CLUSTAL format seed alignment for MF_01877

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSMI_HELPY      -------------------------------MLYFLPTPIGNLADITLRALEVLERCEVF
RSMI_HELPJ      -------------------------------MLYFLPTPIGNLADITLRTLEVLERCEVF
RSMI_CAMFF      -------------------------------MLYFLPTPIGNLDDISKRCLDVLELCEII
RSMI_BACHD      -----------------MKTQQSYQQRDDKGTLYLVATPIGNLEDVTFRAIRTLKEADQI
RSMI_BACSU      ----------------MLRRQMSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAI
RSMI_STRP3      -----------------MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFI
RSMI_STRP8      -----------------MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFI
RSMI_STRP1      -----------------MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFI
RSMI_STRP6      -----------------MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFI
RSMI_THEMA      -----------------------------MGKLIIVGTPIGNLEDITIRALKTLREVDLI
RSMI_BUCAI      -----------------------MNEFY-IGILYIVPTPIGNLSDITYRALEVLKDVDII
RSMI_BUCAP      -----------------------MNSLNKTGLLYIVPTPIGNLSDITYRAVETLKNVNLI
RSMI_BUCBP      ---------------------MNAKNIKQTGILYIVPTPIGNLNDISYRAINILQHVDLI
RSMI_ECOLI      -------------------MKQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLI
RSMI_ECO57      -------------------MKQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLI
RSMI_HAEIN      -------------------------MTDLTGILYIVATPIGNLQDITQRALETFAQVDLI
RSMI_PASMU      -------------------------MNNLTGILYIVATPIGNLQDITQRALAIFEQVDLI
RSMI_VIBCH      -------------------MTDNKTVPNGAPILYIVPTPIGNLGDITQRALDVLASVDMI
RSMI_XYLFA      --------------------------MSTPGTLHIVATPIGNLGDLSPRAQHILRTVTMI
RSMI_XYLFT      --------------------------MSTPGTLHIVATPIGNLGDLSPRAQHILRTVTMI
RSMI_PSEAE      ---------------------------MSAGTLFVVATPIGNLDDISPRALRVLREVALV
RSMI_SYNY3      -----------------------------MGILYLVATPIGNLGDMTPRAVETLQTVDLI
RSMI_MYCTU      ---------------------------MSSGRLLLGATPLGQPSDASPRLAAALATADVV
RSMI_MYCBO      ---------------------------MSSGRLLLGATPLGQPSDASPRLAAALATADVV
RSMI_RHILO      -----------------MVGQTEIPARPLEPALYLVATPIGNLADITLRALETLAAADIV
RSMI_ERYLH      -------------------MQHDHSAEPLSPGLYIVATPIGNLGDITLRAIETLRRCDAV
RSMI_NEIMA      ---------------MFQKHLQKASDSVVGGTLYVVATPIGNLADITLRALAVLQKADII
RSMI_NEIMB      ---------------MFQKHLQKASDSVVGGTLYVVATPIGNLADITLRALAVLQKADII
RSMI_TREPA      -----------------------------MGTLYVVATPIGNLADITLRALDVLRTVDVV
RSMI_BORBP      -------------------------------MLYIVGTPIGNLEDITYRAVDVLKSVNVI
RSMI_COPPD      -------------------------------MIYLVGTPLGNLEDITLRAIRVLGEADVV
RSMI_LEPBP      -----------------------MAYKREKGLLYVVATPIGNMGDITLRAIDVLKEVDLV
RSMI_LEPBL      ------------------------MKKELQGALVLVSVSLGNFGDLTARARHLLEYCDIL
RSMI_MYCPU      -----------------------------MAKIYIVGTPIGNLSDITLRALETLKKVDYI
RSMI_MYCCR      ----------------------------MTKKITLVSTPIGNLKDISLRALDTLRDSDII
RSMI_RICPR      --------------------------MILKSGLYIVSTPIGNFEDITLRAISTLKNSDII
RSMI_HYDS0      ------------------------------MKLYVVPTPIGNLEDITIRAINILKSVKFI
RSMI_MYCGE      -----------------------------MKTLKVVATPIGNIQEISERAKKALQDCEVL
RSMI_MYCPN      -----------------------------MPALKVIATPIGNIEEVSPRVKAALTKCEVL
                                                : .  ..:*:  : : *    :     .

