CLUSTAL format seed alignment for MF_01885

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRML_ECOLI            ------------------------------------------------------------
TRML_ECOL6            ------------------------------------------------------------
TRML_YERPE            ------------------------------------------------------------
TRML_PHOAA            ------------------------------------------------------------
TRML_HAEIN            ------------------------------------------------------------
TRML_AERHH            ------------------------------------------------------------
TRML_SACD2            ------------------------------------------------------------
TRML_SHEPW            ------------------------------------------------------------
TRML_BURCM            ------------------------------------------------------------
TRML_BURCH            ------------------------------------------------------------
TRML_BURP0            ------------------------------------------------------------
TRML_POLSJ            ------------------------------------------------------------
TRML_ACISJ            ------------------------------------------------------------
D5CND7_SIDLE          ------------------------------------------------------------
TRML_METGS            ------------------------------------------------------------
Q4FSD6_PSYA2          ------------------------------------------------------------
D6SYT0_GARVA          MNNSENTQEAAAKTKKQTEAHKAAASRVEQMYEYGYRKSNYGPDELVTDAHGNPISVMDA
D2RC33_GARV4          MNNSENTQEAAAKTEKQTEAHKAAASRVEQMYEYGYRKSNYGPDELVTDAHGNPISVMDA
B1VF40_CORU7          ----------------------------------------------MSSQPSTPASAAGR
H6R1P2_NOCCG          ------------------------------------------------------------
D2NS65_ROTMD          -----MVEVDAAVLTVGFCAHGSSCWVIGGFFASFILSRSIRTLLGVFTYGGAGERYCPG
A1AX54_RUTMC          ------------------------------------------------------------
C8W249_DESAS          ------------------------------------------------------------
Q6ME93_PARUW          ------------------------------------------------------------
Q7VJ65_HELHP          ------------------------------------------------------------
TRML_LISIN            ------------------------------------------------------------
TRML_LISMF            ------------------------------------------------------------
TRML_GEOSE            ------------------------------------------------------------
TRML_BACSU            ------------------------------------------------------------
TRML_STRPM            ----------------------------------------------------------MT
B4U4Q2_STREM          ------------------------------------------MTPGSVVFLMKRVSETSM
TRML_LACLM            ------------------------------------------------------------
TRML_LACGA            ------------------------------------------------------------
A6TU52_ALKMQ          ------------------------------------------------------------
TRML_MYCGE            ------------------------------------------------------------
TRML_MYCPN            ------------------------------------------------------------
Q8EX40_MYCPE          ------------------------------------------------------------
B5ZB78_UREU1          ------------------------------------------------------------
Q2SSB5_MYCCT          ------------------------------------------------------------
B3PMI3_MYCA5          ------------------------------------------------------------
Q4A5J5_MYCS5          ------------------------------------------------------------
A9NFI2_ACHLI          ------------------------------------------------------------
C7N513_SLAHD          ------------------------------------------------------------
D4H0Y4_DENA2          ------------------------------------------------------------
D3PE16_DEFDS          ------------------------------------------------------------
D1AYS9_STRM9          ------------------------------------------------------------
A7I2Q8_CAMHC          ------------------------------------------------------------
B0S1H3_FINM2          ------------------------------------------------------------
A5FNU8_FLAJ1          ------------------------------------------------------------
Q6MR30_BDEBA          ------------------------------------------------------------
Q6ALW4_DESPS          ------------------------------------------------------------
B3E096_METI4          ------------------------------------------------------------
C1ADV2_GEMAT          ------------------------------------------------------------
B2ULK7_AKKM8          ------------------------------------------------------------
Q28L85_JANSC          ------------------------------------------------------------
B8FJE9_DESAL          ------------------------------------------------------------
Q7TU01_RHOBA          --------------------------------------------------MLRPIANRKN
D5SW20_PLAL2          ------------------------------------------------------------
D2QZG9_PIRSD          ------------------------------------------------------------
Q46177_CHLCI          ------------------------------------------------------------
TRML_SYNY3            ------------------------------------------------------------
B0JGD9_MICAN          ------------------------------------------------------------
Q7VBW7_PROMA          --------------------------------------------------------MDKK
