLDANIALVKNNAVVGAKIAVAFNQLH---------------------------
PSUG_HAEPS       EMTEGKSLEANIKLVKNNAKVGARLAVEFFK-----------------------------
PSUG_STAAW       EKTNGKSLAANIKLVENNAALGAKIAVAVNKLL---------------------------
PSUG_BREBN       KLTEGKSLATNIALVKHNAEVAAKIAVAYQKEANQGK-----------------------
PSUG_SORC5       ELTEGKSLIANIALVENNAAVAAEIATAMSELGAKSKSKSKAKA----------------
PSUG2_RHIL3      ELTKGESLKANIELVKNNARLAARIAVAYAPLKKARN-----------------------
PSUG_LEGPH       ELTAGKSLEANIELIKNNAFLGAEIAIAYQKKLFSKKT----------------------
PSUG_SOLUE       ELTGGRSLRTNMALAQNNARLAAELATHLQ------------------------------
PSUG_METNO       DLTGGRSLSTNIALVKNNAALAAQLAVALRGARSSGPQAGAGAPGAEPGPARRTSPARAP
PSUG_JANSC       ELTDGATLASNIALVLNNARLGAAVARALTT-----------------------------
PSUG_ROSDO       ELTQGRSLTANIALVRNNARLAGAIAQALIANARIAGK----------------------
PSUG_PARDP       ELTQGRSLDANIALVLNNARLAARIAAAMAT-----------------------------
PSUG_RHILO       ELTGGRSLKTNIALVENNARLAAEIAKAL-------------------------------
PSUG1_RHIL3      DLTDGQSLKTNIALVENNARLAAEIAVALGE-----------------------------
PSUG_DINSH       ELSEGRSLRSNIALVKNNARLAADIAVALHS-----------------------------
PSUG_NOCSJ       EITGGASLTANIALVRANARLGASIAREYAGLR---------------------------
PSUG_DEIRA       ELTGGRSLETNIALVRHNAAAAAQVAAEYARLG---------------------------
PSUG_RHOCS       TLTGGASLTANRALLLNNAAVGARIAVAYARLKQETTLPKKPPPSKRPTY----------
PSUG_SYMTH       EVTSGRALQTNIALVKHNALVGAQIAVALKAGK---------------------------
PSUG_COPPD       KNSKGETLETNIALVKNNAYVGSLIAKALMAAKI--------------------------
PSUG_RUBXD       ERTGGESLRANERLVVRNARLAARIARRLAAGR---------------------------
PSUG_SALTO       SATEGASLAVNIRIILRNADLAAQIAVASAARQA--------------------------
PSUG_STRGG       RRTEGASLEANLAAVRGNVTLAARIAVAAADAR---------------------------
PSUG_FRAAA       RETGGASLEVNINAVRNNVAVASDIALAWAAKDRSPTDPAAPDPTAPDPAAPDPTAPDPA
PSUG_SACEN       RATGDRSLEVNIDVYQNNVALGASIARAMAG-----------------------------
PSUG_HERA2       RETEGESIATNTALLNNNAQVAAQVAVALFQSV---------------------------
PSUG_ROSS1       RETEGESVRANVALLRQNARIAAQVATAIAGI----------------------------
PSUG_CHLSY       EETSGESIETNIALLRNNTRVAAEVAVRISELG---------------------------
PSUG_MYXXD       KRTGGKTLKANLALLTNNARFAGQLAVAYARAS---------------------------
PSUG_ANAD2       RATRGRARTANLALLERNASVAGEVAVALAADAA--------------------------
PSUG_GEMAT       QRTEGRSVSANLALLEANARLAGQIAVALVEGTP--------------------------
PSUG1_PHOLL      RETDGISAKANMAVLVNTAEVAGKLAVAACLQSSTFFARIKSQ-----------------
PSUG_SERP5       QATHGRSAMANAAVLVNTAEIAGQLAMVYHRPR---------------------------
PSUG_DICC1       RATQGRTVKANMSVLISTAALAGKLACAHTDYLRQHNQA---------------------
PSUG_CORA7       SETDNRSQTANFDVMVEVVNAAAQIARSLKPEFFLDSVAKK-------------------
PSUG_THET2       ELSSGETDRVNRRLLLENARLAARVALALAGLE---------------------------
PSUG_THEMA       EMTNGRTLKANLALLEENVKLAGEIAVKLKRS----------------------------
PSUG_THESQ       EMTNGRTLKANLALLEENVKLAGEIAVKLKRS----------------------------
PSUG_THEP1       EMTNGRTLKANLALLEENVKLAGEIAMKLKR-----------------------------
