CLUSTAL format seed alignment for MF_01884

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RHO_MICLU       ----------------------------------------------MTESTEQTTPTNGG
RHO_STRRD       ------------------------------------------------------------
RHO_STRLI       ------------------------------MSDTTDLMGARVEETAAAPATDASAPATGA
RHO_MYCTU       -----------------------------MTDTDLITAGESTDGKP-SDAAATDPPDLNA
RHO_MYCBO       -----------------------------MTDTDLITAGESTDGKP-SDAAATDPPDLNA
RHO_MYCLE       -----------------------------MTETDLITVGENTDDTELTNAVTTDTPDVKA
RHO_STRCO       ------------------------------------------------------------
RHO_BORBU       ------------------------------------------------------------
RHO_TREPA       ------------------------------------------------------------
RHO_BUCAI       ------------------------------------------------------------
RHO_BUCAP       ------------------------------------------------------------
RHO_BUCBP       ------------------------------------------------------------
RHO_ECOLI       ------------------------------------------------------------
RHO_ECO57       ------------------------------------------------------------
RHO_ECOL6       ------------------------------------------------------------
RHO_SHIFL       ------------------------------------------------------------
RHO_SALTI       ------------------------------------------------------------
RHO_SALTY       ------------------------------------------------------------
RHO_HAEIN       ------------------------------------------------------------
RHO_PSEAE       ------------------------------------------------------------
RHO_PSEFC       ------------------------------------------------------------
RHO_ALLVD       ------------------------------------------------------------
RHO_XYLFA       ------------------------------------------------------------
RHO_NEIGO       ------------------------------------------------------------
RHO_CHRVO       ------------------------------------------------------------
RHO_RICCN       ------------------------------------------------------------
RHO_RICFE       ------------------------------------------------------------
RHO_RICPR       ------------------------------------------------------------
RHO_RICTY       ------------------------------------------------------------
RHO_RICBR       ------------------------------------------------------------
RHO_CERS4       ------------------------------------------------------------
RHO1_EHRCR      ------------------------------------------------------------
RHO2_EHRCR      ------------------------------------------------------------
RHO_HELPY       ------------------------------------------------------------
RHO_HELPJ       ------------------------------------------------------------
RHO_FIBSS       ------------------------------------------------------------
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------------------------------------------------------------
RHO_AQUAE       ------------------------------------------------------------
RHO_BACSU       ------------------------------------------------------------
RHO_RHOBA       ------------------------------------------------------------
RHO_DEIRA       ------------------------------------------------------------
RHO_FUSNN       ------------------------------------------------------------
RHO_STRM9       ------------------------------------------------------------
RHO_AKKM8       ------------------------------------------------------------
RHO_GEMAT       MSGPCSAHRVPPIGPRPTIRSPRITRSSRMTEPKRPSRRGTTRTRPAPDSVGDDNPYLDA
                                                                            

RHO_MICLU       G--------LASLKLAQLQALASQLGIAGGSRMRKADLVTAISDHQRGGSVADRDAAERA
RHO_STRRD       ------------------------------------------------------------
RHO_STRLI       GSRRRRGTGLEGMVLAELQQVASGLGIRGTARMRKSQLIEVIKEAQAAGGAPAKAAPAAA
RHO_MYCTU       DEPA---GSLATMVLPELRALANRAGVKGTSGMRKNELIAAIEEIRRQANGAPAVDRSAQ
RHO_MYCBO       DEPA---GSLATMVLPELRALANRAGVKGTSGMRKNELIAAIEEIRRQANGAPAVDRSAQ
RHO_MYCLE       TAATVSLGSLSTMVLPELRALANQAGVKGTSGMRKSELIAAIEECRGQANGTSVNDGPSR
RHO_STRCO       ---------MSEVLFPAVRRRVVRPLARLFPSLRMS------------------------
RHO_BORBU       ------------------------------------------------------------
RHO_TREPA       ------------------------------------------------------------
RHO_BUCAI       ------------------------------------------------------------
RHO_BUCAP       ------------------------------------------------------------
RHO_BUCBP       ------------------------------------------------------------
RHO_ECOLI       ------------------------------------------------------------
RHO_ECO57       ------------------------------------------------------------
RHO_ECOL6       ------------------------------------------------------------
RHO_SHIFL       ------------------------------------------------------------
RHO_SALTI       ------------------------------------------------------------
RHO_SALTY       ------------------------------------------------------------
RHO_HAEIN       ------------------------------------------------------------
RHO_PSEAE       ------------------------------------------------------------
RHO_PSEFC       ------------------------------------------------------------
RHO_ALLVD       ------------------------------------------------------------
RHO_XYLFA       ------------------------------------------------------------
RHO_NEIGO       ------------------------------------------------------------
RHO_CHRVO       ------------------------------------------------------------
RHO_RICCN       ------------------------------------------------------------
RHO_RICFE       ------------------------------------------------------------
RHO_RICPR       ------------------------------------------------------------
RHO_RICTY       ------------------------------------------------------------
RHO_RICBR       ------------------------------------------------------------
RHO_CERS4       ------------------------------------------------------------
RHO1_EHRCR      ------------------------------------------------------------