RSMI_HELPY      LCEDTRVSKRLLHLLAQNPIISHSFPNIATKKREFIAFHSHNDQEFLNQIKPSFFDKEIA
RSMI_HELPJ      LCEDTRVSKRLLHLLAKNPIISHSFPNIAAKKREFIAFHSHNDQEFLNQIEPSFFDKEIA
RSMI_CAMFF      ICEDTRVTKSLITLLNAKFGLQIS-------PKEFYSLHTHNEKDFFDKFDKVRLETKIC
RSMI_BACHD      AAEDTRQTKKLLNHFDI--------------ATKLVSYHEHNKETMGKRLIDDLIEGRT-
RSMI_BACSU      AAEDTRQTKKLCHVYEI--------------ETPLVSYHEHNKESSGHKIIEWLKSGKN-
RSMI_STRP3      CAEDTRNTGLLLKHFDI--------------ATKQISFHEHNAYEKIPDLIDLLISGRS-
RSMI_STRP8      CAEDTRNTGLLLKHFDI--------------ATKQISFHEHNAYEKIPDLIDLLISGRS-
RSMI_STRP1      CAEDTRNTGLLLKHFDI--------------ATKQISFHEHNAYEKIPDLIDLLISGRS-
RSMI_STRP6      CAEDTRNTGLLLKHFDI--------------ATKQISFHEHNSYEKIPDLIDLLISGRS-
RSMI_THEMA      LAEDTRRTMVLLNKYRI--------------KKPLLSFNERNSKKRIKEILPLLKEGKK-
RSMI_BUCAI      AAENIRHTNILLQHFNI--------------KNNLILMNKDNEKKQSHNLIQELKKGKK-
RSMI_BUCAP      AAENIHHTNILLQHYNV--------------KNILISLNKNNEKKQSDYVINELKKGKK-
RSMI_BUCBP      AAENIFHSQILLKHYNI--------------LTRTTSLNKDNEKIKSKTLIIQLKNKKN-
RSMI_ECOLI      AAEDTRHTGLLLQHFGI--------------NARLFALHDHNEQQKAETLLAKLQEGQN-
RSMI_ECO57      AAEDTRHTGLLLQHFGI--------------NARLFALHDHNEQQKAETLLAKLQEGQN-
RSMI_HAEIN      AAEDTRHSGLLLSHYGI--------------KKPFFALHDHNEQEKAHILVEKLKQGSN-
RSMI_PASMU      AAEDTRHSGLLLSHYGI--------------KKPFFALHDHNEQQKAHLLVEKLQQGQH-
RSMI_VIBCH      AVEDTRHTGKLLAHFNI--------------STKTFALHDHNEQQKAQVLVDKLLSGLS-
RSMI_XYLFA      CAEDTRHTRQLLAHFGI--------------ERPLLALHAHNEDTLAERIITRLISGAS-
RSMI_XYLFT      CAEDTRHTRQLLAHFGI--------------ERPLLALHAHNEDTLAERIITRLISGES-
RSMI_PSEAE      AAEDTRHSIRLFQHFGI--------------ETPLAACHEHNEREEGGRFISRLQGGED-
RSMI_SYNY3      AAEDTRHTGKLLQHFQI--------------TTPQISYHDHNRHGRTQELLAKLQAGQN-
RSMI_MYCTU      AAEDTRRVRKLAKALDIR-I-----------GGRVVSLFDRVEALRVTALLDAINNGAT-
RSMI_MYCBO      AAEDTRRVRKLAKALDIR-I-----------GGRVVSLFDRVEALRVTALLDAINNGAT-
RSMI_RHILO      ACEDTRVSRVLLDRYGI--------------RRRTTAYHEHNAGEAGPKLIAALQGGQS-
RSMI_ERYLH      ACEDTRMTGKLLKHLGI--------------SKSLWRYDDHSDAKAREKIVAAISE-KA-
RSMI_NEIMA      CAEDTRVTAQLLSAYGI--------------QGKLVSVREHNERQMADKIVGYLSDGMV-
RSMI_NEIMB      CAEDTRVTAQLLSAYGI--------------QGKLVSVREHNERQMADKIVGYLSDGMV-
RSMI_TREPA      ACEDTRRTRALLSHFGI--------------HKRLVSCRAHNEAQAARRLIHFLSTPISA
RSMI_BORBP      FAEDTRVTIKLLSRYKI--------------NKKMISCNAVTENKKIRLLLDYLAK----
RSMI_COPPD      ACESKERALKLLSHLQI--------------KKPLIYLREASRASDVKRIIELHKQGKT-
RSMI_LEPBP      LCESAKETKSLFHKLGI--------------STPVLALYKDHSETPFANVLEQLKQGKS-
RSMI_LEPBL      IGEEFRTTSTLLKSLSI--------------SKQFLLCNEHTTPEEIRSLGQIVVDSGL-
RSMI_MYCPU      ACEDTRVSKILLNHYQIN--------------KPLFSYHKFNEKSKLNYIFELVESGSD-