Q0IAI9_SYNS3          --------------------------------------------------------MNKV
A0A0H3A7K1_DESVV      ---------------------------------------------MPRHGRCRGFSARRL
A0LIX2_SYNFM          ------------------------------------------------------------
Q1DAP8_MYXXD          ------------------------------------------------------------
B1ZVY6_OPITP          ------------------------------------------------------------
D3PKC6_MEIRD          ------------------------------------------------------------
Q9RXS5_DEIRA          ------------------------------------------------------------
A0L4J2_MAGMM          ------------------------------------------------------MNQIFQ
I0IEP0_PHYMF          ------------------------------------------------------------
I4B8P9_TURPD          -------------------------------------------------------MAETL
Q04QK1_LEPBJ          ------------------------------------------------------------
B0SLR8_LEPBP          ------------------------------------------------------------
D8IBC8_BRAP9          ------------------------------------------------------------
TRML_BEII9            ------------------------------------------------------------
B7KZ70_METC4          ------------------------------------------------------------
TRML_STAND            ------------------------------------------------------------
Q2J0V1_RHOP2          ------------------------------------------------------------
Q13BK0_RHOPS          ------------------------------------------------------------
B6IWV5_RHOCS          ------------------------------------------------------------
Q1MDJ8_RHIL3          ------------------------------------------------------------
C6AT32_RHILS          ------------------------------------------------------------
A6WZD2_OCHA4          ----------------------------------------------------MFRLLPPS
Q11GB2_CHESB          ------------------------------------------------------------
A5V645_SPHWW          ------------------------------------------------------------
Q5NNY4_ZYMMO          ------------------------------------------------------------
D4Z5K6_SPHJU          ------------------------------------------------------------
C6XPF2_HIRBI          ------------------------------------------------------------
Q0ARQ9_MARMM          ------------------------------------------------------------
Q9AAX1_CAUVC          ------------------------------------------------------------
Q4FPG4_PELUB          ------------------------------------------------------------
                                                                                  

TRML_ECOLI            --------------MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWD----DK
TRML_ECOL6            --------------MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWD----DK
TRML_YERPE            --------------MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWD----DK
TRML_PHOAA            --------------MLNIVLFEPEIPPNTGNIIRLCANTGFQLHLIQPLGFTWD----DK
TRML_HAEIN            --------------MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWD----DK
TRML_AERHH            --------------MLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIEPLGFEWD----DK
TRML_SACD2            --------------MFNIVLFEPEIPPNTGNIIRVCANTGCRLHLIEPLGFELD----DK
TRML_SHEPW            --------------MFHIALYEPEIAPNTGNIIRLIANNGCQLHLIEPLGFDLE----DK
TRML_BURCM            --------------MFNVILVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLD----DA
TRML_BURCH            --------------MFNVVLVAPEIPPNTGNVIRLCANTGAHLHLIEPLGFPLD----DA
TRML_BURP0            --------------MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLD----DA
TRML_POLSJ            --------------MFNIVLVEPEIPPNTGNVIRLAANTGCRLHLVEPLGFSMD----DK
TRML_ACISJ            --------------MFHIVLVEPEIPPNTGNVIRLAANTGCMLHLVEPLGFSME----DP
D5CND7_SIDLE          --------------MFNVILYQPEIPPNTGNVIRLCANTGAHLHLIRPLGFDLD----DK
TRML_METGS            --------------MFDIVLYQPEIPPNTGNIIRLCANTGTRLHLVKPLGFSLE----DK
Q4FSD6_PSYA2          -------------MTIHIVLVAPKMPSNTGNIIRLCANSGAQLHLVKPLGFELD----DK
D6SYT0_GARVA          MLSADDAAR-AETHTPHLCFYSPRIPGNTGSAIRLCAVTGTILHLVEPLGFNLH----DT
D2RC33_GARV4          MLSADDAAR-AETHTPHLCFYSPRIPGNTGSAIRLCAVTGTILHLVEPLGFNLH----DT
B1VF40_CORU7          SSSLTTSPRPAAEPPFHILFDQPQIPPNTGNAIRMCAGTGATLHLAGPLGFNFE----EK
H6R1P2_NOCCG          --------------------------------------------MIEPLGFDLS----EP
D2NS65_ROTMD          MLNAGRGLRGTLRNVFKILFYTPEIPGNTGNAIRLAAITGAELHLVKPLGFNFD----DA
A1AX54_RUTMC          --------------MLNLVLFEPEIPNNTGAIIRLCANMGANLRLIKPYGFEME----DK
C8W249_DESAS          ---------------MHIVLVEPEIPANTGNIVRTCAATSSVLHLVRPLGFSTE----DK
Q6ME93_PARUW          ---------------MKIILFQPQIPQNAGNIVRTCAVTGTDLMMVHPLGFSTH----DR
Q7VJ65_HELHP          ------------MTAFQIVLVQPQIPQNTGNIGRLCVATDSVLHLIHPLGFSTT----QK
TRML_LISIN            -------------MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTD----DK
TRML_LISMF            -------------MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTD----DK
TRML_GEOSE            -------------MALHVVLFQPEIPANTGNIARTCAATNTALHLIRPLGFSTD----DK
TRML_BACSU            ----------MNIVALHVVLYQPEIPANTGNIARTCAATNTTLHLIRPLGFSTD----DK
TRML_STRPM            TKELINKNDKVKKARNHIVLFQPQIPQNTGNIARTCAATNAPLHIIKPMGFPID----DR
B4U4Q2_STREM          KQEIINRQYREKNSRNHVVLFQPQIPQNTGNIARTCAATNTPLHIIRPMGFPID----DR
TRML_LACLM            --------------MNHIALFEPRIHFNTGNIARTCAATNTVLHLIEPFGFEIS----DK
