CLUSTAL format seed alignment for MF_01886

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B3GXD0_ACTP7          -------------------------------------------------------MRKLV
B0BNX7_ACTPJ          -----------------------------------------------------------M
TMCA_ACTP2            -----------------------------------------------------------M
TMCA_HAEDU            -------------------------------------------------------MRQLV
B0BPP2_ACTPJ          ------------------------------------------MTSAPDFLEGAENFSHII
Q9CM04_PASMU          ------------------------------------------------MNRVNKQRKVQC
TMCA_HAEIN            ----------------------------------------------------MPSRQLQI
A6VQP5_ACTSZ          --------------------------------------------------MMMLSRRLTL
Q65RX4_MANSM          ---------------------------------------------------MLAERRLEL
TMCA_CITK8            -----------------------------------MSDNDALRALTAQMAQEGIRRLLVL
TMCA_SALTY            -----------------------------------MSDIDALQALTSQMTQEGIRRLLVI
D2TTA9_CITRI          -----------------------------------MSDYAALKSLTGQMAREGIRRLLVL
TMCA_ECOLI            -----------------------------------MAELTALHTLTAQMKREGIRRLLVL
TMCA_SHIF8            -----------------------------------MAELTALYTLTAQMKREGICRLLVL
B7LKG7_ESCF3          -----------------------------------MAELTALHTLTAQMKREGIRRLLVL
A6TC97_KLEP7          -------------------------------------MMDALLNLTAQMAREGIRRLLVL
B5XVN1_KLEP3          -------------------------------------MMDALLDLTAQMAREGIRRLLVL
A4WD54_ENT38          -----------------------------MTVRVRDETGRPLEDVTAKLAQSGHRRLLLL
A0A0H3CQ14_ENTCC      --------------------------------------MVAFDQLISQLERTGQRRLVVL
C9XXK7_CROTZ          -----------------------------------MVVNESLATLTAQMEAAGIRRLLVL
A7ML07_CROS8          -------------------------------------MNDSLATLTAQMAAAGIRRLLVL
D2T6T0_ERWP6          -----------------------------------------MLRATAQIERQGWRRLLII
D4HY71_ERWAC          --------------------------------------MSDLLQAAAQIKRQGWRRLLVI
B2VE48_ERWT9          --------------------------------------MSDLLKATGQIERLGWRRLLVI
D4GK02_PANAM          ---------------------------------------MNLKAATCAMQAAGIRRLAVI
TMCA_PECAS            --------------------------------------MRDFLHSQQQQQRYGIRRLLVL
C6DBS4_PECCP          ------------------------------------MMLRDFLHSQLQQQRYGVRRLLVL
C6CQK6_DICC1          -------------------------------------MDSSFVVSQQYQQRYGIRRLLVL
C6CC70_DICP7          --------------------------------------MEAFVVSQQQQQRSGIRRLLVL
TMCA_YERE8            -----------------------------------------------MMAQQGHRRLLVL
TMCA_YERPD            -------------------------------------MTNPIVASQPQMAQQGIRRLLIL
A8GHL3_SERP5          ----------------------------------------MLQAMQQLMQQQGIRRLLVL
TMCA_PHOAA            -------------------------------------MLPELSAIQAEMQQQGLRRLLVL
Q7N3J1_PHOLL          -------------------------------------MLPELSVIQTEMQQQGLRRLLVL