RHO2_EHRCR      ------------------------------------------------------------
RHO_HELPY       ------------------------------------------------------------
RHO_HELPJ       ------------------------------------------------------------
RHO_FIBSS       ----------------MPRTPKNQNLEQNTQTQSLTDLVYPESTGIPVPEYLGTVDKLPD
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------------------------------------------------------------
RHO_AQUAE       ------------------------------------------------------------
RHO_BACSU       ------------------------------------------------------------
RHO_RHOBA       ------------------------------------------------------------
RHO_DEIRA       ------------------------------------------------------------
RHO_FUSNN       ------------------------------------------------------------
RHO_STRM9       ------------------------------------------------------------
RHO_AKKM8       ------------------------------------------------------------
RHO_GEMAT       PASRASSESRSESGSGLSAEGSGSDAPRPRRPRQPRRPAADAESAPTAADTNDSAPAPTA
                                                                            

RHO_MICLU       AQAPAAPAAETAPAAASSEDAAPAAERPARRRSRRADADTSAPAAAQDGQPQAEAREAQT
RHO_STRRD       ------------------------------------------------------------
RHO_STRLI       DTAGETKPKRRSTSRTRTGDEAPAEKAEKAGKADKKADKAAADKAAAQQQIEIPGQPTPK
RHO_MYCTU       EHDKGDRPP-SSEAPATQGEQTPTEQIDSQSQQVRPERRSATREAGPSGS----------
RHO_MYCBO       EHDKGDRPP-SSEAPATQGEQTPTEQIDSQSQQVRPERRSATREAGPSGS----------
RHO_MYCLE       DHGGSATAI-STEALAAQ-EEQNYAIVEVSRRERRGASREADVTAGTSTAEAT-------
RHO_STRCO       ------------------------------------------------------------
RHO_BORBU       ------------------------------------------------------------
RHO_TREPA       ------------------------------------------------------------
RHO_BUCAI       ------------------------------------------------------------
RHO_BUCAP       ------------------------------------------------------------
RHO_BUCBP       ------------------------------------------------------------
RHO_ECOLI       ------------------------------------------------------------
RHO_ECO57       ------------------------------------------------------------
RHO_ECOL6       ------------------------------------------------------------
RHO_SHIFL       ------------------------------------------------------------
RHO_SALTI       ------------------------------------------------------------
RHO_SALTY       ------------------------------------------------------------
RHO_HAEIN       ------------------------------------------------------------
RHO_PSEAE       ------------------------------------------------------------
RHO_PSEFC       ------------------------------------------------------------
RHO_ALLVD       ------------------------------------------------------------
RHO_XYLFA       ------------------------------------------------------------
RHO_NEIGO       ------------------------------------------------------------
RHO_CHRVO       ------------------------------------------------------------
RHO_RICCN       ------------------------------------------------------------
RHO_RICFE       ------------------------------------------------------------
RHO_RICPR       ------------------------------------------------------------
RHO_RICTY       ------------------------------------------------------------
RHO_RICBR       ------------------------------------------------------------
RHO_CERS4       ------------------------------------------------------------
RHO1_EHRCR      ------------------------------------------------------------
RHO2_EHRCR      ------------------------------------------------------------
RHO_HELPY       ------------------------------------------------------------
RHO_HELPJ       ------------------------------------------------------------
RHO_FIBSS       NTEEVPQPKRRGRKPNPKTKARKEPALEQNVQAETEPEFQEKKQPVDGIAAAEKRLAEQY
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------------------------------------------------------------
RHO_AQUAE       ------------------------------------------------------------
RHO_BACSU       ------------------------------------------------------------
RHO_RHOBA       ------------------------------------------------------------
RHO_DEIRA       ------------------------------------------------------------
RHO_FUSNN       ------------------------------------------------------------
RHO_STRM9       ------------------------------------------------------------
RHO_AKKM8       ------------------------------------------------------------
RHO_GEMAT       RRGVRRTTRSAAAGTDVSSSTSELPRAESPRSEPRTESRPEPRAENGSETRHESRGGSSE
                                                                            

RHO_MICLU       EQAPRETASDQDRSGGSEARDEGEDRPQSERRSRGRRRAGDDDAQQGQDRRSDGAQGEDG
RHO_STRRD       ------------------------------------------------------------
RHO_STRLI       VNASAEQAAPADDAPSERRRRRATSDAGSPSATDTTVAVETRAEPKADTSAPQQSQGHQQ
RHO_MYCTU       --------------------------------------------GERAGTAADDTDNRQG
RHO_MYCBO       --------------------------------------------GERAGTAADDTDNRQG
RHO_MYCLE       -------------------------------------------ESDCQGTADDDTRTLQG
RHO_STRCO       ------------------------------------------------------------
RHO_BORBU       ------------------------------------MDKKNGGFDLESEIRRLD-VSKEF
RHO_TREPA       ------------------------------------MKVSVGTVVGQGELGLEEGIVGNQ
RHO_BUCAI       ------------------------------------------------------------
RHO_BUCAP       ------------------------------------------------------------
RHO_BUCBP       ------------------------------------------------------------
RHO_ECOLI       ------------------------------------------------------------
RHO_ECO57       ------------------------------------------------------------
RHO_ECOL6       ------------------------------------------------------------
RHO_SHIFL       ------------------------------------------------------------
RHO_SALTI       ------------------------------------------------------------
RHO_SALTY       ------------------------------------------------------------
RHO_HAEIN       ------------------------------------------------------------