TRML_LACGA            -------------MTNHVVLYEPLMPANTGNIARTCAGTNTILDLIEPLGFQID----NK
A6TU52_ALKMQ          -----MEEWEAVELALHVVLLEPEIPQNTGNIARTCVATGATLHLIGPMGFSID----EK
TRML_MYCGE            ----------MYKSVINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLN----DK
TRML_MYCPN            ----------MYKSAINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLN----DK
Q8EX40_MYCPE          --------------MLNIVLFQPEIPENTGNISRTCVGFNATLHMIRPFGFILN----DK
B5ZB78_UREU1          --------------MLHIVLFEPEIILNTGNIARMCVGFNANLHLIRPYGFILDKARFDK
Q2SSB5_MYCCT          ----------MNKRKINIVLYQPEIAQNVGAIMRTCVAINARLHIIEPLGFIFD----DR
B3PMI3_MYCA5          --------------MINVILYQPEISPNTANIIRTCFATNAKLHIIKPTAFDLH----PH
Q4A5J5_MYCS5          --------------MLNIVLYQPEISPNTANIIRSCYALGAKLHIIKPLGFDLH----PK
A9NFI2_ACHLI          --------------MIHVVLCQPEIPQNTGNIMRTCVGSGVHLHLIKPLGFKID----DT
C7N513_SLAHD          ---------MSDKPHIHVVLFEPEIPQNTGNVARTCAVVGATLHLVEPMGFRLT----ER
D4H0Y4_DENA2          --------------MLNIVLYEPEIPQNTGNIGRFCVGTESRLILVGKLGFSLD----DK
D3PE16_DEFDS          ---------------MIVALFEPEIPQNTGNIARLCAVTDTKLLLVGRLGFSIS----DK
D1AYS9_STRM9          ---------------MNIVLYQPEMPYNTGNIGRSCVITNTTLHLIKPLGFEIS----DK
A7I2Q8_CAMHC          --------------MFNIVLVHPQIPQNTGAIGRLCINANLKLHIVKPTIFSLD----EK
B0S1H3_FINM2          --------------MLNIVLLEPEKPSNTGNIGRTCVLTNTRLHLVRPFSFRLD----DK
A5FNU8_FLAJ1          --------------MLNVVLVEPEIPNNTGNIGRLCVGTESRLHLIHPFGFVIN----DK
Q6MR30_BDEBA          --------MPNTEKLFRIVLIEPEIPQNTGNIGRTCVGTNCELHIVGKMGFEIN----DT
Q6ALW4_DESPS          -MTTYRCPTVDYTSHLNIVLVEPEIPPNTGSIARLCGATNAILHLVHPLGFSTD----DK
B3E096_METI4          ----MEWPMEH--QGLGVVLVAPQIPQNTGNIARICAATFSELHLVKPLGFSLE----DA
C1ADV2_GEMAT          -------------MATHVVLVHPEIHWNTGNAGRTCLATGATLHLIEPLGFSLG----ER
B2ULK7_AKKM8          -----------MQPRFHIVMFHPEIPHNTGAAGRLALATGSRLHLIKPLGFSLD----EK
Q28L85_JANSC          -MPDEMSRPQPGQVDMKVVLVHPEIPGNTGTIGRTCVALDLELILIHPLGFDIS----EK
B8FJE9_DESAL          -------------MERHIVLVEPEIHWNTGNIGRTCLGAGADLHLIKPLGFSLD----SS
Q7TU01_RHOBA          VTLMSDSLPLSVQPPAHVVLYQPEIPQNTGNIGRTCVAVGAKLWIVEPASFQFD----EK
D5SW20_PLAL2          ----------MIAPLLHVVLYQPDIPQNTGNIGRTCVAVGARLWLIRPLGFVLD----AR
D2QZG9_PIRSD          ---MRVTVSAKYVPRLHVILWHPEIPPNTGNIGRSCVAVGAKLWLVRPLGFDIS----EK
Q46177_CHLCI          ---------------MKVVLYNPDIPQNTGNIGRTCIALGAELILVRPLGFSLL----DK
TRML_SYNY3            --------------MVKLVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFELG----DR
B0JGD9_MICAN          ----------MTEAILRVVLINPQIPPNTGNIARTCAATRTELHLVGPLGFEIS----DR
Q7VBW7_PROMA          -----------IINKLSIALYEPRIPQNTGNIGRTCLAFDFDLHLILPLGFEIN----NK
Q0IAI9_SYNS3          SNNQSSEEQSLIQKPLRVALFEPRIPPNTGNIARTCAAFGLPLDLIEPLGFSLE----DR
A0A0H3A7K1_DESVV      RGSVPSPQPAAAGAMMHIVLYHPEIPPNTGNVARLCAATRTRLHLIEPLGFSLD----DR
A0LIX2_SYNFM          ------MVGHGGKSVFQVVLYQPEIPQNTGNIARTCAATHTPLHLVEPLGFRIT----DR
Q1DAP8_MYXXD          -------MLEPLARPLHLVLVSPQIPPNTGNVARLCAVTGCRLILVEPLGFSID----DR
B1ZVY6_OPITP          --------------MIHVVLFQPEIAPNTGNVGRMCALTRSRLHLIHPLGFVIN----DR
D3PKC6_MEIRD          --------------MFKVVLYQPEIPQNAGNIARTCAATGAELHLIRPLGFQWN----SA
Q9RXS5_DEIRA          -----MTDAEASGPLLHVVLFEPEKAGNVGNVARTCSVLGAELHLIRPFGFHLH----DR
A0L4J2_MAGMM          QPDASAPAPTLPDTLLHVVLYRPEIPPNTGNIQRICAATGAMLHLVGPIAFRLD----NA
I0IEP0_PHYMF          ----MSGPTHEPPARFHAVQYHPAIPQNTGNIARTCVAFGARLHLIHPMKFAID----EH
I4B8P9_TURPD          HTGQNLSNTSAEIAGPTIVLHRPQIPQNTGNVSRLCVALNSELIITGKAGFEFD----SA
Q04QK1_LEPBJ          -------------MPLHIGLYRPEIPPNTGNIARLCVALGAELHIIGQASFDLS----EK
B0SLR8_LEPBP          ---------------MEIALFRPEIPPNTGNIARLCVNAGVPLSIVGEPAFDLS----EK
D8IBC8_BRAP9          --MKDKINISNENFNVSIALYRPEIPSNTGNIGRLCVGLNISLHIVSKPSFILS----AK
TRML_BEII9            ----------------MLALYQPDIPQNCGTMLRLCACLGVEAAIIEPAGFPVS----DR
B7KZ70_METC4          --------------MLRLALYQPDIPQNTGTMLRMSACLGIAVEIIEPAGFDVS----DR
TRML_STAND            -------------MTLALALYEPDIAQNAGTLARAVACLGLELHIVEPAGFPVG----DA
Q2J0V1_RHOP2          ---------------MRIALYQPDIPQNTGTLLRFCACLNVEAHIIEPAGFPTS----DR
Q13BK0_RHOPS          ---------------MRIALYQPDIPQNTGTLLRFCACLNLEAHIIEPAGFPTS----DR
B6IWV5_RHOCS          ---------------MRIALFQPDIPQNAGTLIRTGACLDVPVDIVEPCGFILD----DT
Q1MDJ8_RHIL3          ------------MTSLRLALYQPDIPGNTGTILRLAACLGFAVDLIEPAGFDIS----DR
C6AT32_RHILS          ------------MTSLRLALYQPDIPGNTGTILRLAACLGFAVDLIEPAGFDIS----DR
A6WZD2_OCHA4          VLAAICISRYPHHMELRVALYQPDIPGNTGTILRMAACLGFAVDLIEPAGFDIS----DR
Q11GB2_CHESB          ----------MPQLGFRIALFQPDIPGNTGAILRLSACLGLAVDLIEPAGFDLS----DR
A5V645_SPHWW          ---------------MRIALHQPDIAGNVGTILRMAACFGVPVDIIEPCGFPFS----ER
Q5NNY4_ZYMMO          ---------------MRIALFQPDIAGNVGTILRTAACFGVGVDIIEPCGFAFS----DR
D4Z5K6_SPHJU          -----------MARGMRIALYQPEIAGNVGAILRLAACFSVPVDIIMPTGFAFS----DA
C6XPF2_HIRBI          ---------------MQIAFYQPDIPQNLGSNFRIAACFSTKVDIIGPCGFPLT----AK
Q0ARQ9_MARMM          ---------------MRIVFFQPDIPQNLGAAMRVAACFGAELDIIEPCAFPLT----DK
Q9AAX1_CAUVC          ---------MVGSLIMRIALFQPGIPQNVGACIRLTACFGLGLDVIEPCSFPLN----DK
Q4FPG4_PELUB          -----------MNLRPKIALYEPDIPQNTAAIIRTCACLGADLEIIEPCGFLFS----DK
                                                                  :     *         

TRML_ECOLI            RLRRAGLDYH-EFTAVTRHHDYRAFLEAE--------------------------NPQRL