D3V7B0_XENBS          ----------------------------------MTMLDSIWKKLQEQMQQQGQRRLVVL
D3VI71_XENNA          ----------------------------------MTVQGNEWEVLQAQMQQQGQRRLVVL
Q2NS79_SODGM          ------------------------------MTSLPPPWLACLRAETAAMKRAGVRRLLVI
C5B7A5_EDWI9          ---------------------------------------MPLSVSLPAMSRAGVRRLLVI
D0ZEZ3_EDWTE          ---------------------------------------MPLSASLPAMSRAGVRRLLVI
B4EY73_PROMH          ------------------------------------MPSLDLLRYQQAFARLGQRRLLLL
TMCA_NITHN            ------------------------MHPILFP-PTLDNIRKITASLVAAAKASGHRRALVL
Q3J7N7_NITOC          ------------------------MYRVYFSFQILDNFRKITAALVTAAKASYQRRALVL
Q0A9W2_ALKEH          -------------------------------MTGPEPLLGVVDRLLAAARARGHRRLLVL
A1WWU2_HALHL          ----------------------------------------------------MSRRTAVL
D3RRX5_ALLVD          --------------------------------MDSSLDTQWLRDQRALARARGHRLTLWL
Q1QTA5_CHRSD          ---------------------------MRVPRDDAAASMTWLATLVEACQAQDHRGVVWV
A1U6V4_MARHV          ------------------------------MNDKTETIASGWRAFQQILAARGHRRLVLV
A0A656HB11_THINJ      -------------------------------------------------MNDLPRQLRVI
Q2SKZ4_HAHCH          ----------------MLYSVMSQEESWRDALTSALARAHAVNFRAPVLIQGEAPEIDAV
A4SIB4_AERS4          ------------------------------------MSPAEVKALRQTLAHAGERRLIWL
A0KPS8_AERHH          ------------------------------------MMPAALDELRQVLARTGERRLIWL
C4LD78_TOLAT          -------------------------------------MSHLFAEHYARLLHRGERRLLLL
TMCA_VIBCH            ---MFPPSYDAFQGVTAIGWACANMAHHFGISLVMTQPITYLLQLQQLAKQGQTRFGCWL
A1T0E4_PSYIN          ----------------------------------MPALLSLLDHLKNHATIQNHRQLLRL
B6EPZ0_ALISL          ------------------MLQFRYLIILFSGFFLMNSQLSFLNSVLSDASVCNIRYPILL
Q6LFR2_PHOPR          ----------------------------------MFDLPHFSSQLIAQAKNANCRHLVVL
Q487G0_COLP3          -----------------------------------MVVLSGCESWAMSLLRSIDVIHAAL
A0A1H9ZCM0_THASX      -----------------------------------MILYPWLSQLHTDLVSKQQRQLVVV
TMCA_HALMA            --------MPTTVSGPIKSVPGERRDRQVHTGASATTGMDIARSLRAEARRANERRLLVL
D2RVY0_HALTV          --------------------------MIVETGATA---------LFEEATAVDERRVLVL
A8MCG8_CALMQ          ----------------------------------MSEWVKSLEDFIRSGVKANHRRMVVL
A2BLE0_HYPBU          MESLPAEYSELGKKDIENLAKNVAEELKKYVPSSFNKLLRKLSKAIERAIVSRHRRLLVV
TMCA_THEPD            ------------------------------MPLVPLEHLDEVREELVKARKSRHRRLLVI
TMCA_METKA            ------------MPDKAEVFFDEGVLDFA---DVDEIVLDVGEEALAEALAHRHRRMIVF
TMCA_PYRAB            --------------MTIKIRFPKDVREYARKEKVKESIIKLTETSLAEAITNFHRRMIIL
D2RDE6_ARCPA          --------------------------------MTLKKLTSELEKATKTALENRHRFMVIL
TMCA_SULIY            ------------------------MIPGSNPGGRIHNVVKMFQSYFMDAVNGYYRHLAII
Q4JCC9_SULAC          ------------------------MINTIN-----------FNEEFRKASNYNYRLLSIH
Q4JBI8_SULAC          ------------------------MEKKE--------FFEILRNSMLDSKDRYYRNLVFI
A0A0V8RU50_PYROC      ---------------------------------MDARVRGALEGFAEAVRGSGYRGLVVL