RHO_PSEAE       ------------------------------------------------------------
RHO_PSEFC       ------------------------------------------------------------
RHO_ALLVD       ------------------------------------------------------------
RHO_XYLFA       ------------------------------------------------------------
RHO_NEIGO       ------------------------------------------------------------
RHO_CHRVO       ------------------------------------------------------------
RHO_RICCN       ------------------------------------------------------------
RHO_RICFE       ------------------------------------------------------------
RHO_RICPR       ------------------------------------------------------------
RHO_RICTY       ------------------------------------------------------------
RHO_RICBR       ------------------------------------------------------------
RHO_CERS4       ------------------------------------------------------------
RHO1_EHRCR      ------------------------------------------------------------
RHO2_EHRCR      ------------------------------------------------------------
RHO_HELPY       ------------------------------------------------------------
RHO_HELPJ       ------------------------------------------------------------
RHO_FIBSS       GVANIDAIAEPIYTGEQNYKPAESTEENAFVSENTSEAVIPQNGDMAQAQAENQGEVATD
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------------------------------------------------------------
RHO_AQUAE       ------------------------------------------------------------
RHO_BACSU       ------------------------------------------------------------
RHO_RHOBA       ----------------------------------------MHPSRMALIRPPLFSSYRFG
RHO_DEIRA       ------------------------------------------------------------
RHO_FUSNN       ------------------------------------------------------------
RHO_STRM9       ------------------------------------------------------------
RHO_AKKM8       ------------------------------------------------------------
RHO_GEMAT       GRPSFRDPSPSGYEASMERPLADRPDAPNRYDRAFDRTDGPERQDTRPERPFQQERPFQQ
                                                                            

RHO_MICLU       ADADRRGDREDRDDNGRE--NGRGRNGRNGRDRDNGRDRENGRENSRDRENGRDGSREQR
RHO_STRRD       ------------------------------------------------------------
RHO_STRLI       GQGDARSDAEGGDGRRRDRRDRGDRDRGDRGDRGDRGDRGDRGERGRDRRNKGDDQQNQG
RHO_MYCTU       GQQDAKTE-----------------------------------ERGTDAGGDQGGDQQAS
RHO_MYCBO       GQQDAKTE-----------------------------------ERGTDAGGDQGGDQQAS
RHO_MYCLE       GQSDTKTE-----------------------------------ERGPDVGNDQGVEQQSS
RHO_STRCO       ------------------------------------------------------------
RHO_BORBU       KIEDNLKKKVVKVVAKKDSASSVTKSADLSGVKDSNGVIFSDFDYDIPSSGLENNIKTLE
RHO_TREPA       IVSEDSAADVGECDAYGGRKKLVIRSRSRRRVVTPKALEVEKRPRRALRFKQNFCPEDAE
RHO_BUCAI       ------------------------------------------------------------
RHO_BUCAP       ------------------------------------------------------------
RHO_BUCBP       ------------------------------------------------------------
RHO_ECOLI       ------------------------------------------------------------
RHO_ECO57       ------------------------------------------------------------
RHO_ECOL6       ------------------------------------------------------------
RHO_SHIFL       ------------------------------------------------------------
RHO_SALTI       ------------------------------------------------------------
RHO_SALTY       ------------------------------------------------------------
RHO_HAEIN       ------------------------------------------------------------
RHO_PSEAE       ------------------------------------------------------------
RHO_PSEFC       ------------------------------------------------------------
RHO_ALLVD       ------------------------------------------------------------
RHO_XYLFA       ------------------------------------------------------------
RHO_NEIGO       ------------------------------------------------------------
RHO_CHRVO       ------------------------------------------------------------
RHO_RICCN       -------------------------------------------MNTTNKESTAELNNTES
RHO_RICFE       -------------------------------------------MNTTNKESTEELNNTES
RHO_RICPR       -------------------------------------------MNTTNKQLTEELNNTES
RHO_RICTY       -------------------------------------------MNTTNKQLTEELNNTES
RHO_RICBR       -------------------------------------------MSITNKESPEQLNNPEF
RHO_CERS4       -------------------------------------------MNER-------------
RHO1_EHRCR      ------------------------------------------------------------
RHO2_EHRCR      ------------------------------------------------------------
RHO_HELPY       ---------------------------------------------------MNENAPTHK
RHO_HELPJ       ---------------------------------------------------MNENAPTHK
RHO_FIBSS       QNADPNAQQQGEAQAQNGEGQDDRRFNNQNGKFNKFNKNNKFNKNNRNNRNFQQQEEFVD
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------------------------------------------------------------
RHO_AQUAE       --------------------------------------------------------MTQQ
RHO_BACSU       ------------------------------------------------------------
RHO_RHOBA       SLLMEPSSTPGPARNARRSNRRMRHPDKDVDKRVRELDAERDPLSLPEEIVSEVTRAGGR
RHO_DEIRA       ------------------------------------------------------------
RHO_FUSNN       ------------------------------------------------------------
RHO_STRM9       ------------------------------------------------------------
RHO_AKKM8       --------------MTEELDNTPSPAGDIPQETLPKPLPAPEETAGEQPAAAPEENRGNA
RHO_GEMAT       DRQDRHERQDRPDRRDRNGRRRGRGGRPDNRGPGGDRHQSTGPAADRSHDRGPDRNNERA
                                                                            

RHO_MICLU       GDKSEDGGRGDGGRGDRSRRDDRDDEGGRNRRNRRNRNERGRNRRGRGGPEVDETELTED
RHO_STRRD       ----------------------MTIETTTKKRPRAARPPRPRE---------------SD
RHO_STRLI       GGRQDRQQQGGGGRQDRQQHDDGYDDDGSGRRGRRGRYRDRRGRRGRD--EIQEPQINED
RHO_MYCTU       GGQQARG--------------DEDGEARQGRRGRRFRDR--RRRGERSG-DGAEAELRED
RHO_MYCBO       GGQQARG--------------DEDGEARQGRRGRRFRDR--RRRGERSG-DGAEAELRED
RHO_MYCLE       S-LQPRG--------------DDDGEGRQGRRGRRFRDRDRRRRGERSG-DGAEAELRQD