TRML_ECOL6            RLRRAGLDYH-EFTAVTRHHDYRAFLEAE--------------------------NPQRL
TRML_YERPE            RLRRAGLDYH-EFADIKHHHDYQAFLDSEKL---------------------DSTQPARL
TRML_PHOAA            RLRRAGLDYH-EFANIKQHHDYHSFLENEGV---------------------TGESFARL
TRML_HAEIN            RLRRSGLDYH-EFAEIKRHKTFEAFLESE--------------------------KPKRL
TRML_AERHH            RVKRAGLDYH-EFAEVKRWPNFEAFLEAV--------------------------APTRV
TRML_SACD2            RLRRAGLDYG-EWQSVVTHANWDAFIKQQ--------------------------APERL
TRML_SHEPW            KLRRAGLDYA-DLANVSHHKNFESFLKAM--------------------------QGKRI
TRML_BURCM            KMRRAGLDYH-EYAEMRVHRDWDAFVAA------------------------EAPDPARM
TRML_BURCH            RMRRAGLDYH-EYAQMRVHRDWDAFVAA------------------------ETPDPARM
TRML_BURP0            KMRRAGLDYH-EYAQMRVHRDWDAFVAA------------------------EAPDPARM
TRML_POLSJ            HMRRAGLDYH-EYAQVLRHASWQALLDS------------------------QRPPAGRL
TRML_ACISJ            LMRRAGLDYH-EYAEVRRHPGWTALLRD------------------------MQPDLSRM
D5CND7_SIDLE          NLRRAGLDYH-EYASVRVYDTLVECLDTLPLATALPHPNPPPGGEGTSVSLRELADTRRA
TRML_METGS            QLKRAGLDYH-EYANMQVHENWEACCAA--------------------------LAGRRM
Q4FSD6_PSYA2          KLRRAGLDYH-EYAHLQVHDDWSVAKQAL-----------------------QDADCHTI
D6SYT0_GARVA          KLRRAGLDYH-DMAHVVLHPNFENLVESMP--------------------------NSRI
D2RC33_GARV4          KLRRAGLDYH-DMAHVVLHPNFENLVESMP--------------------------NSRI
B1VF40_CORU7          HVRRAGLDYH-DLANVQLHEDFEAAAAHLTGLSRQQ-------------AAAGAQPQTRI
H6R1P2_NOCCG          KLRRAGLDYH-DLASVTVHADLAAAWEAIR--------------------------PERV
D2NS65_ROTMD          HLRRAGLDYH-DLAVVTVHETLEDAWEALA--------------------------PERV
A1AX54_RUTMC          KLRRAGLDYK-ELMCVSEYDNFDDYLEKEK--------------------------PKNL
C8W249_DESAS          YLKRAGLDYW-YLVEIYYHDSFEALKEKY-PL-------------------------GTF
Q6ME93_PARUW          WLKRAGLDYW-EGVSVSFIENLENYLEN--QQ-------------------------ASF
Q7VJ65_HELHP          ELKRAGLDYW-QHLQVYEWADLNTFWHSYPPS-------------------------KRH
TRML_LISIN            MLKRAGLDYW-DNVKLSYYDSLDEFFE--KNA------------------------GGEF
TRML_LISMF            MLKRAGLDYW-DNVKLSYYDSLDEFFE--KNE------------------------GGEF
TRML_GEOSE            MLRRAGLDYW-EFVNIHYYDSLDHFFQ--QNQ------------------------NGDF
TRML_BACSU            MLKRAGLDYW-EFVNVVYHDSLEELFE--AYK------------------------KGKF
TRML_STRPM            KMKRAGLDYW-DKLELHFYDHLEQFIN--QCH-------------------------GQL
B4U4Q2_STREM          KMKRAGLDYW-DKLDIRFYDHLDEFLA--QCD-------------------------GSL
TRML_LACLM            HLKRAGLDYW-DKVNIVYHKNLQDFMN--SIAD-----------------------GGQL
TRML_LACGA            KMKRAGLDYW-DKVDIRMHDDLDAFLK--TLGP-----------------------NDEM
A6TU52_ALKMQ          QVKRAGLDYW-ELLDLNYYDRYADFLE--KNK------------------------HPKV
TRML_MYCGE            RMVRAGLNCW-DKIQLFEHKSWEHFLQATTENK-------------------------TI
TRML_MYCPN            RMVRAGLNCW-DKVQMFEHKSWEHFIETTPPNK-------------------------AI
Q8EX40_MYCPE          RMKRAGLDYW-DHLKRKEYDDWSDFESQNLVNK-----------------------NSKV
B5ZB78_UREU1          DFVRASANHL-DELKLFEYDDFYEFIAKNNIIE-----------------------N-QI
Q2SSB5_MYCCT          HLSRSSANEY-KYVDCIRYDDWNDFITKHQNI--------------------------TL
B3PMI3_MYCA5          WLKRKAAGHFLSEIEHEIHANYEQFFKKYGDK--------------------------NI
Q4A5J5_MYCS5          YFKRAAAGRLLSDIRHEVHDSYLDFYNKYKNA--------------------------NV
A9NFI2_ACHLI          KLRRSAVDYY-DALNFEIHEDFESFQNEHPGTY--------------------------L
C7N513_SLAHD          NLKRSGCDYW-DDVDVVKHASVEAFLSQHGNDE--------------------------L
D4H0Y4_DENA2          HVKRAGLDYW-QNVNLMQLPSLEAFYEEFPND------------------------KHPY
D3PE16_DEFDS          YLKRAGMDYW-NYLDWEWIKSINEFFDKYNNK------------------------EYSY
D1AYS9_STRM9          HIKRTGLDYW-KYVDLKIWESFEDFMENKGS--------------------------GKI
A7I2Q8_CAMHC          SVRRAGLDYW-KKLNPTIWDSLDDFMAANGDKI------------------------SRF
B0S1H3_FINM2          LLKRSGMDYW-DKVDLVIHDDIDEFLEYIKGN-------------------------DRV
A5FNU8_FLAJ1          NLKRSGLDYW-VHLDVTEYQNVEEWIQQIPDH-------------------------SRV
Q6MR30_BDEBA          NLKRAGLDYW-PHLTWYRHETFEDWWKHVEDP-------------------------SRI
Q6ALW4_DESPS          HLRRAGLDYW-KFVNIVYWESFEAFLSQCDKD--------------------------NM
B3E096_METI4          ALRRAGLDYW-KEVRLFLWEGWDHFTAANPRK--------------------------RL
C1ADV2_GEMAT          EVRRAGLDYW-EHVDVRVWPDWDTFEAQLPTL-------------------------GEP
B2ULK7_AKKM8          HVRRTGLDYW-AKVDLHVWDSLEELKQAAAPG-------------------------AQF
Q28L85_JANSC          SVRRAGLDYW-KHVRLSEYDSWTAFLEARAPRE------------------------DQV
B8FJE9_DESAL          HVKRAGLDYW-EKVRLHTWGSFDEFSAKMQNAP------------------------DET
Q7TU01_RHOBA          RLRRAGLDYW-QYLDWEPVPSWDALCERLN--------------------------PERF
D5SW20_PLAL2          HLKRAGMDYW-PMLDYVVVDSLNDVREQLP--------------------------GHDF
D2QZG9_PIRSD          QLRRAGLDYW-QHLEWEAVDSLDEIRAKIPEPFE----------------------QQRV
Q46177_CHLCI          FVKRAGMDYW-DKVNLSVVDSLDEALSGVD--------------------------QNKV
TRML_SYNY3            YLKRAGLDYW-PYVDLHYHNSCEEFITHWRGQGG------------------------NL
B0JGD9_MICAN          YLKRAGLDYW-PYVKLMYHLTINDFCDYQQKSGG------------------------RA
Q7VBW7_PROMA          RLKRAGLDYW-KYINLELHESF-AHYSKFINPS-------------------------RI
Q0IAI9_SYNS3          YLKRAGLDYW-PHVDLTIHKDVDAFFESLAQPS-------------------------RV
A0A0H3A7K1_DESVV      YLKRAGLDYW-PHVPLTVWSSWEDFLSRGVEGR-------------------------RL
A0LIX2_SYNFM          GLKRAGLDYW-PHVRLKVHPDLESLCREIGDRR--------------------------W