A2BKG0_HYPBU          ---------------------------------MKYSHPESLARFAVEIRNSGYRGLAVV
TMCA_AERPE            -----------------------------------MDVELEVSGFIQRLRHSRLRGLLVV
A2BLX9_HYPBU          -------------------------MAAVLGRLDLYMVLRQLSAWLTELRGSGYRGLVLL
B1L3H0_KORCO          ------------------------------MLSLTGRVKLDPRLIVEEAMNTGERRLIVI
B5IHD3_ACIB4          --------------------------------MPEQDILELVDELVKEAKRCNQRRLIVI
Q15W71_PSEA6          ----------------------------------MDLHFKIEDWVKQRKSHVFHRQLVIV
Q31DY3_HYDCU          ----------------------------MAMTQASPDLKNWSQQLHNTLTFHRHRACLVL
A6FY33_9DELT          ----------------------------MTGPELSERHRRLLVIRDEAGLELVARGIAES
Q3IDD4_PSET1          -------------------------------MQDYKLYKKQLIQLEQQLAGAHHRQLVLV
A6VTS2_MARMS          --------------------------------MSDNHRHCFILKGSSREVLSDFLRLCEN
TMCA_IDILO            -----------------------------------------------MAERSGYRQLQLL
D3SEZ5_THISK          ------------------------------------------MRQAEDRPTLGWRRLLAH
F2G4U5_ALTMD          ----------------------------MALSQLCEWVLAPFFTEHQNSTLRLHRRLLVI
                                                                                  

B3GXD0_ACTP7          ILAEMPPLDRGIVIHSGD------------------------------------------
B0BNX7_ACTPJ          ILAEMPPLDGGIVIHSGN------------------------------------------
TMCA_ACTP2            ILAEMPPLDGGIVIHSGN------------------------------------------
TMCA_HAEDU            ILSTMPPIQGGVLLNSQN------------------------------------------
B0BPP2_ACTPJ          LPVLSSDKERNVTLPRSHK-----------------------------------------
Q9CM04_PASMU          WVGENATLFPPLARLSGIKSAVWIGDD---------------------------------
TMCA_HAEIN            LIRKTLPLVPDHVLIIG-------------------------------------------
A6VQP5_ACTSZ          KFDQTPPHFPSDLKESAV------------------------------------------
Q65RX4_MANSM          YFAENPPHFFDEMAKSAV------------------------------------------
TMCA_CITK8            SGDVSWCRERALALREALAGDWLWVA----------------------------------
TMCA_SALTY            SGDAAWCRKRAEAIRAALPGDWLWVA----------------------------------
D2TTA9_CITRI          SGESDWCREQAQQLREQLPGDWLWVS----------------------------------
TMCA_ECOLI            SGEEGWCFEHTLKLRDALPGDWLWIS----------------------------------
TMCA_SHIF8            SGEEGWCFDHALKLRDALPGDWLWIS----------------------------------
B7LKG7_ESCF3          SGEEGWCFEHALKLRDALPGDWLWIS----------------------------------
A6TC97_KLEP7          SGDESWTLQQAQVLRERLGGDGLWVG----------------------------------
B5XVN1_KLEP3          SGDEAWTLQQAQALRERLGGDGLWVG----------------------------------
A4WD54_ENT38          SGDDDWSQTHSLALRDQLQGDWLWVG----------------------------------
A0A0H3CQ14_ENTCC      SGDAQWSLAQAGALRDTLSGDWVWLD----------------------------------
C9XXK7_CROTZ          SGDETWSSQQAQQLANTLPGDWLWVG----------------------------------
A7ML07_CROS8          SGDETWSSQQARQLANALPGDWLWVG----------------------------------
D2T6T0_ERWP6          SGDACWCEQQAAACMAQLPGDWLTVG----------------------------------