RHO_STRCO       -------------------------HARVLERTDHMTTT-------------LEHPPVQH
RHO_BORBU       QSNIIKFFNGKDYVEIEKLYDKPITEVRKIVEGLGTNHTIAVTMKKTELIFLLVKILSEN
RHO_TREPA       TSESSADVKGRARLLIDDLTEMGMHALRDFAVQRGISQEDVVVMKKSDIIFHVLKNHTEN
RHO_BUCAI       -------------MNLTALKNMPVSELITLGE--KMGLENLARMRKQDIIFAILKQHAKS
RHO_BUCAP       -------------MNLTALKNMPVSELITLGE--KMGLENLARMRKQDIIFAILKQHAKS
RHO_BUCBP       -------------MNLTALKNIPVSELIFLGD--NAGLENLARMRKQDIIFSILKQHAKS
RHO_ECOLI       -------------MNLTELKNTPVSELITLGE--NMGLENLARMRKQDIIFAILKQHAKS
RHO_ECO57       -------------MNLTELKNTPVSELITLGE--NMGLENLARMRKQDIIFAILKQHAKS
RHO_ECOL6       -------------MNLTELKNTPVSELITLGE--NMGLENLARMRKQDIIFAILKQHAKS
RHO_SHIFL       -------------MNLTELKNTPVSELITLGE--NMGLENLARMRKQDIIFAILKQHAKS
RHO_SALTI       -------------MNLTELKNTPVSELITLGE--SMGLENLARMRKQDIIFAILKQHAKS
RHO_SALTY       -------------MNLTELKNTPVSELITLGE--SMGLENLARMRKQDIIFAILKQHAKS
RHO_HAEIN       -------------MHLTELKNTPVSDLVKLGEE-QMGLENLARLRKQDIVFAILKQHAKS
RHO_PSEAE       -------------MNLTELKQKPIAELLEMSD--AMGLENMARSRKQDIIFALLKKHAKS
RHO_PSEFC       -------------MNLTELKQKPITDLLQLAE--EMGIENMARSRKQDVIFSLLKKHAKS
RHO_ALLVD       -------------MNLTELKKMPVPNLVALAQ--SMDIEGVGRSRKQDLIFAILKAQAKK
RHO_XYLFA       ---------------------MPAHKLLEIAEQ-LNIHEGVARARKQDVIFALLKVLTRH
RHO_NEIGO       -------------MHVSELQTLHISKLLELAE--EHGIENANRFRKQDLVFAIVRQMMKK
RHO_CHRVO       -------------MHLSDLKHLHVSELVEMAI--SNEIDGANRLRKQDLIFALLKNQAKK
RHO_RICCN       NNNYNNFAENGNIINLKQLKRKLPEELQAQAE--ELKIENINSLLKQELVFAILKKSVEQ
RHO_RICFE       NNNHNNFAENGNIINLKQLKRKLPEELQAQAE--ELKIENINSLLKQELVFAILKKSVEQ
RHO_RICPR       NNDHNDFAEN-NIINLKQLKRKLPEELQVQAE--ELKIENISSLLKQELVFAILKKSVEQ
RHO_RICTY       NNDHNDFAEN-NIINLKQLKRKLPEELQVQAE--ELKIENISSLLKQELVFAILKKSVEQ
RHO_RICBR       N---NHYAENGNIINLKELKRKLPEELQAQAE--ELKIENVSSLRKQELVFAILKKSVEQ
RHO_CERS4       -------------LNLADLKAKTPADLLAMAE--EWEIENAPSMRKGEMMFSILKEHAEE
RHO1_EHRCR      ------------MLDLSELKKKTIEDLLKIAE--DLGVVSNGRMLKQEIIFHLMKKVVSD
RHO2_EHRCR      ------------MLDLSELKKKTIEDLLKIAE--DLGVVSNGRMLKQEIIFHLMKKVVSD
RHO_HELPY       SSHKVKTHTPVSGYHIEDLRTYPTEKLLEIAN--KLKVENPQEFKRQDLMFEILKTQVTQ
RHO_HELPJ       SSHKVKTHTPVSGYHIEDLRTYPTEKLLEIAN--KLKVENPQEFKRQDLMFEILKTQVTQ
RHO_FIBSS       DSATLPAPGSEAILKAKENWLKFRKLSMSELQELAVQKEVDFRRMRKQSLNYILQSLENE
RHO_SULMS       ------------------------------------------------------------
RHO_THEMA       ------MSEEQKTISISELESMNIKQLYEIAK--SLGIPRYTSMRKRDLIFAILKAQTES
RHO_AQUAE       TAQQEQQKSEVKIYSREELKQKTLAELQKIGK--ELGLTRTTGLKKEELIEKILKAQLEK
RHO_BACSU       ----------MKDVSISSLENMKLKELYELAR--HYKISYYSKLTKKELIFAILKANAEQ
RHO_RHOBA       VGIPAKDQSPKQALNINDLQKLEHDELLALAE--TEGLQEIAALPRQELVFRLLKARMSA
RHO_DEIRA       ---MTVTEVAPQALPFQELQEKILPELHLLAA--GLGIENYRKLKKDALALAIMEKQADA
RHO_FUSNN       ---------------MDILNKLLLKDLQEIAK--VMEIE-IGVGQKKDELKRIISNSLEE
RHO_STRM9       ----------MENITLDELGNFTLTNLRKLAK--EHKIEGYSTIPKMELLNRLCYSIATA
RHO_AKKM8       VREEEEAAPVLEQIDINELRKRPLNDLQEMAE--GLPIRNAASLTKSQLVFELGKQLLAK
RHO_GEMAT       FDRPERPDRQGESSDRFDSQDRGGNRQRNGRRGRNRFRRGAGGNESAPISGSHAPSQGSP
                                                                            

RHO_MICLU       DVLQPVAGILDVLD--N--YAFVRTS--GYLPGPNDVYVSLAMVKKYGLRKGDAVVGPIA
RHO_STRRD       AYLETVAGLLDVRD--K--TGYIRTH--GYLPGVDDVRVPHAQIRQYGLRPGDHVVA---
RHO_STRLI       DVLIPVAGILDILD--N--YAFIRTS--GYLPGPNDVYVSLAQVRKNGLRKGDHLTGAVR
RHO_MYCTU       DVVQPVAGILDVLD--N--YAFVRTS--GYLPGPHDVYVSMNMVRKNGMRRGDAVTGAVR
RHO_MYCBO       DVVQPVAGILDVLD--N--YAFVRTS--GYLPGPHDVYVSMNMVRKNGMRRGDAVTGAVR
RHO_MYCLE       DVVQPVAGILDVLD--N--YAFVRTS--GYLAGPHDVYVSMSMVRKNGLRRGDAVTGAVR
RHO_STRCO       AQADIASGVLDIET--GG-KGRLRGR--NLQPEPADPALSPALIRRHGLRRGDLVEGVCG
RHO_BORBU       NIDVLFTGVLDVL---SDGYGFLRTASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIR
RHO_TREPA       GGVIFASGSLEIL---PDGYGFLRSPQNSYLPGSDDIYVSPSQIRLFNLKTGDTIYGQIR
RHO_BUCAI       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIR
RHO_BUCAP       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_BUCBP       GEDIFGDGVLEIL---QDGFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_ECOLI       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_ECO57       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_ECOL6       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_SHIFL       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_SALTI       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_SALTY       GEDIFGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
RHO_HAEIN       GEDIFGGGVLEIL---PDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIR
RHO_PSEAE       GEEISGDGVLEIL---QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIIGKIR
RHO_PSEFC       GEEISGDGVLEIL---QDGFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIR
RHO_ALLVD       GEDIYGDGVLEIL---SDGFGFLRSADASYLAGPDDIYVSPSQIRRFALRTGDTISGKIR
RHO_XYLFA       GEGVFADGVLEIL---PDGFGFLRAAEASYLAGPDDTYISPSQIRRFNLRTGDHLSGRIR
RHO_NEIGO       GEGFTCSGTLEIL---PDGFGFLRSADTSYLAGPDDIYVSPTQIRRFNLHTGDTIEGSVR
RHO_CHRVO       GESIFGEGTLEVL---PDGFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEIR
RHO_RICCN       GVLIVGEGVLEVL---PDGFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIR
RHO_RICFE       GGLIVGEGVLEVL---PDGFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIR
RHO_RICPR       GGLIVGEGVLEVL---PDGFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIR
RHO_RICTY       GGLIVGDGVLEVL---PDGFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIR
RHO_RICBR       GGSIVGEGVLEVL---PDGFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGRIR
RHO_CERS4       GYEVGGDGVLEVL---QDGFGFLRSPEANYLPGPDDIYVSPEILRQFSLRTGDTIEGVIV
RHO1_EHRCR      GGAAIGGGVVEIL---SDGFGFLRSPEANYAASGDDVYISAGQIKKFNLRTGDIVSGEIR
RHO2_EHRCR      GGAAIGGGVVEIL---SDGFGFLRSPEANYAASGDDVYISAGQIKKFNLRTGDIVSGEIR
RHO_HELPY       GGYILFTGILEIM---PDGYGFLRGFDGSFSDGHNDTYVSPSQIRRFALRNGDIVTGQVR
RHO_HELPJ       GGYILFTGILEIM---PDGYGFLRGFDGSFSDGHNDTYVSPSQIRRFALRNGDIVTGQVR
RHO_FIBSS       GNIIYTEGVLEVT---PQGHGFLRMPDQNYQTSADDVYVSQNLIRKFNLKIGDTIEGLVR
RHO_SULMS       ------------M---TDKYGFLRSSYTNYLSSSKDVYVSQSQIRLFRIKTGDTIRGEVR