RSMI_MYCCR      LCEDTRVSQKLLNHYQINN-------------KKLISYHKFNEYKMLDLIDNYLNQGLQ-
RSMI_RICPR      LCEDTRISQKLLAKHYIH--------------TKLQIYNDHSDYKDREYIISLIKAGNV-
RSMI_HYDS0      ACEDTRRIQILLKHYNIEG-------------KTLLSYYHPKEAIQIRKIISLIRKDED-
RSMI_MYCGE      FCEDSRVTRKMLDLLNIDCK-----------QKKFVINNSFKEKQNLTFAEEFITNFKC-
RSMI_MYCPN      FCEDTRVTKKLLGLLGIDFS-----------NKQFIINNEFKEKQNLSKVANLIHQYHC-
                  *.      :                                                 

RSMI_HELPY      V--------------------------------------------------MSDAGMPSL
RSMI_HELPJ      V--------------------------------------------------MSDAGMPSL
RSMI_CAMFF      IY-------------------------------------------------ASDAGMPCI
RSMI_BACHD      ------------------------------------------------IALVSDAGMPAI
RSMI_BACSU      ------------------------------------------------IALVSDAGLPTI
RSMI_STRP3      ------------------------------------------------LAQVSDAGMPSI
RSMI_STRP8      ------------------------------------------------LAQVSDAGMPSI
RSMI_STRP1      ------------------------------------------------LAQVSDAGMPSI
RSMI_STRP6      ------------------------------------------------LAQVSDAGMPSI
RSMI_THEMA      ------------------------------------------------VAIVSDAGMPVI
RSMI_BUCAI      ------------------------------------------------IALVSNAGTPII
RSMI_BUCAP      ------------------------------------------------IALVSDAGTPVI
RSMI_BUCBP      ------------------------------------------------IALISNSGTPLI
RSMI_ECOLI      ------------------------------------------------IALVSDAGTPLI
RSMI_ECO57      ------------------------------------------------IALVSDAGTPLI
RSMI_HAEIN      ------------------------------------------------IALISDAGTPLI
RSMI_PASMU      ------------------------------------------------IALISDAGTPLI
RSMI_VIBCH      ------------------------------------------------IALVSDAGTPLI
RSMI_XYLFA      ------------------------------------------------LALVSDAGTPLI
RSMI_XYLFT      ------------------------------------------------LALVSDAGTPLI
RSMI_PSEAE      ------------------------------------------------VALISDAGTPLI
RSMI_SYNY3      ------------------------------------------------IALVSDAGTPGI
RSMI_MYCTU      ------------------------------------------------VLVVSDAGTPVI
RSMI_MYCBO      ------------------------------------------------VLVVSDAGTPVI
RSMI_RHILO      ------------------------------------------------VALISDAGTPLV
RSMI_ERYLH      ------------------------------------------------VALVSDAGTPLI
RSMI_NEIMA      ------------------------------------------------VAQVSDAGTPAV