D4HY71_ERWAC          SGDAFWCEQQAAACMAQLPGDWLTVG----------------------------------
B2VE48_ERWT9          SGDASWCEQQAAVCMAQLPGDWLTVG----------------------------------
D4GK02_PANAM          GGEADWCRDTALSWSQTLEGDWLWLS----------------------------------
TMCA_PECAS            SGESSWCEEQAMVLSSQSAGDWLWVSE---------------------------------
C6DBS4_PECCP          SGEANWCEAQALALSDRLPGDWLWIGE---------------------------------
C6CQK6_DICC1          SGQPDWCRAQALRLSGLLPGDWLWVST---------------------------------
C6CC70_DICP7          SGERNWCLQEAIFLRGLLAGDWLWVGP---------------------------------
TMCA_YERE8            SGDADWARQQAIHLSEQLPGDWLWVGD---------------------------------
TMCA_YERPD            SGQADWSRQQAIMLRQHLAGDWLWLSE---------------------------------
A8GHL3_SERP5          SGEPQWCRQQAHRLATTLPGDWPWVGE---------------------------------
TMCA_PHOAA            SGDHNWCHQQAHELQQEFMGDWLWISY---------------------------------
Q7N3J1_PHOLL          SGDDHWCYLQANELQRRFIGDWLWISH---------------------------------
D3V7B0_XENBS          SGDVLWSEQIVNQLKKQFQGDWVTVAS---------------------------------
D3VI71_XENNA          SGDLQWSEAIVARLKTQFQGDWLTVSS---------------------------------
Q2NS79_SODGM          SGASDWCAQQAAALGDALDGDWLWVGE---------------------------------
C5B7A5_EDWI9          SGEADWCRRRAALAIAPL-GDVTWCGS---------------------------------
D0ZEZ3_EDWTE          SGEADWCRRRAALAIAPL-ADVTWCGS---------------------------------
B4EY73_PROMH          AGSYTWQREQLRAIQQQCKGDWLILSS---------------------------------
TMCA_NITHN            SGDREWCLQAAQVSLASTSLEPVL------------------------------------
Q3J7N7_NITOC          SGDQNWCLQAAQASLEGASLERVP------------------------------------
Q0A9W2_ALKEH          AGTAVWGRAEARRVLQRCGADEHH------------------------------------
A1WWU2_HALHL          AGPPQWGRDLAAGQLPDNARICWIGE----------------------------------
D3RRX5_ALLVD          RGSPEWTADEARRLVAALPEIDRV------------------------------------
Q1QTA5_CHRSD          AAPGEQALARACAIHRSREWHAPLWVGE--------------------------------
A1U6V4_MARHV          EGDRQAAIARVAGLLPELSAAQGLWVG---------------------------------
A0A656HB11_THINJ      SGQQAECLQRAQALLPVGVNAIWIT-----------------------------------
Q2SKZ4_HAHCH          IWPILEHFTPNQRIVWAGSPSSTPP-----------------------------------
A4SIB4_AERS4          EGDEADCIVRAEALLGGV--IYWLG-----------------------------------
A0KPS8_AERHH          EGDEADCIARAETLLSGV--SYWLG-----------------------------------
C4LD78_TOLAT          TGEELACQQHAEQLWLSG--GLWLG-----------------------------------
TMCA_VIBCH            RGDAQWQHHLLKTLVPH--FAEQPI--L--------------------------------
A1T0E4_PSYIN          QGDLNWCFTLTQKMIAE--LQLPYF--W--------------------------------
B6EPZ0_ALISL          EGSKAWYGDLLSSFLSQDNTSSLLT--E--------------------------------
Q6LFR2_PHOPR          AGDLVWGAESANVFIS----GYPTY--L--------------------------------
Q487G0_COLP3          STET---------KQNFQTFSSQVQ--C--------------------------------