RHO_THEMA       TGYFFGEGVLEIH---PEGFGFLRRIEDNLLPSNDDIYISPSQIRKFNLNTGDIISGVIR
RHO_AQUAE       SRLVFVKGVLEIL---PEGYGFLRMPENNYMPSWNDVYVAPSQIKKFGLRTGDTIEGFAR
RHO_BACSU       EDLLFMEGVLEIIQ--SEGFGFLRPI--NYSPSSEDIYISASQIRRFDLRNGDKVSGKVR
RHO_RHOBA       NGLMYGEGTLEIL---PDGFGFLRSAQYHYLSCPDDIYVSPSQIRRFGLHTGSHVAGQIR
RHO_DEIRA       EGQSLARGYLDIT---SDGYGFLQADLLDPASRS--VLVTAGVIKQYHLRTGDEVIGRAR
RHO_FUSNN       NNTELAYGTLDTA---PEGFGFLKET-----TLGKNIYMSASQIKRFKLRRGDQVLGEVR
RHO_STRM9       EGLIYSYGELDII---NETYGFLRNT-----PQNIDVYVSNSQIKKFGLRQGDVIVGEVR
RHO_AKKM8       GHEVVVSGVMEQA---KDNYAMLRDPVKSFRTSPDDIYLGGNLIKPLHLRVGQQIKVRLR
RHO_GEMAT       SAPIGVEGTMAGWFDPSRDGGFLRRPENSYLPDPTDPFMPPALVRLHQLRRGDRLEVTYG
                                    . ::              :    ::   :. *. :     

RHO_MICLU       PRDGEKQQHHGGGSNRQKFNALVKISSVNGQ--PAVEHPQRVEFGKLVPLYPQERLRLET
RHO_STRRD       -------------TTRKPYERLAEVESVNG----STDWRNRPDFADMTPIHPRERLRLET
RHO_STRLI       --------QPKEGERREKFNALVRLDSVNGM--APEHGRGRPEFNKLTPLYPQDRLRLET
RHO_MYCTU       VP-----KEGEQPNQRQKFNPLVRLDSINGG--SVEDAKKRPEFGKLTPLYPNQRLRLET
RHO_MYCBO       VP-----KEGEQPNQRQKFNPLVRLDSINGG--SVEDAKKRPEFGKLTPLYPNQRLRLET
RHO_MYCLE       VP-----REGEQGHQRQKFNPLVRLDSINGG--SVEDAKKRPEFGKLTPLYPNQRLRLET
RHO_STRCO       --------------DRRTLTDVVRVNGRTP------DRRSRPHFADLTPLHPHERLRLEH
RHO_BORBU       SP-----------RDGERFFAMVKIKSINDQ--DPTFAQNRIPFDNLTPLYPNVKLNLEY
RHO_TREPA       SP-----------KEGERFFAMLRVETVNFE--EVAKVQDRVPFDSLTPLYPREKLNLET
RHO_BUCAI       PP-----------KEGERYFALLKVNEVNYD--KPENARSKILFENLTPLHANSRLRMER
RHO_BUCAP       PP-----------KEGERYFALLKVNAVNYD--KPENARSKILFENLTPLHANSRLRMER
RHO_BUCBP       PP-----------KEGERYFALLKVNKVNYD--KPENARSKILFENLTPLHANSRLRMER
RHO_ECOLI       PP-----------KEGERYFALLKVNEVNFD--KPENARNKILFENLTPLHANSRLRMER
RHO_ECO57       PP-----------KEGERYFALLKVNEVNFD--KPENARNKILFENLTPLHANSRLRMER
RHO_ECOL6       PP-----------KEGERYFALLKVNEVNFD--KPENARNKILFENLTPLHANSRLRMER
RHO_SHIFL       PP-----------KEGERYFALLKVNEVNFD--KPENARNKILFENLTPLHANSRLRMER
RHO_SALTI       PP-----------KEGERYFALLKVNEVNYD--KPENARNKILFENLTPLHANSRLRMER
RHO_SALTY       PP-----------KEGERYFALLKVNEVNYD--KPENARNKILFENLTPLHANSRLRMER
RHO_HAEIN       PP-----------KEGERYFALLKVDQVNDD--KPEVSRSKILFENLTPLHANSRLRMER
RHO_PSEAE       PP-----------KEGERYFALLKVDSINFD--RPENAKNKILFENLTPLFPNERMKMEA
RHO_PSEFC       PP-----------KEGERYFALLKVDTINFD--RPENAKNKILFENLTPLFPTVRMKMEA
RHO_ALLVD       PP-----------KDGERYFALLKVNDINFD--RPENAKSKILFENFTPLFAQKRLTLEI
RHO_XYLFA       FP-----------KDGERYFALSIVDTINGE--PLEASKNKILFENLTPLFPRKRFRLER
RHO_NEIGO       VP-----------KDNERYFALVRLDSINGD--HPEVCRHKILFENLTPLFPTEQLKLER
RHO_CHRVO       TP-----------KDGERYFALVKVDKVNGE--APENSKHKILFENLTPLFPTEQFKLER
RHO_RICCN       AP-----------KAGERYFALLKVNRVNFE--DPSKAYHRVHFDNLTPLYPDEKLGLEL
RHO_RICFE       AP-----------KAGERYFALLKVNRVNFE--DPSKAYHRVHFDNLTPLYPDEKLGLEL
RHO_RICPR       AP-----------KAGERYFALLKVNRVNFE--DPAKAYHRVHFDNLTPLYPDEKLGLEL
RHO_RICTY       AP-----------KAGERYFALLKVNRVNFD--DPVNAYHRVHFDNLTPLYPDEKLGLEL
RHO_RICBR       AP-----------KEGERYFALLKVNKVNFE--DPSKAYHRVNFDNLTPLYPDEKLGLEL
RHO_CERS4       AP-----------RENERYFSLTRVTKINFD--DPERARHKVHFDNLTPLYPDERLKMEV
RHO1_EHRCR      AP-----------SEKERYFTLVKAHSINFT--DMAKLQRYVHFDDLIPLYPEERILLEC
RHO2_EHRCR      AP-----------SEKERYFTLVKAHSINFT--DMAKLQRYVHFDDLIPLYPEERILLEC
RHO_HELPY       SP-----------KDQEKYYALLKIEAINYS--PSDEIRNRPLFDNLTPLFPDEQIKLEY
RHO_HELPJ       SP-----------KDQEKYYALLKIEAINYL--PSDEIKNRPLFDNLTPLFPDEQIKLEY
RHO_FIBSS       TP-----------RDQDKYFSMRRIDRVNFE--EPDKMRRRVAFEYLTPIHPEEKIHLEW
RHO_SULMS       TPNP---------KKGEKYFPLKRIFQINGR--FPTSVIKRKSFKKLTPLFPNEKFQISK
RHO_THEMA       KP-----------KEGEKYFAMIKIEAINYR--PVEAVNDRVNFDNLTPDYPRERFILET
RHO_AQUAE       LP-----------RENEKYKALIRMESVNGLPPDPEILKRRPQFEKLTPLHPMERFKLEY
RHO_BACSU       PP-----------KENERYYGLLHVEAVNGD--DPESAKERVHFPALTPLYPDRQMVLET
RHO_RHOBA       PP-----------KENERYFALLRIEAINHA--DPMQRQRQKPFDDLTPLHPRTRIVTEH
RHO_DEIRA       KP-----------RENERYGSLVRVEAVNGL--DPEAARQRPRFDDLTPTFPDQQLVLED
RHO_FUSNN       KP-----------IGEEKNYAIRRVLKANDN--DLAALESRVPYEELIPTYPTEQFVLGI
RHO_STRM9       KP-----------LNDEKNFGLLKLIYVNGE--KGELSRQRPIFDDLTPSYPIERLELG-
RHO_AKKM8       KL-----------RPHDKYLSAASVISVEDI--PAEDYRARSDFERLTPLFPKERLLLEN
RHO_GEMAT       RD-------------HRGRYLVIEVQTLNDG--SPVVLEKRPDFNTLVASYPDRKLTLET
                                                           :  : . ..  ::    

RHO_MICLU       DPK------LIGPRVIDLVSPIGKGQRGLIVSPPKAGKTMILQSIANAIKTNNPEVHLMM
RHO_STRRD       ES--------VTSRVIDLFAPIGKGQRGLIVAPPKAGKTMVLQDLAAAITRNHPDCHLMV
RHO_STRLI       DPG------VLTTRIIDLVAPIGKGQRGLIVAPPKTGKTMIMQAIANAITHNNPECHLMV
RHO_MYCTU       STE------RLTTRVIDLIMPIGKGQRALIVSPPKAGKTTILQDIANAITRNNPECHLMV
RHO_MYCBO       STE------RLTTRVIDLIMPIGKGQRALIVSPPKAGKTTILQDIANAITRNNPECHLMV
RHO_MYCLE       TPD------RLTTRVIDLIMPIGKGQRALIVSPPKAGKTTILQDIANAITRNNLECHLMV
RHO_STRCO       PAA------GLAGRVVDLLAPVGKGQRGLIVAPPKTGKTVLLQQFAAAVAGNHPEARLMV
RHO_BORBU       ENC------NISTRLINLFSPIGKGQRALIVSPPKAGKTTLLQKIANAITTNYSDVILMI
RHO_TREPA       RTE------DISTRVMNLFCPIGKGQRALIVAPPRTGKTILMQKIANAITQNHPEVYLIV
RHO_BUCAI       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTILLQNIAQSIAYNHPDCVLMV
RHO_BUCAP       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTILLQNIAQSIAYNHPDCVLMV
RHO_BUCBP       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_ECOLI       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_ECO57       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_ECOL6       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_SHIFL       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_SALTI       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_SALTY       GNG---STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMV
RHO_HAEIN       GNG---STEDLTARILDLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSITHNYPDVELIV
RHO_PSEAE       GNG---STEDLTGRVIDLCAPIGKGQRGLIVAPPKAGKTIMLQNIASNITRNNPECHLIV
RHO_PSEFC       GNG---STEDLTGRVIDLCAPIGKGQRGLIVAPPKAGKTIMLQNIAANIARNNPEVHLIV
RHO_ALLVD       GNG---STEDITARTIDLVAPIGKGQRGLIVSPPKAGKTMMLQNIAQSIGHNHPDCYLIV
RHO_XYLFA       ADG---STEDITGRILDLMAPQGKGQRALIVSPPKAGKTMLMQQVATAITTNHPEVHLIV