RSMI_NEIMB      ------------------------------------------------VAQVSDAGTPAV
RSMI_TREPA      FLSPEKGRGRQSARRTRARPGETVGTAALQLAAEATGEQEVCGSPHAQVAYVSDAGTPGV
RSMI_BORBP      ------------------------------------GDS---------VAFVSDAGTPGL
RSMI_COPPD      ------------------------------------------------VAVTTDAGMPGI
RSMI_LEPBP      ------------------------------------------------MALVSDAGTPGV
RSMI_LEPBL      ------------------------------------------------TVLVSDAGTPGI
RSMI_MYCPU      ------------------------------------------------VALISDSGMPVI
RSMI_MYCCR      ------------------------------------------------ICLISDAGVPTI
RSMI_RICPR      ------------------------------------------------VSLISDAGTPLI
RSMI_HYDS0      ------------------------------------------------VALVSDAGTPSI
RSMI_MYCGE      -------------------------------------------------CLVSDAGYPSL
RSMI_MYCPN      -------------------------------------------------GLVSDAGYPSV
                                                                    :::* * :

RSMI_HELPY      SDPGMSLAAYALKH--NIQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKI
RSMI_HELPJ      SDPGMSLVAYALKH--NLQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLRI
RSMI_CAMFF      SDPGISLVKFAQQN--SIKYEVLSGANALLLAAAASGIIEKEFTFLGFLPNLGKERAIAI
RSMI_BACHD      SDPGYELVVSAIKE--GIAVIPIPGANAAVTALIASGLPTESFQFIGFLPRQKKQRRQAL
RSMI_BACSU      SDPGAEIVKDFTDI--GGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKEL
RSMI_STRP3      SDPGHDLVKAAIDS--DITVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFF
RSMI_STRP8      SDPGHDLVKAAIDS--DIAVVALPGASAGITALIASGLAPQPHVFYGFLSRKAGQQKAFF
RSMI_STRP1      SDPGHDLVKAAIDS--DIAVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFF
RSMI_STRP6      SDPGHDLVKAAIDS--DIAVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFF
RSMI_THEMA      SDPGYNLVEECWRE--GIEVDIVPGPSALTSAVAVSGFPGSKFIFEGFLPR-GKNRRRLL
RSMI_BUCAI      NDPGCILIKQCHIF--DIKVIPLPGACAAITALSASGIINNRFCYEGFLPSRKKSRCDLL
RSMI_BUCAP      NDPGYFLVKKCCFL--NIKIIPLPGPCAAITALSASGISTNRFCYEGFLPSKKKIRRDLL
RSMI_BUCBP      NDPGFYLINECYNH--IIKIVPIPGPCAAITALIASGLPANRFCYEGFLPSKQNSRCKIL
RSMI_ECOLI      NDPGYHLVRTCREA--GIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDAL
RSMI_ECO57      NDPGYHLVRTCREA--GIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDAL
RSMI_HAEIN      SDPGFHLVRQCREA--GIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKL
RSMI_PASMU      SDPGFHLVRQCRQA--GIKVVPIPGACAAVTALCASGIASDRFCFEGFLPAKSKARCDKL
RSMI_VIBCH      SDPGYHLVTQCRQA--GVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKL
RSMI_XYLFA      SDPGFLLVRAARAA--GIRVTPVPGPSALIAALSVSGLPSNRFTFEGFLPAKPTARRDRL