Q1DAP8_MYXXD          QLKRAGLDYW-DKVFLRLYPTYAAYAAD-YPDAR------------------------R-
B1ZVY6_OPITP          NLRRAGMDYW-RALDVHEHRDWASFRAS-AVAPR------------------------RL
D3PKC6_MEIRD          KLRRAGLDYW-PEVDYVLHDSWRAFLETLPPDG-------------------------RI
Q9RXS5_DEIRA          EFRRAVMDYL-QGVTLHEYAGWSDFQAQLPDAA-------------------------RV
A0L4J2_MAGMM          ALKRAGMDYR-QWVDVQRYDDWAHCLRMQPLGV-------------------------RW
I0IEP0_PHYMF          KVQRAGLDYW-PLLDLTQHADDDAFLAWLG--------------------------GRRP
I4B8P9_TURPD          AVRRAGLDHW-PHLRFTHHQRFADFYRASK--------------------------GRRL
Q04QK1_LEPBJ          AARRAGLDYW-DKVKISFHSSLEEY-KAILPS------------------------GTDP
B0SLR8_LEPBP          AVRRAGLDYW-KDLELHRYPDWDWFQKEKETQ------------------------GKRI
D8IBC8_BRAP9          EIRRAGLDYW-EKLNLIKHENEHTFLEYCKEN------------------------NKRI
TRML_BEII9            HFRRAGMDYL-DQVALSRHVSFTAFRAWQIETG------------------------RRL
B7KZ70_METC4          HLRRSGLDYL-DHVAITRHRSWDAFEAWRRETD------------------------IRL
TRML_STAND            GFRRAGMDYL-DRAVIRRHASFKAFEEWRRAEG------------------------RRL
Q2J0V1_RHOP2          HFRRAGMDYL-DQITIVRHDSWSKFEQWRKDAD------------------------CRV
Q13BK0_RHOPS          HFRRAGMDYL-DQVTILRHDSWSKFVQWRKEAD------------------------CRV
B6IWV5_RHOCS          RLRRSLMDYG-ELAAVSRHVNWSAFAASRRG---------------------------RI
Q1MDJ8_RHIL3          NLKRAGMDYI-AAAALTRHVSWDRFEAWRLTTG------------------------RRL
C6AT32_RHILS          NLKRAGMDYI-AAAALTRHVNWDRFEAWRLTTG------------------------RRL
A6WZD2_OCHA4          SLKRAGMDYL-EQATLTRHADWHHFEDWRLQAK------------------------RRI
Q11GB2_CHESB          ALKRAGMDYL-ELAALRRHASWEDFNSWRHQEA------------------------RRI
A5V645_SPHWW          GLRRAGMDYA-EAAEISRHADWAAFESRAAG---------------------------RI
Q5NNY4_ZYMMO          ALKRAGMDYA-KIAPPVRHNDWNSFLSTRPE---------------------------RR
D4Z5K6_SPHJU          KLKRAAMDYG-ASADVTRHANFEAFDVRRRAEG------------------------RRL
C6XPF2_HIRBI          ALRRSAMDYG-PMVDVEQHDSWTSFKNSPDRKK------------------------GRL
Q0ARQ9_MARMM          GIRRAAMDYQ-AAISPLRHASWKAYQASAEASA------------------------GRL
Q9AAX1_CAUVC          SLKRAALDYG-SLSHLTRHDSWETFLKAPERVD------------------------GRL
Q4FPG4_PELUB          RFKRVVMDYM-DEKMIRFYQSSDEFFKSKKNE--------------------------RV
                         *   .                                                    

TRML_ECOLI            FALTTKGTPAHSAV---SYQ-----------DGD--YLMFGPET--RGLPASILDALPAE
TRML_ECOL6            FALTTKGTPAHSAV---SYQ-----------DGD--YLMFGPET--RGLPASILDALPAE
TRML_YERPE            FALTTKGTPAHSAV---SYQ-----------AND--YLLFGPET--RGLPAYILDALPAQ
TRML_PHOAA            FALTTKGTPAHSAV---SYQ-----------AGD--YLMFGPET--RGLPSYVLDNMPPQ
TRML_HAEIN            FALTTKGCPAHSQV---KFK-----------LGD--YLMFGPET--RGIPMSILNEMPME
TRML_AERHH            FACTTKGRTAHSAV---QFA-----------AGD--ALLFGPES--RGLPIEIIESLPFE
TRML_SACD2            WALSTKGTKFHHEV---SIG-----------EGD--YLVFGPET--RGLPMEILEYITFD
TRML_SHEPW            MACTTKGSRPHSEL---TFQ-----------QDD--VLLFGPES--RGLPADIIDSIPTE
TRML_BURCM            FAFTTRGSGRFHDH---AFV-----------PGD--WFVFGSET--RGLPADVLERFPNE
TRML_BURCH            FAFTTRGSGRFHDH---AFL-----------SGD--WFVFGSET--RGLPAELLERFPNE
TRML_BURP0            FAFTTRGSGRFHDR---AFE-----------PGD--WFVFGAET--RGLAPALVDRFAPE
TRML_POLSJ            FAMTTHGAGSVYDM---RFL-----------PGD--WLVFGAET--RGLAPDVRESFPMA
TRML_ACISJ            FALTTHGTQSVYDT---GFL-----------PGD--WFVFGAES--RGLPPELRETFPPA
D5CND7_SIDLE          FAFTTKGSHPFNEV---RYQ-----------PGD--AFLFGPES--RGLPAEVLAAFVPE
TRML_METGS            FALTTKGSARHSTI---AFQ-----------EGD--VFVFGPET--RGLPEEIRDQFTPE
Q4FSD6_PSYA2          TALTTKLSKPFYDY---DFGGQETAESGSEFSGNNVAMVFGSET--AGLADDIREDIGAD
D6SYT0_GARVA          IAFTANATKLYTEI---EYK-----------SND--ILLFGPEPGDIPDPMDVMAGPHVA
D2RC33_GARV4          IAFTANATKLYTEI---EYK-----------PND--ILLFGPEPGDIPDPMDVMAGPHVA
B1VF40_CORU7          FAFTTHAKTWFTDV---DFR-----------RGD--VLLFGPEP--TGLDEETLADPRIT
H6R1P2_NOCCG          YAFTTQATTRFTDV---RYQ-----------AGD--VLLFGTEP--TGLPAEVLADPYIT
D2NS65_ROTMD          FAFTTTASTSYADI---EYR-----------PGD--VFMFGPES--VGLPAEVQQDPHVS
A1AX54_RUTMC          FVVSSKVKTIYTDV---KYQ-----------AGD--SLLLGPET--RGLPQDILNQ---Y
C8W249_DESAS          YYVSTKAARHYCDV---EYGPGD-------------FLVFGKET--RGLPESLLQA-NSG
Q6ME93_PARUW          YFFSSKATTLYTEV---SYAADS-------------FLIFGSET--SGLPSIFQEK-WGN
Q7VJ65_HELHP          FFFSTKAQQLYYDA---DFSQGG-------------FLYFGRED--AGLNEDILHT-YQK
TRML_LISIN            YYITKFGRHVYSDV---DYSDPN----------KNYFFVFGKET--TGLPDELLQA-NEE
TRML_LISMF            YYITKFGRHVYSDI---DYSDPN----------KDYFFVFGKET--TGLPDALLQK-NEE
TRML_GEOSE            YYITKFGKRYYTSY---DFSDPS----------KEIFFIFGRET--TGLPKELLAE-NED
TRML_BACSU            FFITKFGQQPHTSF---DYTDLD----------EDYFFVFGRET--SGLPKDLIQN-NMD
TRML_STRPM            HLISKFAVNNYSQA---TYAD-G----------DSHYFLFGRED--TGLPEDFMRE-HAE
B4U4Q2_STREM          HVISKFADQVYSDK---DYND-R----------QSHYFLFGRED--TGLPELFMRQ-YAD
TRML_LACLM            YLVSKFAEHVYSDV---DYSDDK----------KDHYFLFGRED--TGLPEEFMHE-HRD
TRML_LACGA            YLISKFSSKNYAQV---DYTDPN----------KDYYFVFGKET--TGLPETFMRE-YYD
A6TU52_ALKMQ          YCATTKAQKNHSEV---AYPQ------------DDTYIMFGKET--AGIPKEILKD-HEE
TRML_MYCGE            WLLTKSGDKTPDQI---CMTNKLP---------NELYFVFGQET--KGLPKTIMDN-FKQ
TRML_MYCPN            WLLTKSGTTTPDQI---NMQTDNR---------EQLYFVFGQET--KGLPQTLMEQ-YSQ