A0A1H9ZCM0_THASX      EGDSDWLKETLSRLKKDILVSDQSN--W--------------------------------
TMCA_HALMA            AGDPDRTRERAATALDLADVPSAETTVV--------------------------------
D2RVY0_HALTV          AGDRDRGYDTLESVLEALPVPITETTLV--------------------------------
A8MCG8_CALMQ          VGSSDDAVAESAVEVVKLFLDITG--------MGNG------IYLYQPEYGDARNRL---
A2BLE0_HYPBU          TGTDPVEVAATVARALLFYERVYR--------RLKGKEPLPLLYVFHDEFKDAKIRK---
TMCA_THEPD            TGDDD---SRLVTTALDFIYNVKD--------LLSGEK---VLYTYHAFYSDGAMRK---
TMCA_METKA            QGDE-GKAEAAGVVTAGAADVLFD---------VRDR-PISVLYVTDSLKEDTYARERYE
TMCA_PYRAB            QGDTLEKAKLAGILAGGVARILSEYIPEFLDRKLRDEDKIEVLYATDALGEDTYGRKRFE
D2RDE6_ARCPA          CSKDLEKLLKTAKKLYKKYEKIRK--------------------KLKEIEEDLLIVG---
TMCA_SULIY            ESQ-DYLEKVNSLVEEYLEVNKKP----------------RVIYGFHPWLDNSKDRM---
Q4JCC9_SULAC          LG--NWEKSTFDLLRVYKEFREPE----------------KALYAFHPWIEGAKDRF---
Q4JBI8_SULAC          QDESDILRHVLEVLQLYLDINPDP----------------LIAYAFHPWAKGAKDRL---
A0A0V8RU50_PYROC      HSRSPGGVAAEVVELLG-ASGGCV------------------VVAPRRLVPSCPGGCR--
A2BKG0_HYPBU          HSNRLQWLLNTTAEVL---DGNCI------------------AVAPQSL--AVPRRCR--
TMCA_AERPE            GTGDVKAWAEKLAGYA---GGDCA------------------LVSPSAG--RLPGICR--
A2BLX9_HYPBU          HSTAIGVCASAVAGLLSEVYSQVA------------------CIAPAELRRELQERCS--
B1L3H0_KORCO          SGNDSPEVASEIAKIWLSKREGRLLIAT--------------------------------
B5IHD3_ACIB4          ADKRERGIALLQEILSKVQLSRKITFAK--------------------------------
Q15W71_PSEA6          SGAKEWAEKQAENLLINVESLASKHLWV--------------------------------
Q31DY3_HYDCU          SGDVGWQQHMLNILIQPDTRGIFIGS----------------------------------
A6FY33_9DELT          LGPRERPGELAWVTAEALPPSLATLP----------------------------------
Q3IDD4_PSET1          TGNDNWCYELTNSLVQNTNTLTLSKHC---------------------------------
A6VTS2_MARMS          VSTPLIAAHDVGQYDELLVPSLKTK-----------------------------------
TMCA_IDILO            QDASLWREYCEARSESSIYLSNLQTH----------------------------------
D3SEZ5_THISK          PMSQAARERAATWLGRMPSGKSSLWVG---------------------------------
F2G4U5_ALTMD          SSHDEFCHNALTTVTNAIDKSNTVKYNL--------------------------------
                                                                                  

B3GXD0_ACTP7          -----------------------ISQAKQYLGQEHPYAIYDMRAEGGVWLNLDALAIIAG
B0BNX7_ACTPJ          -----------------------ISQAKQYLGQEHPYAIYDMRAEGGVWLNLDALAIIAG
TMCA_ACTP2            -----------------------ISQAKQYLGQEHPYAIYDMRAEGDVWLNLDALAIIAG
TMCA_HAEDU            -----------------------FSKAKQFLGQEYPFALYDMRSENGICFNLEAFAIIVG
B0BPP2_ACTPJ          ---------------FSNWRKIPFSNAKTLLGSEHAFAFFDMRASNGVNFHLEAFAIVAG
Q9CM04_PASMU          ------------LPPFLSFAHFDFKQAKNMLGQEFALIVYDARGG----LNLDALAIASG
TMCA_HAEIN            ------------------ESGIAFSKATNLLGQEFEHILFDGRNG----IHLEALAIAAG
A6VQP5_ACTSZ          -----------------VLSTENFSKAKNLLGQEFDWILYDGRAA----LNLDALAIAVG
Q65RX4_MANSM          -----------------ILSPENFHNAKNLLGREFDQILFDGRTS----LNLDALAIAAG