RSMI_XYLFT      SDPGFLLVRAARAA--GIRVTPVPGPSALIAALSVSGLPSNRFTFEGFLPAKPTARRDRL
RSMI_PSEAE      SDPGFHLVRQAQAL--GIRVVPVPGSCALIAALSAAGLPSDRFIFEGFLPAKAAGRRSRL
RSMI_SYNY3      SDPGQELVAACGEA--NIEVIPIPGATALIAALISSGLATDRFVFEGFLSTKNRPRQQLL
RSMI_MYCTU      SDPGYRLVAACIDA--GVSVTCLPGPSAVTTALVMSGLPAEKFCFEGFAPRKGAARRAWL
RSMI_MYCBO      SDPGYRLVAACIDA--GVSVTCLPGPSAVTTALVMSGLPAEKFCFEGFAPRKGAARRAWL
RSMI_RHILO      SDPGYRLVGEAIDH--GIRVVPIPGPSAPLAALTASGLPSDAFLFAGFLPVKVGQRLTRL
RSMI_ERYLH      SDPGYRLVRDARDA--SLPVTTIPGACAAIAGLTLSGLPSDRFLFAGFLPVKDKARREML
RSMI_NEIMA      CDPGAKLARRVREV--GFKVVPVVGASAVMAALSVAGVAGSDFYFNGFVPPKSGERRKLF
RSMI_NEIMB      CDPGAKLARRVREA--GFKVVPVVGASAVMAALSVAGVEGSDFYFNGFVPPKSGERRKLF
RSMI_TREPA      SDPGAVLVRAVRDA--GHTVVPIPGASALTTLLSVAGVRDKTVLFEGFLSPHPGRRRARL
RSMI_BORBP      SDPGSLLVAAAFRE--GYKVCPIPGVSSFNTIVSVNPFRDKSVLFEGFLPNKGLKRFKKI
RSMI_COPPD      SDPGAYLVRELSAQ--GIPFTVVPGPSALCMSITVSGLE-EPWAFLGFLPLKEGKRRREL
RSMI_LEPBP      SDPGSQMVRTAREN--GISIVPVPGASALTALLSVSGFQVNPTYFLGFLSEKPSKKRREL
RSMI_LEPBL      EDPGRELVGEVLRR--GGRVQSAPGPIAFGAALSISGFKTSPFTFCGFLSRDSSERKLEL
RSMI_MYCPU      SDPGFLLIREAKKK--NIDLEVIPGVSAFSMAFVKSSFPLP-FSFLGFLNDKTG-KRKNE
RSMI_MYCCR      SDPGQILVNWAHEN--DIEVDIIPGANALISAFALSGYKGS-FYFGGFLDSKKQ-QIIKQ
RSMI_RICPR      SDPGYKLVRDLRNL--NYYIEVVPGVSSPITALTLSSLPTDRFLFSGFLPKTIESKKKIF
RSMI_HYDS0      SDPGFKLINACIKE--DIPVEVLPGPCALITALVGSGLPTHSFMFLGFAPRKSQ-ESFYK
RSMI_MYCGE      SDPGNEMINWIISKNKEIRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYL
RSMI_MYCPN      SDPGHILVEYVRTQLPQIAIEVINGPSALVCGLVTSGFPESPLLFLGFLDHKPTQVTQTL
                 ***  :                 *  :                : **            

RSMI_HELPY      AKILNALAYLEEKTPVVFYESPHRLLETLKDLNDLAKGM----HLFAAKELTKLHQQYYL
RSMI_HELPJ      IKILNALAYLEEKTPVVFYESPHRLLETLRDLNDLAQGM----HLFAAKELTKLHQQYYL
RSMI_CAMFF      QNALNSL------YPVIIYESPKRILSLIKSISEFDPLR----EVFIIKEATKKFEAKFK
RSMI_BACHD      EETKPTK------ATLIFYESPHRLKDTLDDMLLILG-N---RHVSICRELTKTYEEFLR
RSMI_BACSU      EALKKRQ------ETIIFYEAPHRLKETLSAMAEILG-D---REIAVTRELTKKYEEFIR
RSMI_STRP3      EDKHHYP------ETQMFYESPYRIKDTLTNMLACYG-D---RQVVLVRELTKLFEEYQR
RSMI_STRP8      EDKHHYP------ETQMFYESPYRIKDTLTNMLACYG-D---RQVVLVRELTKLFEEYQR
RSMI_STRP1      EDKHHYP------ETQMFYESPYRIKDTLTNMLACYG-D---RQVVLVRELTKLFEEYQR
RSMI_STRP6      EDKHHYT------ETQMFCESPYRIKDTLTNMLACYG-D---RQVVLVRELTKLFEEYQR
RSMI_THEMA      KSLKKEN------RVIVFFESPERLLSTLRDILEIIG-D---REVFIAREMTKLHQEFFR
RSMI_BUCAI      HSLKEET------RTIIFYESKHRILESIKDIIEQIDKN---RHIVIAREMTKKWESIYG
RSMI_BUCAP      KSLKKEI------RTIIFYESKHRILESIKDIIETIDEN---RYLVIAREITKKWEYIYG
RSMI_BUCBP      NQIKEEQ------RTIIFFEVTHRIIESITDIINILGPK---RIITFAKELTKKWEIIQK