Q8EX40_MYCPE          FLITKFADKSISNL---TKDELTKD--------EEIFFVFGRET--KGLTSEIMEK-YKK
B5ZB78_UREU1          YFFTRYGTKAPCDY---KYANLNK---------EDVYLVFGKES--TGIDHDILRK-YPQ
Q2SSB5_MYCCT          FCLSRYGQKPISDF---DFSKIN----------DNVYLVFGKES--TGIAKPILKE-HYN
B3PMI3_MYCA5          YYITRYGLSNYSQI---DWKNELDNN-------KEIWVMFGTES--TGIPKKIMQT-KIA
Q4A5J5_MYCS5          FYITRYGLKSYDKV---DFKNEYSKD-------KNIFFMFGRES--TGIDKEILKN-NID
A9NFI2_ACHLI          YL-SRYGRKTHSAP---NYQAIKG----------DIYLVFGSES--YGIDRALLSK-NIE
C7N513_SLAHD          HLFTSHTETCYTDV---RYGEGGG----------DVYLVFGRES--RGIDEDVLAA-HVD
D4H0Y4_DENA2          AFLSKFASRVYTEI---PHEND------------NLMLIFGRET--SGLPESVEKD-HPD
D3PE16_DEFDS          FFISKFGKKYYTEI---SREFNFN----------KSILIFGNES--YGLREDIRNL-YSD
D1AYS9_STRM9          YFATTKTDRKYSDV---QFEEDD-------------YIMFGPES--RGLPEEILNR-YKE
A7I2Q8_CAMHC          WFSTTKSKRLYFTA---DFKKDD-------------FIFFGGES--TGLPMNFMQK-NWQ
B0S1H3_FINM2          FYVETFATHYYHEV---EYKDGD-------------YLVFGKES--SGIDKDLVSK-HKE
A5FNU8_FLAJ1          FLMSSHSEKSYLEN---EFQDGD-------------WLVFGKES--VGLSAAFMAR-FEN
Q6MR30_BDEBA          WLFTTKTQRTYFEP---QYQSGD-------------WFVFGKET--KGLDPEFLQK-HPQ
Q6ALW4_DESPS          YFFTTKTEKSYTEA---KFKQGDF-------------LIFGKET--KGLPKPILDL-HPD
B3E096_METI4          LFFETGTYPPYFTA---SFAPGDM-------------LVFGRET--KGLSQRILSF-SPH
C1ADV2_GEMAT          YFFSTKATQLFWDA---PLGEPDHIV-----------LIFGRET--AGLPEPVRTR-WAH
B2ULK7_AKKM8          WYLSTKAPRSHWDA---VFHAGDY-------------LVFGPES--RGLPESMLRE-HAD
Q28L85_JANSC          FLFENGGEGGSVYE---PDYPSDAY------------LIFGKET--KGLPSEVLNG-RAH
B8FJE9_DESAL          LLFSKLGARPFWDM---PSHMTRLF------------LVLGAET--RGLPQGVLDQ-YPG
Q7TU01_RHOBA          FFFSKFAKRTVWEA---EFALGD-------------VLVFGRET--SGLPASILKP-DDP
D5SW20_PLAL2          WYVENPAPRRIWEA---EFKPGS-------------VLVFGSES--RGLPPAVIEE-CRG
D2QZG9_PIRSD          WLFTKFGQSRYSDV---TYEQGD-------------VLLFGCES--AGLPEEIVSQFPSS
Q46177_CHLCI          FCLSTKGSQYYGDV---SLPMDG-------------VYVFGSES--KGLPEDVLKK-YYN
TRML_SYNY3            LGFSVTGTVNFWDY---TYQSTDW-------------LMMGSET--DGLPQMMR-DLSTQ
B0JGD9_MICAN          IGFTVRGSSSYVEY---SYQSGDW-------------LLFGSET--DGIPADLL-NKCDD
Q7VBW7_PROMA          IGFSKEGGIPLSKI---EFQSNDS-------------LLFGRED--LGLPSHVK-NKCDF
Q0IAI9_SYNS3          IGCSRRGGILLRNM---EFQKGDV-------------LLFGRED--TGLPETIR-SRCHQ
A0A0H3A7K1_DESVV      VTTSARGGTAVHRF---TYAPDDM-------------LVFGPET--TGLPQEVL-DLTPH
A0LIX2_SYNFM          VYFSAHADRRYCDF---RFQPGDC-------------LFFGSES--FGLPNDLLVSRPGF
Q1DAP8_MYXXD          WLFSARAETSLYEA---RFEEGDH-------------LVFGSEV--SGLAPEVMEGGTGT
B1ZVY6_OPITP          WLFTTKSTRCFWDA---RFEDGDG-------------LVFGNEG--SG-APEWLHAEIGD
D3PKC6_MEIRD          WAFSSKVSRLYTEV---RYQPGDY-------------LLFGPES--RGLPSEVL--ERF-
Q9RXS5_DEIRA          FAFSTHATEYHTRA---GFKRGDY-------------LLFGPES--RGLPVWLR--DAL-
A0L4J2_MAGMM          IPISTKATQGYHTM---RYQAGDR-------------LLFGSEG--SGLPAEIH--QALG
I0IEP0_PHYMF          WLVSKHLDGVSHRFDEAAYTRGD-------------VLIFGNEN--SGLPATWHDRWP--
I4B8P9_TURPD          LGISKAGTVSALEF---SYEKGD-------------VLVFGNET--MGLPPALFSRV---
Q04QK1_LEPBJ          YLISVYGKRSYTDV---QYKEGD-------------AFLFGNET--SGVPTKMKNSWSE-
B0SLR8_LEPBP          FLVSKFGKKVYWDV---SFSSKD-------------VFLFGRET--SGLPEEIHKGHPS-
D8IBC8_BRAP9          VPISKFGHIRYDEF---NYSDND-------------ILLFGRES--TGLRESIWENDAA-
TRML_BEII9            VLLSTKASQPYTDF---TFRPDDI-------------LLMGRES--AGVPEAVHASADAR
B7KZ70_METC4          VLATTTGSVPYTQH---AFRDGDC-------------LLMGRES--AGVPEAVHAAADAR
TRML_STAND            VLATTRGAVAHVDF---AFTETDV-------------VLLGRES--AGVPEAVHESADAR
Q2J0V1_RHOP2          ILLTTKGVTPYLEQ---RYQSTDV-------------LLLGRES--AGVPDEVAAAADAR
Q13BK0_RHOPS          ILLTTKGVTPYLEQ---RYQSTDV-------------LLLGRES--AGVPDEVAAAADAR
B6IWV5_RHOCS          VLVETDHGVPYTDF---AFHPDDT-------------LLLGRES--AGTPPEVAAACHAA
Q1MDJ8_RHIL3          ILASTKAAERYTDL---SFRPDDV-------------LLFGRES--AGVPDQVHETADAR
C6AT32_RHILS          ILASTKAAERYTDL---AFRPDDV-------------LLFGRES--AGVPDQVHERADAR
A6WZD2_OCHA4          VLLSTKAAIPYTDY---RFQENDI-------------LLFGRES--SGVPDNVHNSADAR
Q11GB2_CHESB          ILFTTAGTVPYQCF---SFRDGDI-------------LMFGRES--SGVPDHVHNAVNYR
A5V645_SPHWW          VLLTTAADLTLDKA---GFLPDDI-------------VLLGSEG--AGVPRPVHDRADLR
Q5NNY4_ZYMMO          VLLTTAGDIPLPEM---TFQPDDI-------------LLFGSES--AGAPDFVHQAASHQ
D4Z5K6_SPHJU          MLMSSHASQRLPDV---EFRADDI-------------LLMGSES--AGVPNAVRDLADVR
C6XPF2_HIRBI          VLFTTKGATPLLET---KFESGDT-------------LLFGRES--AGVPDEVHDSAQIR
Q0ARQ9_MARMM          VLFTTRGAGKLWDF---SFRPDDR-------------LLFGRES--AGVPDDVHDAATCR
Q9AAX1_CAUVC          LLFTTKGATPFHRF---SFEPGDT-------------LLFGNES--RGAPEEVHAAAHGR
Q4FPG4_PELUB          ILLTTKSADSYTDF---KFESNDT-------------LLFGRES--AGVPDHVHNLIKYR
                                                             :* *                 

TRML_ECOLI            QK-IRIPMVPD--------SRSMNLSNAVSVVVYEAWRQLGYPGAVLRD-----------
TRML_ECOL6            QK-IRIPMVPD--------SRSMNLSNAVSVVVYEAWRQLGYPGAVLRD-----------
TRML_YERPE            QK-IRIPMQAD--------SRSMNLSNAVSVVVYEAWRQLGYPGALLKE-----------
TRML_PHOAA            QK-IRIPMLAD--------SRSMNLSNSVAVVVFEAWRQLGYSGALLKE-----------
TRML_HAEIN            QK-IRIPMTAN--------SRSMNLSNSVAVTVYEAWRQLGYKGAVNLPEVK--------
TRML_AERHH            QR-LRIPMLPQ--------SRSMNLANAVAVFVYESWRQLGYAGSLQE------------
TRML_SACD2            NV-LRIPMLPN--------SRSMNLSNAASVMVYEAWRQLGFAGSK--------------