PSUG_THENN       EITGGRTLKANLSLLEENVKLAGKIALALGR-----------------------------
PSUG_KOSOT       ELSGGKTLTANIALLKNNASLAGEIAVALSRGGRD-------------------------
PSUG_PSELT       HYSKGKTVRSNVELLKNNVKVACEILNQLSKMQ---------------------------
PSUG_FERNB       QLSNGKTLTSNIELLKNNVLLACQIAKSLKTMA---------------------------
PSUG_THEAB       ELSNGKTLESNIVLLKNNVELACKIAQSLKK-----------------------------
                   .   :   *          .  :                                   

PSUG_ECOLI       ----------------------------
PSUG2_PHOLL      ----------------------------
PSUG_HAHCH       ----------------------------
PSUG_CLOBL       ----------------------------
PSUG_ALKMQ       ----------------------------
PSUG_BRAHW       ----------------------------
PSUG_PETMO       ----------------------------
PSUG_CALS4       ----------------------------
PSUG_MYCAP       ----------------------------
PSUG_ACHLI       ----------------------------
PSUG_GEOKA       ----------------------------
PSUG_CUPPJ       ----------------------------
PSUG_LYSSC       ----------------------------
PSUG_HAEPS       ----------------------------
PSUG_STAAW       ----------------------------
PSUG_BREBN       ----------------------------
PSUG_SORC5       ----------------------------
PSUG2_RHIL3      ----------------------------
PSUG_LEGPH       ----------------------------
PSUG_SOLUE       ----------------------------
PSUG_METNO       SGEGW-----------------------
PSUG_JANSC       ----------------------------
PSUG_ROSDO       ----------------------------
PSUG_PARDP       ----------------------------
PSUG_RHILO       ----------------------------
PSUG1_RHIL3      ----------------------------
PSUG_DINSH       ----------------------------
PSUG_NOCSJ       ----------------------------
PSUG_DEIRA       ----------------------------
PSUG_RHOCS       ----------------------------
PSUG_SYMTH       ----------------------------
PSUG_COPPD       ----------------------------
PSUG_RUBXD       ----------------------------
PSUG_SALTO       ----------------------------
PSUG_STRGG       ----------------------------
PSUG_FRAAA       APDSAAPDLAGPDPSAPDPAAVARAHRP
PSUG_SACEN       ----------------------------
PSUG_HERA2       ----------------------------
PSUG_ROSS1       ----------------------------
PSUG_CHLSY       ----------------------------
PSUG_MYXXD       ----------------------------
PSUG_ANAD2       ----------------------------
PSUG_GEMAT       ----------------------------
PSUG1_PHOLL      ----------------------------
PSUG_SERP5       ----------------------------
PSUG_DICC1       ----------------------------
PSUG_CORA7       ----------------------------
PSUG_THET2       ----------------------------
PSUG_THEMA       ----------------------------
PSUG_THESQ       ----------------------------
PSUG_THEP1       ----------------------------
PSUG_THENN       ----------------------------
PSUG_KOSOT       ----------------------------
PSUG_PSELT       ----------------------------
PSUG_FERNB       ----------------------------
PSUG_THEAB       ----------------------------