RSMI_ECOLI      KAIEAEP------RTLIFYESTHRLLDSLEDIVAVLGES---RYVVLARELTKTWETIHG
RSMI_ECO57      KAIEAEP------RTLIFYESTHRLLDSLEDIVAVLGES---RYVVLARELTKTWETIHG
RSMI_HAEIN      ENIAEED------RTLIFYESTHRILDTLEDMQAVLGEE---RYIVLAREMTKTWETITG
RSMI_PASMU      QNLAEEE------RTLIFYESTHRILDTLADIEKTLGAE---RYVVLAREITKTWETIVG
RSMI_VIBCH      LEIAKVS------RTCIFYESPHRICESLQDMLDVLGGE---REVVLARELTKTFETIQG
RSMI_XYLFA      THLAHEP------RTLIFYEASHRIAECLTDLATIFGSM---RAAVVARELTKIFETVLD
RSMI_XYLFT      THLAHEP------RTLIFYEASHRIAECLTDLATIFGSM---RIAVVARELTKIFETVLD
RSMI_PSEAE      QAVQEEP------RTLIFYEAPHRLLESLADMRDVFGGE---RRAVLARELSKTFETIRS
RSMI_SYNY3      QSLAQEE------RTIILYEAPHRLLATLTDLQTFLGQE---RSLTVARELTKYHEQFWR
RSMI_MYCTU      AELAEER------RTCVFFESPRRLAACLNDAVEQLGGA---RPAAICRELTKVHEEVVR
RSMI_MYCBO      AELAEER------RTCVFFESPRRLAACLNDAVEQLGGA---RPAAICRELTKVHEEVVR
RSMI_RHILO      EALKAVP------ATLIFFESPRRLAESLGAMVEALGGE---RKAAIGRELTKTFEEMRT
RSMI_ERYLH      EKLAPVD------ASLIFYETGPRLLKSLAAIDEMLP-N---REISVARELTKLHEECRR
RSMI_NEIMA      AKWVRVA------FPVVMFETPHRIGATLADMAELFPER----RLMLAREITKTFETFLS
RSMI_NEIMB      AKWVRAA------FPIVMFETPHRIGATLADMAELFPER----RLMLAREITKTFETFLS
RSMI_TREPA      VQLCAQR------VAFVLYESPYRVQKLLEDLVAVAPES----QVVLGRELTKVHEELCV
RSMI_BORBP      AELYKRG------DAFVLLESGHRLLKLLVEISSVSLDA----KILIGREMTKIYEEYQI
RSMI_COPPD      EKFLPLN------IGLVIYEGPHRVGKLLSLLNELCPQR----KVALLRELTKLHEEVQV
RSMI_LEPBP      ERAREIE------GLIVFYESVHKLPRLYPILEELFPET----EVLMGRELTKAFEEVVY
RSMI_LEPBL      SRYLKPG------HTVVFYETPYRYKAVLRDLDSVLIETGEDRAIFFCLDLTLDSEFQFR
RSMI_MYCPU      LKKLSAG------ISYISYVSKYKLIQTLKDLKEVFGL---NVEVFLTRELTKKFENDYT
RSMI_MYCCR      ISLLDPK------VSYIFYISPFKLVYTLEIIRDLYGE---EIDIFLIKEITKIYQKYYR
RSMI_RICPR      AELVNLK------ATLIFFDTASRLINTLLLAKEIFG----NREICVARELTKIYQETKT
RSMI_HYDS0      EVFSSDT------GSYILYESPQRILDTLELISHIEP----NITVAIARELTKMHEEYIR
RSMI_MYCGE      STYQNQK------STIVFFEAVHRLENTLETVKNVFKNN----DVFIGRELTKLHESHYW
RSMI_MYCPN      KHYQNFQ------GTIVLFEAVHRLQQTLEVIQTVFSNT----EVFVGRELTKLHESHYW
                                :      :                         : :   :    

RSMI_HELPY      GEVSQIIERLQQSTIQ---GEWVLVLLN------------EKKIEPCMGLSALLELDLPP
RSMI_HELPJ      GEISQIMTQLQKSNIQ---GEWVLVLLN------------EKKIEPSMGLSALLELDLPP
RSMI_CAMFF      NSATNLLTQLENSNLN---GEWCVVIDRS-----------ANKALERITTKDIMELDLPL
RSMI_BACHD      GTLEEAVHWAREATIK---GEFCLIVEG-NGEKVEPEEVWWESLSPVQHVEHYIALGFRS
RSMI_BACSU      GTISEVIGWANEDQIR---GEFCLVVEGSNNEEVDEEEQWWETLTAKEHVEHYISKGATS
RSMI_STRP3      GSISEILSYLEETSLK---GECLLIVAG---AQVDSEVELTADVDLVSLVQKEIQAGAKP