TRML_SHEPW            QR-LRIPMMST--------SRSLNLSNAVAIISYEAWRQLDYSGT---------------
TRML_BURCM            QR-VRLPMRPG--------NRSLNLSNTVAVVVFEAWRQAGFEGGA--------------
TRML_BURCH            QR-VRLPMRPD--------NRSLNLSNTVAVVVFEAWRQAGFEGGA--------------
TRML_BURP0            QR-VRLPMRPG--------NRSLNLSNTVAVVVFEAWRQAGFEGGA--------------
TRML_POLSJ            QR-LRVPMQPG--------QRSLNLSNTVAVTVFEAWRQNGFAGSHHPAAADQG------
TRML_ACISJ            QR-LRLPMLPN--------QRSLNLSNAVAVTVYEAWRQNSFLTPPTQPQPA--------
D5CND7_SIDLE          RR-LRLPMLPD--------NRSLNLSNTVAVTVYEAWRQCGYGGSQSNSLPG--------
TRML_METGS            HR-VRLPMMPN--------NRSLNLSNSAAVLLYEAWRQHDFAGAV--------------
Q4FSD6_PSYA2          NW-LRLPMLAD--------SRSLNLSNSVAICLYEVWRQQGFSGDEGRSIGYETLTVYDP
D6SYT0_GARVA          EQ-VRLPMRPS--------LRSLNLTNCASIAVYEAWRQLGFTGGK--------------
D2RC33_GARV4          EQ-VRLPMRPS--------LRSLNLTNCASIAVYEAWRQLGFTGGK--------------
B1VF40_CORU7          AQ-LRIPMLPA--------RRSMNLSNAAAVAAYEAWRQLGFPGGQ--------------
H6R1P2_NOCCG          DL-VRIPMLPG--------RRSMNLSNSAAVAVYEAWRQHGFPDAV--------------
D2NS65_ROTMD          ER-VKIPMKPG--------RRSLNLANSASIAVFEAWRQNGFEGGAI-------------
A1AX54_RUTMC          KG-ITLPMQDK--------SRSLNLSNCASIVAYEAWRQIGFKGAKSA------------
C8W249_DESAS          NC-VRIPMVSD--------ARSLNLANSVAIVLYEALRQ-QAFAGLETAGRVNPQLQGTC
Q6ME93_PARUW          RF-VKIPMKPK--------VRCLNLATSAGIALYEAWRQ-QGFM----------------
Q7VJ65_HELHP          QV-YKLPMKAG--------VRSINLATSVGAALYEGVRQCQSYKIL--------------
TRML_LISIN            NC-LRIPMTD--------HIRSLNLSNTAAVLAYEALRQ-QSFGALLQEPNYDRKIFKD-
TRML_LISMF            NC-LRIPMTD--------HIRSLNLSNTAAILAYEALRQ-QNFGALLQEPNYDRKIFQD-
TRML_GEOSE            RC-LRIPMTE--------NVRALNLSNTAAILVYEALRQ-QSFHGLS-------------
TRML_BACSU            RC-LRLPMTE--------HVRSLNLSNTAAILVYEALRQ-QNYRDLK-------------
TRML_STRPM            KA-LRIPMNDE-------HVRSLNVSNTVCMVIYEALRQ-QGFQGLELKHTYEHDKLK--
B4U4Q2_STREM          RA-LRIPMNDE-------HVRSLNVSNAVCMIVYEALRQ-QAFKGLELSHTYEHDKLKS-
TRML_LACLM            EC-IRIPMNDE-------HVRSLNLSNCACMIVYEALKQ-QEFRGLELVHTYEKDKLK--
TRML_LACGA            RN-LRIPMSD--------NIRCYNLSNSVAMVLLEALRQ-QGFPNMETSHHYENDKLKDN
A6TU52_ALKMQ          TC-IRIPMVDIE------RARSLNLSNAVSIVVYEVLRQ-WGYSNMR-------------
TRML_MYCGE            NQ-IRIPIWNS--------VRSINLANAVVCILYEYSKQ-NQYSNLDKQCA---------
TRML_MYCPN            NQ-VRIPIWNP--------VRSINLSNTVACVLYEYAKQ-NHYFNLDKQCA---------
Q8EX40_MYCPE          FQ-LKIEMNSN--------IRSFNLSNSVAIVAFHYHFL-TNFNDLK-------------
B5ZB78_UREU1          NW-IRIPTSIN--------LRSLNIANSVAMGIYEVLRQ-NDFSDLLKYEPHKKFE----
Q2SSB5_MYCCT          TT-FRIPMISE--------TRSLNIANTVGIASYEVLRQ-WDYLDLVKYETQKGKDYILS
B3PMI3_MYCA5          NC-LRIPMFAQ--------CRSLNLANSVAIVLYEIMRQ-NSFPNLSEFESQKGKDFILK
Q4A5J5_MYCS5          KC-LRIPMVSK--------MRSINLANTVCIVGFEFMRQ-MNWEGLSLYEVQKGKEYLLE
A9NFI2_ACHLI          NT-FRIPTNDK--------IRSLNLSNAVAITVYEVLRQ-LGYPELSEEEPESLKGSDYL
C7N513_SLAHD          RC-VRIPMRHN--------MRSLNLSNAVAVGVYEVIRQ-WGGLE---------------
D4H0Y4_DENA2          SL-FRIPATGK--------VRSFNLSNSVALVGFDIIRR-RGFPGLDAEWKGESTGEIYA
D3PE16_DEFDS          RL-YRIPMKEG--------MRSLNLSNSVAIVVYHLLEK-TGFNGLT-------------
D1AYS9_STRM9          QN-ITIPMLKIG--------RSLNLSNSAVIILYEALRQ-QNFEFNMEDEKVEAIRKDLT
A7I2Q8_CAMHC          NA-ITIPMGNEG--------RSLNLAMSVGIVAYEAIRQ-NIGAFEN-------------
B0S1H3_FINM2          HS-IKIPMNMEID-------RSLNLANSCNIVLFEALRQ-INFPGLK-------------
A5FNU8_FLAJ1          H--LTIPMSPLI--------RSFNIANSVAFVVGEAKRQ-IGLKK---------------
Q6MR30_BDEBA          QT-VTIPMIGEGA-------RSLNLATSVAIAAYEGLRQ-VRFTLR--------------
Q6ALW4_DESPS          RC-LTLPMPNP-------NIRSLNLAMTAGIVLYEAMRQVGENV----------------
B3E096_METI4          FI-YSIPILNG-------KVRSLNLANCVSIVLYEALRQILLGKK---------------
C1ADV2_GEMAT          RM-VAMPITSP-------HVRSLNLSTSVAVAIYERLRQQHRRSPGSPVMKDV-------
B2ULK7_AKKM8          TA-LTIPMPGE-------GARSLNLSTAVAVVLYEGLRQTGI------------------
Q28L85_JANSC          RT-FHLPMRSP-------HIRSLNLSNAATAVIYQAMRSFLV------------------
B8FJE9_DESAL          NV-YHVPITN--------EIRSLNLSTTAGIVLYESMRGLPPGHAWK-------------
Q7TU01_RHOBA          RS-LRLPMREQ--------VRSLNLSVTAGIALYEHQRQTIDLLPA--------------
D5SW20_PLAL2          QM-IDLPMRPE--------VRSLNLASTVNTAVYEAIRQIGHVGL---------------
D2QZG9_PIRSD          AK-LRLPMRPQ--------VRSLNLSSSATAAMYEVIRQIGTPEDAF-------------
Q46177_CHLCI          HC-YYLPMRPG--------IRSLNLATTVGVVLFEAVRQNNQSACIRNGD----------
TRML_SYNY3            L--LCIPMP-------HSEVRSLNLASSAAIALFEAGRQLRSLG----------------
B0JGD9_MICAN          T--VYIPMA-------EPGVRSLNLSVSVAIGLFEARRQLGFIR----------------
Q7VBW7_PROMA          M--ATIPMPGKSNSKNDNGVRSLNLSVACGIASFCSFNCLNHVEH---------------
Q0IAI9_SYNS3          I--TTISMPCSAGEDGQGGVRSLNLSVACAIVSHQAGSQLQLW-----------------
A0A0H3A7K1_DESVV      R--VCIPIW--------GEVRSINLSTATGVVLYQALAATGELDQHTPETMP--------
A0LIX2_SYNFM          V--INIPIN-------RARVRSLNLATSVGIALFEALRQLTSHDDCRR------------
Q1DAP8_MYXXD          A--VTIPMLE--------DRRSLNLSTSVGIGTYEALRQVRFTGAGRQAPPAS-------
B1ZVY6_OPITP          EQRVTIPHANP-------ELRSLNLSTAAGIATYEALRQVGLPTQSRAES----------
D3PKC6_MEIRD          -PGVTIPMP-------GRGGRSLNLAVAVGVGLYEALRQVGWGFRAARNLGAT-------
Q9RXS5_DEIRA          -PKLKLPQP-------GRG-RSLNLSVAVGAAAFEAGRQIERW-----------------
A0L4J2_MAGMM          HNAVRVPML-------PRA-RSLNLANTVAVVLYEALRQLNYPEMA--------------