RHO_NEIGO       DLK---SEENLTGRAIDLISPIGKGQRALLVAPPKIGKTVMLENIAHEVTANYPEVELIV
RHO_CHRVO       EIR---AEENITGRIIDLISPIGKGQRALLVAPPKSGKTVMLQHIAHAITANHPEAVLIV
RHO_RICCN       ENN-SKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIV
RHO_RICFE       ENN-SKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIV
RHO_RICPR       ENN-SKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIV
RHO_RICTY       ENN-SKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIV
RHO_RICBR       EDN-SKD---FSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIV
RHO_CERS4       DDP-TMK--DRSARIIDLVAPIGKGQRGLIVAPPRTGKTVLLQNIAHSIATNHPECYLIV
RHO1_EHRCR      NDPISVSKKDISMRVIDIVAPLGKGQRALIVAPPRAGKTIILQQIAHSISVNHPDIELIV
RHO2_EHRCR      NDPISVSKKDISMRVIDIVAPLGKGQRALIVAPPRAGKTIILQQIAHSISVNHPDIELIV
RHO_HELPY       EPT------KVTGRMLDLFSPVGKGQRALIVAPPRTGKTELMKELAQGITSNHPEVELII
RHO_HELPJ       EPT------KVTGRMLDLFSPVGKGQRALIVAPPRTGKTELMKELAQGITSNHPEVELII
RHO_FIBSS       NET------EYSTRIMDLFSPIGKGQRSIILAPPRTGKTVLLQNVTRAIAKNHPEIILIT
RHO_SULMS       RKV------TLSTRIVDFFSPLGKGQRGIIVAPPKTGKTTLLKEIANTIAYNHPEVYLII
RHO_THEMA       DPK------IYSTRLIDLFAPIGKGQRGMIVAPPKAGKTTILKEIANGIAENHPDTIRII
RHO_AQUAE       DPN------ELSTRVVSLIAPIGKGQRGLIVAPPKAGKTVLLQKIAQAIIRNHPEVYLII
RHO_BACSU       KPN------FLSTRIMDMMAPVGFGQRGLIVAPPKAGKTMLLKEIANSITANQPEAELIV
RHO_RHOBA       DSQ------ELSTRVVDLFTPIGFGQRGLIVSPPRAGKTMLMQSLARGVLNNYPDAYVVV
RHO_DEIRA       PST----DDGLSLRVVDLLVPIGRGQRALIVAPPKAGKTTLLKKIANSITKNYPDVTVMV
RHO_FUSNN       EQG------NISGRILDLISPIGKGQRALIIAPPKAGKTTFISSIANALIEGQKDSEVWI
RHO_STRM9       -EG------TVSSRIIDLIAPIGKGQRGLIVAPPKAGKTTILSDLANDILKYNKDVQVWI
RHO_AKKM8       KGV-----NSAAMRVLDLMTPFGKGQRGLIVAPPRGGKTVLLKTIARSIRANYPEVELIV
RHO_GEMAT       GRP-AKTGPELTRRAIDLIAPIGYGQRALIVAPARAGKTTLLQAIVEGVSINHPEAVLLV
                             * :.:  * * ***.::::*.: *** .:. ..  :     :     

RHO_MICLU       VLVDERPEEVTDMQR--------------SVDGEVIASTFDRPADDHTTLAELAIERAKR
RHO_STRRD       VLVGERPEEVTEMRE--------------SIHGEVAASTFDRPDRDHTALAELAVERAKR
RHO_STRLI       VLVDERPEEVTDMQR--------------SVKGEVISSTFDRPAEDHTTVAELAIERAKR
RHO_MYCTU       VLVDERPEEVTDMQR--------------SVKGEVIASTFDRPPSDHTSVAELAIERAKR
RHO_MYCBO       VLVDERPEEVTDMQR--------------SVKGEVIASTFDRPPSDHTSVAELAIERAKR
RHO_MYCLE       VLVDERPEEVTDMQR--------------SVKGEVIASTFDRPPSDHTSVAELAIERAKR
RHO_STRCO       VLLDERPEEVTDMRR--------------SVRGEVYSSTFDRSARQHIALAELVIERAKR
RHO_BORBU       LLIDERPEEVTDMIR--------------SVKGEVIASNFDEQASRHVQVAEMVIEKAKR
RHO_TREPA       LLIDERPEEVTDMER--------------TVDAEVISSTFDEQATRHVQIAEIVLERAKR
RHO_BUCAI       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_BUCAP       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_BUCBP       LLIDERPEEVTEMRR--------------LVKGEVVASTFDEPSSRHVQVSEMVIEKAKR
RHO_ECOLI       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_ECO57       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_ECOL6       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_SHIFL       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_SALTI       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_SALTY       LLIDERPEEVTEMQR--------------LVKGEVVASTFDEPASRHVQVAEMVIEKAKR
RHO_HAEIN       LLIDERPEEVTEMQR--------------SVKGEVIASTFDEPATRHVQVAEMVIEKAKR
RHO_PSEAE       LLIDERPEEVTEMQR--------------TVRGEVVASTFDEPPTRHVQVAEMVIEKAKR
RHO_PSEFC       LLIDERPEEVTEMQR--------------TVRGEVVASTFDEPPTRHVQVAEMVIEKAKR
RHO_ALLVD       LLIDERPEEVTEMAR--------------SVRGEVISSTFDEPATRHVQVAEMVIEKAKR
RHO_XYLFA       LLIDERPEEVTEMQR--------------TVRGEVISSTFDEPAARHVQVAEMVIERAKR
RHO_NEIGO       LLIDERPEEVTEMSR--------------SVRGEVVSSTFDEPAQRHVQVAEMVLEKAKR
RHO_CHRVO       LLIDERPEEVTEMQR--------------SVRGEVVSSTFDEPATRHVQVAEMVIEKAKR
RHO_RICCN       LLIDERPEEVTDMQR--------------SVRGEVVSSTFDEPASRHVQLAEMVIKKAKR
RHO_RICFE       LLIDERPEEVTDMQR--------------SVRGEVVSSTFDEPASRHVQLAEMVIEKAKR
RHO_RICPR       LLIDERPEEVTDMQR--------------SVRGEVVSSTFDEPASRHVQLAEMVIEKAKR
RHO_RICTY       LLIDERPEEVTDMQR--------------SVRGEVVSSTFDEPASRHVQLAEMVIEKAKR
RHO_RICBR       LLIDERPEEVTDMQR--------------SVRGEVVSSTFDEPASRHVQLAEMVIEKAKR
RHO_CERS4       LLIDERPEEVTDMQR--------------SVKGEVVSSTFDEPATRHVAVAEMVIEKAKR
RHO1_EHRCR      LLIGERPEEVTDMCR--------------SVKGEVVSSTFDEPGYRHVQLAEIVIEKAKR
RHO2_EHRCR      LLIGERPEEVTDMCR--------------SVKGEVVSSTFDEPGYRHVQLAEIVIEKAKR
RHO_HELPY       LLVDERPEEVTDMQR--------------SVKGQVFSSTFDLPANNHIRIAELVLERAKR
RHO_HELPJ       LLVDERPEEVTDMQR--------------SVKGQVFSSTFDLPANNHIRIAELVLERAKR
RHO_FIBSS       LLIDERPEEVTEMRDIITDIKEKAAEKGIEIKAEVVASTFDEPPEHHTRVANMVLEKAKR
RHO_SULMS       LLIDERPEEVTDMQR--------------NVNGEVVYSTFDEPAEKHVKVANIVLQKAKR
RHO_THEMA       LLIDERPEEVTDIRE--------------STNAIVIAAPFDMPPDKQVKVAELTLEMAKR
RHO_AQUAE       LLIDERPEEVTEMRRIV------------KDKAEVVASTFDEPPERHMQVAEIVVEKAKR
RHO_BACSU       LLIDERPEEVTDIER--------------SVAGDVVSSTFDEVPENHIKVAELVLERAMR
RHO_RHOBA       LLIDERPEEVTDMEREIQ-----------SPQCEVISSTFDEPPARHIQVAQMVVEKAKR
RHO_DEIRA       LLVDERPEEVTDFRES-------------VQGAQVIASTFDEPPQHHVRVAEFVHERARR
RHO_FUSNN       LLIDERPEEVTDIKEN-------------VEGATVFASTFDDDPKNHIKVTEEIIEKAKM
RHO_STRM9       ILIDERPEEVTDIKEN-------------VKNAEIFAATFDENTSVHLSVTEKVLEAAKR
RHO_AKKM8       LLLDERPEEVTDFEE--------------TVDAPVFASTFDEPSRRHAQVSDLVIERAKR
RHO_GEMAT       LLVDERPEEVSEMIT--------------WGYGEVVASSFDMPPKRHVEVAEMTLERARR
                :*:.******:::                     :  : **     :  :::   : *  

RHO_MICLU       LVEMGRDVVVLLDSMTRLGRAYNLAAP-ASGRILSGGVDSSALYPPKKFFGAARNIE---
RHO_STRRD       LAESGHDVVVLLDSLTRLGRAYNNLAP-GGGRTLAGGLDAAALLPPRRFFGAARNLR---
RHO_STRLI       LVELGHDVVVLLDSITRLGRAYNLAAP-ASGRILSGGVDSTALYPPKRFFGAARNIE---
RHO_MYCTU       LVEQGKDVVVLLDSITRLGRAYNNASP-ASGRILSGGVDSTALYPPKRFLGAARNIE---
RHO_MYCBO       LVEQGKDVVVLLDSITRLGRAYNNASP-ASGRILSGGVDSTALYPPKRFLGAARNIE---
RHO_MYCLE       LVEQGKDVVVLLDSITRLGRAYNNASP-ASGRILSGGVDSTALYPPKRFLGAARNIE---
RHO_STRCO       LVEAGEDVVILLDSLTRLCRAHNNAAS-SGGRTLSGGVDAGALLGPKRFFGAARKAE---
RHO_BORBU       LVENKKDVVILLDSITRLARAYNQTMP-TSGKILSGGVDSNALHKPKRFFGSARNIE---
RHO_TREPA       LVEHRKDVVILLDSITRLARAYNQTMP-TSGKVLSGGVDSNALHKPKRFFGAARNVE---