RSMI_STRP8      GSISEILSYLEETSLK---GECLLIVAG---AQVDSEVELTADVDLVSLVQKEIQAGAKP
RSMI_STRP1      GSISEILSYLEETPLK---GECLLIVAG---AQADSEVELTADVDLVSLVQKEIQAGAKP
RSMI_STRP6      GSISEILSYLEETPLK---GECLLIVAG---AQVDSEIELTADVDLVSLVQKEIQAGAKP
RSMI_THEMA      GKVSEAISHFEKKKPL---GEITVVLSG-------KE-----------------------
RSMI_BUCAI      AKASLILEWLKENKYRYK-GEMVIIIDGFK---KLKN-YTLSKKILD--TFSILRKFFSL
RSMI_BUCAP      AKANIILSWLKEDQSRYKKGEIVIIIDGFK---ELKN-KDISAKAIN--TLTILRNFLSL
RSMI_BUCBP      NTSYNILIWLKQN-YTYKKGEIVIIISGYN---NKNT-NLISDAVLK--TLKILKTHLSF
RSMI_ECOLI      APVGELLAWVKEDENRRK-GEMVLIVEGHK---AQEE--DLPADALR--TLALLQAELPL
RSMI_ECO57      APVGELLAWVKEDENRRK-GEMVLIVEGHK---AQEE--DLPADALR--TLALLQAELPL
RSMI_HAEIN      NTIKNLREWLLEDPNRTK-GEMVLIVEGKP---KSDNNDEISPQAVK--ALELIAEELPL
RSMI_PASMU      DNVANLRQWLGEDPNRTK-GEMVLIIEGKV---KQET-DEINPQALK--ALELISQSLPL
RSMI_VIBCH      MPLAELITWIAEDDNRKK-GEMVLLVHGYR---DAGE-QQLPDEALR--TLTILTKELPL
RSMI_XYLFA      GTLATLQTQVANDDNQRK-GEFVIIVQG-----AADQDAAKITEGRR--VYALLKEHLPP
RSMI_XYLFT      GTLATLQTQVANDENQRK-GEFVIIVQG-----AADQDAAKITEGRR--IYALLKEHLPP
RSMI_PSEAE      LPLAELHDWVASDSNQQR-GECVVLVAGWQ---APEGEESIGAEALR--VLDLLLAELPL
RSMI_SYNY3      GTLQTAIAYFTENTPK---GEFCLVIAGAT---PEDR-PSFSEENLRDELRSLMAKGLTR
RSMI_MYCTU      GSLDELA--IWAAGGVL--GEITVVVAGA-----APHAELSSLIAQV--EEFVAAGIRVK
RSMI_MYCBO      GSLDELA--IWAAGGVL--GEITVVVAGA-----APHAELSSLIAQV--EEFVAAGIRVK
RSMI_RHILO      GTLRALADHYAAADTPK--GEIVVCVGPA-----EAKADEPADIDRL--LLSLAAEMPAS
RSMI_ERYLH      GMGAGLMAHYQAN-PPK--GEIVLMVGPP-----PEAAPDDTDAELM--LREALETMKPS
RSMI_NEIMA      GTVGEIQTALAADGNQS-RGEMVLVLYPAQDEKHEGLSESAQNIMKILTAELPTKQAAEL
RSMI_NEIMB      GTVGEIQTALSADGNQS-RGEMVLVLYPAQDEKHEGLSESAQNIMKILTAELPTKQAAEL
RSMI_TREPA      GTALRVMESF-CARTRV-RGECVLLVSAEKF-----------------------------
RSMI_BORBP      GKPLELKKYFESSKEKV-KGEFTILVSRSSS-----------------------------
RSMI_COPPD      ----GYPHELIKD--SY-KGEFVVVVYP---SQEGT------------------------
RSMI_LEPBP      Y---ANPRELANNPPNA-KGEFVFLLNHRKKSLKGNSDSTDM------------------
RSMI_LEPBL      GKLGELLKVLDTLP----KGNPVIVVSQRKEQRSQRSFSKGDKKPSFKRFKK--------
RSMI_MYCPU      GTIDEIIDQLGESI----KGEFTLIFFIKQA-----------------------------
RSMI_MYCCR      GTPDKILNNLSAP-----KGEFTIILKLKEKKSIKKNKYEQFSKVK--------------
RSMI_RICPR      GDIDEIIEFYKNNI-L--KGEIVLLISGNVQVQNKQINLEKFIEFCLSKNLSSKTIIELA
RSMI_HYDS0      GNIKDVIEELKKRNNI--KGEIVLVLSKENTLYQESL-----------------------
RSMI_MYCGE      FNTSENTLPDITLK-----GEFVIVIDNQN----INHQTLSSNQYLVYEIKKLMDIGVKL
RSMI_MYCPN      FNTSA-PLPDITLK-----GEFVIVINNHH----TQPVGQYSDQLLKQEITQLVQMGVKV
                                   *:  . .                                  