I0IEP0_PHYMF          DRRVHVPMPGP--------LHGRGNVRSLNVANTVAILLAQATLSA--------------
I4B8P9_TURPD          DQTLALPMFGP--------VRSLNLANSVAVVAYAWLQKVYGAALQVDSTRYPRTYYRSG
Q04QK1_LEPBJ          ERILKIPMEDS--------SRCLNLSNSVAVISYEAMRQIRSW-----------------
B0SLR8_LEPBP          DQIISIPMAES--------SRSINLSNAVAIILYEALRQEKTRTIP--------------
D8IBC8_BRAP9          NSVY-LPMSDD--------IRSINVSNTAAIVSYEAFRQLCLNKNI--------------
TRML_BEII9            VV---IPLRPP--------MRSLNVAVAAAMVLGEALRQVGALAKVMDAPRASL------
B7KZ70_METC4          VV---VPIRPG--------LRSLNVAICAAMMLGEAIRQVG-------------------
TRML_STAND            IV---IPLNEG--------ARSLNVALAGAMILGEALRQTGGFARTGTG-----------
Q2J0V1_RHOP2          IV---IPMQPG--------FRSLNVAMAAALVVGEALRQTRQG-----------------
Q13BK0_RHOPS          VL---IPMQPK--------MRSLNVAMAAALVVGEALRQTRYG-----------------
B6IWV5_RHOCS          VH---IPMHPG--------ARSLNVAIAAAMVLGEALRQTRAWTHAPAG-----------
Q1MDJ8_RHIL3          VL---IPMVEG--------QRSINVAVSAAMIVGEAMRQTVWA-----------------
C6AT32_RHILS          VL---IPMVEG--------QRSINVAVSAAMIVGEAMRQTVWA-----------------
A6WZD2_OCHA4          LL---IPMMPG--------ARSLNLAVSVAMTAGEALRQRRDKVDSLRQE----------
Q11GB2_CHESB          LV---IPMKEG--------TRSLNVAMAAAMACGEAVRQVR-------------------
A5V645_SPHWW          VR---IPMRPG--------FRSLNVAVSAGIALAEALRQTGGWPQ---------------
Q5NNY4_ZYMMO          VR---IPLLAD--------FRSLNIAVSAGIALAEALRQTGGFAHEVR------------
D4Z5K6_SPHJU          VR---IPMAPG--------FRSLNIAVSTGIAVAEALRQTGSFPQ---------------
C6XPF2_HIRBI          CV---IPLNPE--------ARSLNVSVSAAIALHEALRQTGGLPR---------------
Q0ARQ9_MARMM          VK---IPIREG--------MRSLNVTVSAGIALAEASRQLG-------------------
Q9AAX1_CAUVC          IV---IPIRPE--------ARSMNLATTAAMALGEALRQTGGFPEAG-------------
Q4FPG4_PELUB          LK---IPMMDN--------KRSLNIASSVAIILSENLRQTNFNK----------------
                           :              :  .                                    

TRML_ECOLI            --------------
TRML_ECOL6            --------------
TRML_YERPE            --------------
TRML_PHOAA            --------------
TRML_HAEIN            --------------
TRML_AERHH            --------------
TRML_SACD2            --------------
TRML_SHEPW            --------------
TRML_BURCM            --------------
TRML_BURCH            --------------
TRML_BURP0            --------------
TRML_POLSJ            --------------
TRML_ACISJ            --------------
D5CND7_SIDLE          --------------
TRML_METGS            --------------
Q4FSD6_PSYA2          K-------------
D6SYT0_GARVA          --------------
D2RC33_GARV4          --------------
B1VF40_CORU7          --------------
H6R1P2_NOCCG          --------------
D2NS65_ROTMD          --------------
A1AX54_RUTMC          --------------
C8W249_DESAS          TKP-----------
Q6ME93_PARUW          --------------
Q7VJ65_HELHP          --------------
TRML_LISIN            --------------
TRML_LISMF            --------------
TRML_GEOSE            --------------
TRML_BACSU            --------------
TRML_STRPM            --------------
B4U4Q2_STREM          --------------
TRML_LACLM            --------------
TRML_LACGA            YNRPERYERNLGEN
A6TU52_ALKMQ          --------------
TRML_MYCGE            --------------
TRML_MYCPN            --------------
Q8EX40_MYCPE          --------------
B5ZB78_UREU1          --------------
Q2SSB5_MYCCT          ERWKGIEE------
B3PMI3_MYCA5          --------------
Q4A5J5_MYCS5          DDNQV---------
A9NFI2_ACHLI          KQFKE---------
C7N513_SLAHD          --------------
D4H0Y4_DENA2          --------------
D3PE16_DEFDS          --------------
D1AYS9_STRM9          VKGATLK-------
A7I2Q8_CAMHC          ARGYQI--------
B0S1H3_FINM2          --------------
A5FNU8_FLAJ1          --------------
Q6MR30_BDEBA          --------------
Q6ALW4_DESPS          --------------
B3E096_METI4          --------------
C1ADV2_GEMAT          --------------
B2ULK7_AKKM8          --------------
Q28L85_JANSC          --------------
B8FJE9_DESAL          --------------
Q7TU01_RHOBA          --------------
D5SW20_PLAL2          --------------
D2QZG9_PIRSD          --------------
Q46177_CHLCI          --------------
TRML_SYNY3            --------------
B0JGD9_MICAN          --------------
Q7VBW7_PROMA          --------------
Q0IAI9_SYNS3          --------------
A0A0H3A7K1_DESVV      --------------
A0LIX2_SYNFM          --------------
Q1DAP8_MYXXD          --------------
B1ZVY6_OPITP          --------------
D3PKC6_MEIRD          --------------
Q9RXS5_DEIRA          --------------
A0L4J2_MAGMM          --------------
I0IEP0_PHYMF          --------------
I4B8P9_TURPD          HHG-----------
Q04QK1_LEPBJ          --------------
B0SLR8_LEPBP          --------------
D8IBC8_BRAP9          --------------
TRML_BEII9            --------------
B7KZ70_METC4          --------------
TRML_STAND            --------------
Q2J0V1_RHOP2          --------------
Q13BK0_RHOPS          --------------
B6IWV5_RHOCS          --------------
Q1MDJ8_RHIL3          --------------
C6AT32_RHILS          --------------
A6WZD2_OCHA4          --------------
Q11GB2_CHESB          --------------
A5V645_SPHWW          --------------
Q5NNY4_ZYMMO          --------------
D4Z5K6_SPHJU          --------------
C6XPF2_HIRBI          --------------
Q0ARQ9_MARMM          --------------
Q9AAX1_CAUVC          --------------
Q4FPG4_PELUB          --------------