RHO_BUCAI       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_BUCAP       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_BUCBP       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_ECOLI       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_ECO57       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_ECOL6       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_SHIFL       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_SALTI       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_SALTY       LVEHKKDVIILLDSITRLARAYNTVVP-ASGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_HAEIN       SVEHKKDVVILLDSITRLARAYNTVTP-ASGKILSGGVDANALHRPKRFFGAARNVE---
RHO_PSEAE       LVEHKKDVVILLDSITRLARAYNTVIP-SSGKVLTGGVDAHALEKPKRFFGAARNIE---
RHO_PSEFC       LVEHKKDVVILLDSITRLARAYNTVIP-SSGKVLTGGVDAHALEKPKRFFGAARNIE---
RHO_ALLVD       LVEHKRDVVILLDSITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNVE---
RHO_XYLFA       LIEHKKDVVILLDSITRLARAYNNVVP-SSGKVLTGGVDANALHRPKRFFGAARNVE---
RHO_NEIGO       MVEHKKDVVILLDSITRLARAYNTVVP-ASGKILTGGVDANALHRPKRFFGAARNVE---
RHO_CHRVO       LVEHKKDVVILLDSITRLARAYNTVVP-ASGKVLTGGVDANALQRPKRFFGAARNVE---
RHO_RICCN       LVEHKKDVVILVDAITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO_RICFE       LVEHKKDVVILVDAITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO_RICPR       LVEHKKDVVILVDAITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO_RICTY       LVEHKKDVVILVDAITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO_RICBR       LVEHKKDVVILVDAITRLARAYNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO_CERS4       LVEHKRDVVILLDSITRLGRAFNTVVP-SSGKVLTGGVDANALQRPKRFFGAARNIE---
RHO1_EHRCR      MVEHKKNVVILLDSITRLARAYNSVIP-SSGKVLTGGVDSNALQRPKRFFGAARNIE---
RHO2_EHRCR      MVEHKKNVVILLDSITRLARAYNSVIP-SSGKVLTGGVDSNALQRPKRFFGAARNIE---
RHO_HELPY       RVEMGKDVVVLLDSITRLARAYNAVTP-SSGKVLSGGVDANALHRPKRFFGAARNIE---
RHO_HELPJ       RVEMGKDVVVLLDSITRLARAYNAVTP-SSGKVLSGGVDANALHRPKRFFGAARNIE---
RHO_FIBSS       LVESQKDVVILLDSITRFARANNVVIP-HSGKILSGGVDANAMQFPKKFFGAARKIQDKI
RHO_SULMS       MVECGHDVVILLDSITRLARAYNTVSP-TSGKILSGGVDSNALQKPKRFFGAARNIE---
RHO_THEMA       LVEFNYDVVILLDSLTRLARVYNIVVP-PSGKLLTGGVDPAALYKPKRFFGAARNTR---
RHO_AQUAE       MVELKKDVVILMDSLTRFTRASNAVTP-PTGRVLTGGIEITAFQRPKKFFGAARNIE---
RHO_BACSU       LVEHKKDVIILMDSITRLARAYNLVIP-PSGRTLSGGIDPAAFHRPKRFFGAARNIE---
RHO_RHOBA       MVESGTDVVIFLDSITRLARAFNSDSDSATGKLLTGGLDAGAMQKPKSIFGSARKVE---
RHO_DEIRA       IVEEGGHVVILLDSITRLARANNLVTP-PTGRTLSGGLDSNALHWPKRFLGAARNIR---
RHO_FUSNN       KVEDGENVVILLDSLTRLARAYNIVMP-SSGKLLSGGIDPTALYHPKNFFGAARNIK---
RHO_STRM9       EIEKGNNIVILMDSLTRLARSYNIEMP-SSGKLLSGGIDPKSLYMPKKFLGAARKIR---
RHO_AKKM8       LVEMGRDVVILLDSLTRLARGYNANQT--GGRIMSGGLGSNALEKPRKFFSAARNVE---
RHO_GEMAT       LVEQGKDVVIVLDSITRLARAHNTVDR-GTGRTMSGGLDATAMQKPKAFFGSARMIAPQH
                  *   .:::.:*::**: *  *       *: ::**:   ::  *: ::.:**      

RHO_MICLU       ---------------NGGSLTILATALVETGSRMDEVIFEEFKGTGNMELRLSRHLAERR
RHO_STRRD       ---------------DGGSLTILATALVETGSRMDDNLFEEFKGTGNMELRLSRALADKR
RHO_STRLI       ---------------DGGSLTILATALVDTGSRMDEVIFEEFKGTGNAELKLDRKLADKR
RHO_MYCTU       ---------------EGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERR
RHO_MYCBO       ---------------EGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERR
RHO_MYCLE       ---------------EGGSLTIIATAMVETGSTGDMVIFEEFKGTGNAELKLDRKIAERR
RHO_STRCO       ---------------EGGSLTILATALVETGSRADDFYFEELKSTGNMELRLSREPASRR
RHO_BORBU       ---------------EGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRR
RHO_TREPA       ---------------EGGSLTIIATALIETGSRMDEVIFEEFKGTGNMEINLDRRLSDRR
RHO_BUCAI       ---------------EGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKR
RHO_BUCAP       ---------------EGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKR
RHO_BUCBP       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKR
RHO_ECOLI       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_ECO57       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_ECOL6       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_SHIFL       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_SALTI       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_SALTY       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKR
RHO_HAEIN       ---------------EGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAERR
RHO_PSEAE       ---------------EGGSLTILATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKR
RHO_PSEFC       ---------------EGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKR
RHO_ALLVD       ---------------EGGSLTILATALVDTGSRMDDVIYEEFKGTGNMEIHMDRRIAEKR
RHO_XYLFA       ---------------EGGSLTIIATALIDTGSKMDEVIYEEFKGTGNCELHLNRRIAEKR
RHO_NEIGO       ---------------EGGSLTIIATALVETGSRMDDVIYEEFKGTGNMELHLDRRIAEKR
RHO_CHRVO       ---------------EGGSLTIVATALIDTGSRMDDVIYEEFKGTGNSEIHLDRRMAEKR
RHO_RICCN       ---------------NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKR
RHO_RICFE       ---------------NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKR
RHO_RICPR       ---------------NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKR
RHO_RICTY       ---------------NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKR
RHO_RICBR       ---------------NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKR
RHO_CERS4       ---------------EGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKR
RHO1_EHRCR      ---------------NGGSLTIIATALIETGSKMDEVIFEEFKGTGNCEIILDRKISDKR
RHO2_EHRCR      ---------------NGGSLTIIATALIETGSKMDEVIFEEFKGTGNCEIILDRKISDKR
RHO_HELPY       ---------------EGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEIVLARNIADRR
RHO_HELPJ       ---------------EGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEIVLARNIADRR
RHO_FIBSS       RTVKNEDGTISEEVQKNGSLTIIGTALIETGSRMDEVIFEEFKGTGNMELVLDRRIAEKR
RHO_SULMS       ---------------YGGSLSIIATAIIETGSKMDEVIFEEFKGTGNMELQLDRKIANKR
RHO_THEMA       ---------------EGGSLTIIATALVETGSKMDEVIFEEFKGTGNMELVLSRQLANKR
RHO_AQUAE       ---------------EGGSLTIIATALVETGSKMDDVIYEEFKGTGNMEIHLDRRLMERR
RHO_BACSU       ---------------EGGSLTILATALVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERR
RHO_RHOBA       ---------------EGGSLTILATALVDTGSRMDDVIFEEFKGTGNLEIVLDQDLVARR
RHO_DEIRA       ---------------EGGSLTILATALVETGSRMDDVIFEEFKGTGNAELVLSRRLEERR
RHO_FUSNN       ---------------DGGSLTIIATILVDTGSKMDEVIYEEFKSTGNCDIYLDRQLAEFR
RHO_STRM9       ---------------GGGSLTILATALIETGSRMDEVIFEEFKGTGNMELVLDRALQQLR
RHO_AKKM8       ---------------EGGSLTIIATCLVDTESRMDEVIFEEFKGTGNLEIRLDRELSERR
RHO_GEMAT       G---------------GGSLTIIATALVETGSRMDDVIFEEFKGTGNCEIKLDRSLADRR
                                .***:*:.* :::* *  *   :**:*.*** :: : :     *

RHO_MICLU       IFPAVDVNASGTRREEALLSQEEVKIMWKLRRVLSGL-EQQQALDLLTNKIKDTASNAEF
RHO_STRRD       LYPAVDLDASGTRREEILLDPQEHQLTWRLRRTLGGL-EKQQALELLTDRLRETPSNAAF
RHO_STRLI       IFPAVDVDASGTRKEEILLGSDELAITWKLRRVLHAL-DQQQAIELLLDKMKQTKSNAEF
RHO_MYCTU       VFPAVDVNPSGTRKDELLLSPDEFAIVHKLRRVLSGL-DSHQAIDLLMSQLRKTKNNYEF
RHO_MYCBO       VFPAVDVNPSGTRKDELLLSPDEFAIVHKLRRVLSGL-DSHQAIDLLMSQLRKTKNNYEF
RHO_MYCLE       VFPAVDVNPSGTRKDELLLSPDEFGIVHKLRRVLSGL-DSHQAIDLLMSQLRKTKTNYEF
RHO_STRCO       VFPAVEPVGSGTRREELLLSGAETTALRGLRRALVAR-DGQSGLETLLERLRRTPDNATF
RHO_BORBU       LFPAINIKKSGTRKEELLLSEEERSKILLIRRILGGV-DDYEGVEVLIEKMKKSKNNEIF
RHO_TREPA       LFPAVSIKKSGTRKEELLLTEEEMQRIWVLRKVINPM-DDAEIVELLIDKMRKTKNNEAF
RHO_BUCAI       VFPAIDYNRSGTRKEELLTLPDELQKMWILRKIIHPM-SEIDAMEFLLNKLAMTKTNDEF
RHO_BUCAP       VFPAIDYNRSGTRKEELLTLPDELQKMWILRKIIHPM-SEIDAMEFLLNKLSMTKTNDEF
RHO_BUCBP       VFPAIDYNRSGTRKEELLTKSDELQKMWILRKIIHPM-SEIDAMEFLINKLAMTKTNNEF
RHO_ECOLI       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_ECO57       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_ECOL6       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_SHIFL       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_SALTI       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_SALTY       VFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPM-GEIDAMEFLINKLAMTKTNDDF
RHO_HAEIN       VFPAIDFKRSGTRKEDLLTTADELQKMWILRKILNPM-DEVDAMEFLIDKLMMAKTNEEF
RHO_PSEAE       VFPAININRSGTRREELLTSEDELQRMWILRKILHPM-DEISAIEFLIDKLKQTKTNDEF
RHO_PSEFC       VFPAININRSGTRREELLTADDELQRMWILRKLLHPM-DEVAAIEFLIDKLKTTKTNDEF
RHO_ALLVD       IFPAININRSGTRREELLMGQAELQKMWILRKILHPM-DELAAMEFLHDKLKATKTNDEF
RHO_XYLFA       VYPAIDINRSGTRREDLLIESDLLQKIWILRKLLHPM-DEIAAIEFVLDKMKNTKSNDEF
RHO_NEIGO       LFPAININKSGTRREELLVPNDQLQRMWLLRKFLHPM-DEIEATEFLNGKIKASKNNDDF
RHO_CHRVO       IFPALNINRSGTRREELLVPQDQLQRIWVLRKLLYPM-DDLEAMEFLQDKIKATKSNQAF
RHO_RICCN       IYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIIDPM-GSSEAIEFLLKKLENTKTNGEF
RHO_RICFE       IYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIIDPM-GSSEAIEFLLKKLENTKTNGEF
RHO_RICPR       IYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIIDPM-GSSEAIEFLLKKLENTKTNCAF
RHO_RICTY       IYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIIDPM-GSSEAIEFLLKKLENTKTNYEF
RHO_RICBR       IYPAIDITRSGTRKEDLLVDKIVLNKMWVLRRIIDPM-GSSEAIEFLLKKLEHTKTNNEF
RHO_CERS4       VFPAMDILKSGTRKEDLLVDKSDLQKTYVLRRILNPM-GTTDAIEFLISKLRQTKSNAEF
RHO1_EHRCR      VYPAIDISKSGTRKEDMLIDSVCLKKVWLLRRLLSSM-GSVEAMEFLRDKLLITKDNNEF
RHO2_EHRCR      VYPAIDISKSGTRKEDMLIDSVCLKKVWLLRRLLSSM-GSVEAMEFLRDKLLITKDNNEF
RHO_HELPY       IYPAFDILKSGTRKDNILLGKDRLTKVWVLRNVMQQM-DDIEALSFVYSKMQQTKDNEEF
RHO_HELPJ       IYPAFDILKSGTRKDNILLGKDRLTKVWVLRNVMQQM-DDIEALSFVYSKMQQTKDNEEF
RHO_FIBSS       IWPAIDVFKSGTRKEERLLTLLEQNAAWNFRRGSQNE-TETGIMENLLKLMSKLKTNAEL
RHO_SULMS       IFPAIDLNASSTRKEEFLLTKYNLNKMFLIRKLLAEM-TSVEAIDFIKTRLMKTKNNQEF
RHO_THEMA       IFPAINLLLSGTRREELLLDEETLKKVWLLRRMLSAM-TEEEGLTLILNKLSETSSNEEF
RHO_AQUAE       IFPAINIEKSGTRKEELLLEPWELQRIWVLRKFLSTM-DPVEAMEFLLEKLRRFKTNEEF
RHO_BACSU       IFPAIDIRRSGTRKEELLVPKEHLDRLWSIRKTMS---DSPDFAEKFMRKMKKTKTNQEF
RHO_RHOBA       VWPAIDLTRSGTRREEMLLDQEEHRRIETLRRDLAEH-SPVDSMTELIKRMRKTQNNAEF
RHO_DEIRA       IFPALDILKSGTRREELLLQPEVLKKMWLLRKVISDM-DPADAMEMLLGRMGKTRNNVEF
RHO_FUSNN       IFPAIDITKSGTRKEELLLNKNQIDDIWNLRRLLNDYDNKVSATSALIKAIKTTRNNDEL
RHO_STRM9       LFPAVDILKSGTRKEELLYSKREFDSILKLRKFLLKL-NEAEALKFLMDLIKRYSSNKDL
RHO_AKKM8       IYPAISLSQSGTRNDDRLYNEQEFVKIMQLRRQLAMK-PGWEGLQTLLQNISKTQNNAEL
RHO_GEMAT       IFPAFDIATSGTRREEKLYRPDQLEKVHLLRRGLHQL-PPQAGMEWLIKRIAATTNNDSL
                ::**..   *.**.:: *           :*.              .   :     *  :

RHO_MICLU       LMLVSKTTLGSKGDD----------
RHO_STRRD       LQQVRQTT-----------------
RHO_STRLI       LIQIQKTTPTPGNGD----------
RHO_MYCTU       LVQVSKTTPGSMDSD----------
RHO_MYCBO       LVQVSKTTPGSMDSD----------
RHO_MYCLE       LVQVSKTTPGSMDDD----------
RHO_STRCO       LRQVQPTLPAG--------------
RHO_BORBU       LKTMSNGN-----------------
RHO_TREPA       LRSMNTGAFSS--------------
RHO_BUCAI       FDMMKRS------------------
RHO_BUCAP       FDMMKRS------------------
RHO_BUCBP       FDMMKRS------------------
RHO_ECOLI       FEMMKRS------------------
RHO_ECO57       FEMMKRS------------------
RHO_ECOL6       FEMMKRS------------------
RHO_SHIFL       FEMMKRS------------------
RHO_SALTI       FEMMKRS------------------
RHO_SALTY       FEMMKRS------------------
RHO_HAEIN       FEVMKRS------------------
RHO_PSEAE       FDSMKRK------------------
RHO_PSEFC       FLSMKRK------------------
RHO_ALLVD       FSSMKG-------------------
RHO_XYLFA       FGSMKR-------------------
RHO_NEIGO       FELMRGK------------------
RHO_CHRVO       FDSMRR-------------------
RHO_RICCN       FEMMKSPERPKNGL-----------
RHO_RICFE       FEMMKSPERPKNGL-----------
RHO_RICPR       FEMMKSPERPRNGL-----------
RHO_RICTY       FEMMKSPERSRNGL-----------
RHO_RICBR       FEMMKSPAERK--------------
RHO_CERS4       FDSMNT-------------------
RHO1_EHRCR      FDMMNS-------------------
RHO2_EHRCR      FDMMNS-------------------
RHO_HELPY       LNLMNEK------------------
RHO_HELPJ       LNLMNEK------------------
RHO_FIBSS       LAVLSKPKV----------------
RHO_SULMS       FKSIKSSIKSSIKSSRDRENIEKKI
RHO_THEMA       LKLIDKEKARY--------------
RHO_AQUAE       LKAMNA-------------------
RHO_BACSU       FDILNQEWKQANLSSARR-------
RHO_RHOBA       LMSVHPQD-----------------
RHO_DEIRA       LAALAG-------------------
RHO_FUSNN       LAQLPKVLYK---------------
RHO_STRM9       LENIDYELKL---------------
RHO_AKKM8       LLTGLR-------------------
RHO_GEMAT       LDGL---------------------
                :