RSMI_HELPY      KIKAKIEAVMTQKNAKELYFQRLLEEKNQ------
RSMI_HELPJ      KIKAKMEAAMTQKNAKELYFQRLLEEKKQCD----
RSMI_CAMFF      KQKAKLISKITGENAKKIYQNLIT-----------
RSMI_BACHD      KEAIKQVATDRGVPKRDIYNIYHQE----------
RSMI_BACSU      KEAIKKAAVDRNVPKREVYDAYHIKQ---------
RSMI_STRP3      NQAIKTIAKAYQVNRQELYQQFHDL----------
RSMI_STRP8      NQAIKTIAKAYQVNRQELYQQFHDL----------
RSMI_STRP1      NQAIKTIAKAYQVNRQELYQQFHDL----------
RSMI_STRP6      NQAIKTIAKAYQVNRQELYQQFHDL----------
RSMI_THEMA      -----------------------------------
RSMI_BUCAI      KTSVLITAQIHDINKNKLYQYVIKKEE--------
RSMI_BUCAP      KQSVFITSKIHKIKKNDLYQHAIKEKDK-------
RSMI_BUCBP      NKAIKITAGIYKLPKNYLYNYAINNTISKNNDIH-
RSMI_ECOLI      KKAAALAAEIHGVKKNALYKYALEQQG--------
RSMI_ECO57      KKAAALAAEIHGVKKNALYKYALEQQG--------
RSMI_HAEIN      KKAAAIVAELYGYKKNALYQFGLAHLEK-------
RSMI_PASMU      KKAAAIVAEIYGYKKNALYQYGLEHFN--------
RSMI_VIBCH      KKAAALVAEIHQLKKNALYKWGLENLGE-------
RSMI_XYLFA      SSAAKLAAEITGAPRKALYGG--------------
RSMI_XYLFT      SSAAKLAAEITGAPRKALYGG--------------
RSMI_PSEAE      KKAAALAAEITGVRKNLLYQQALQRQGKS------
RSMI_SYNY3      SQASRQLAEETKLPRRQLYQLSLELEADG------
RSMI_MYCTU      DACSEVAAAHPGVRTRQLYDAVLQSRRETGGPAQP
RSMI_MYCBO      DACSEVAAAHPGVRTRQLYDAVLQSRRETGGPAQP
RSMI_RHILO      KAASEAAKM-TGGQKQALYRRLLELKDTSGEGDGG
RSMI_ERYLH      QAAGHVAKA-TGLDRKDLYSRALELKT--------
RSMI_NEIMA      AAKITGEGKKALYDLALSWKNK-------------
RSMI_NEIMB      AAKITGEGKKALYDLALSWKNK-------------
RSMI_TREPA      -----------------------------------
RSMI_BORBP      -----------------------------------
RSMI_COPPD      -----------------------------------
RSMI_LEPBP      -----------------------------------
RSMI_LEPBL      -----------------------------------
RSMI_MYCPU      -----------------------------------
RSMI_MYCCR      -----------------------------------
RSMI_RICPR      YDKFKDVYSKKEIYSVVHKKKFTA-----------
RSMI_HYDS0      -----------------------------------
RSMI_MYCGE      KDACNYLAKKMHLKSSMLYTLFHESI---------
RSMI_MYCPN      KDACHYLAKRLQLKSNKLYTLFHESD---------