TMCA_CITK8            ------------TDA-PAAPHCTPQALQTLLGREFRHAVFDAQLG----FDASAFAALSG
TMCA_SALTY            ------------PDA-PAQPCCTPQALQTLLGREFRHAIFDAWQG----FDAAAFAALSG
D2TTA9_CITRI          ------------PDA-PWAPSCAPRTLQTLLGREFRHAVFDAQQG----FDAAAFAALSG
TMCA_ECOLI            ------------PRP-DAENHCSPSALQTLLGREFRHAVFDARHG----FDAAAFAALSG
TMCA_SHIF8            ------------PQL-DAENHCSPSALQTLLGREFRHAVFDARHG----FDAAAFAALSG
B7LKG7_ESCF3          ------------PQP-VAENYCSPSTLQTLLGREFRHAVFDARHG----FDAAAFAALSG
A6TC97_KLEP7          ------------PEP-GSAPCVAPGALKTLLGREVMHAFFDARRG----FDVAAMAALSG
B5XVN1_KLEP3          ------------SDP-VSAPCVAPGALKTLLGREVMHAFFDARRG----CDVAALAALSG
A4WD54_ENT38          ------------NET-SVEPCCAPQNLKSLLGREYLHAIFDARDG----FDVAAFAALSG
A0A0H3CQ14_ENTCC      ------------ENP-SRE-------ISGLLGREFRHAVFDARVG----FDVSAFAALSG
C9XXK7_CROTZ          ------------SAP-EMALNGAPGAINTLLGREYLHAVFDARSG----FDAAAFAALAG
A7ML07_CROS8          ------------TAP-EMALNGAPGAINTLLGREYLHAVFDARSG----FDAAAFAALAG
D2T6T0_ERWP6          ------------DRP-LSVLHCAPQAIRTLLGREFKHALFDARGG----FHAEALAAMAG
D4HY71_ERWAC          ------------EQP-LSALHCAPQAIRTLLGREFRHALFDARRG----FHAEALAALSG
B2VE48_ERWT9          ------------EQP-LTAQYCTPQAVRTLLGRELHHVLFDARRG----FHAEALAALAG
D4GK02_PANAM          ------------DNPPETGTHCAPTAFRTLLGREFHHAVFDARQG----FHAEALAALAG
TMCA_PECAS            ------------HAPD-SVASLPASRVRTLLGREFHHAVFDARSG----VDVEALAMLSG
C6DBS4_PECCP          ------------SAPD-SITSLPASRVRTLLGREFLHAVFDARKG----VDVEALAMLSG
C6CQK6_DICC1          ------------SAPE-NINALPSSRVRSVLGREFLHAVFDAHEG----LDAEALAMLAG
C6CC70_DICP7          ------------TAPAVNYPSLAARQVRGLLGHEYLHAVFDARDG----LDVESLVMLAG
TMCA_YERE8            ------------NFPP-GANGIRPTAAKTLLGQEGLHGVFDATDG----LNTEALAVLAG
TMCA_YERPD            ------------QPPE-GVNSISPTAARTLLGQENLHGVFDATDG----LNIEALAIVAG
A8GHL3_SERP5          ------------NPPS-GMQSLASGAVRTLLGQERLHAVYDATDG----LDVEALAALAG
TMCA_PHOAA            ------------RKEK----AVLPEKAAGLLGQEYLHGVFDATEG----LNAEALAILAG
Q7N3J1_PHOLL          ------------RKQH----AVLPEKAVSLLGQEYLHGIFDATEG----FNAEALAILAG
D3V7B0_XENBS          ------------GDEG----VIEPVKACSLLGREFMHGVFDVTRG----FNAEALAILAG
D3VI71_XENNA          ------------YVPD----AVEPTKAVSLLGREFLHGIFDATHG----FNAEALAILAG
Q2NS79_SODGM          ------------QSE--CGTGSRPAALKILLGREFLHAVFDARQS----LAVDTLAALAG
C5B7A5_EDWI9          ------------PAP-TGCQMLSLAQIRTVLGRELGHCVLDWHPG----CHAEVLAALAG
D0ZEZ3_EDWTE          ------------PAP-TGCQALPLTQIRTVLGRELGHCVLDWHPG----CHAEALAALAG
B4EY73_PROMH          ------------EMS----EAIKPEHAHQLLGREYLHAVFDANHA----FNADALAMLTG
TMCA_NITHN            ---------WIAAQAPENAWRMEAAKAHRSLGQEVDAIVFDAYS----GFDLDAFGIITG
Q3J7N7_NITOC          ---------WISASAPEKVWKLEAAKAHQFLGQEVDALVFNAHS----GFDLDAFGIITG
Q0A9W2_ALKEH          ---------LWVG---EGEGARAAAEVWQELGREYPALVFDAHC----GFDPDAFGAVAG
A1WWU2_HALHL          ---------PPAAGLPEAVTRLAARDGRRVLGRTVDILVYDAHA----GLDADALGAAAG
D3RRX5_ALLVD          ---------CLAERPILAEPSRPLRSAIRLMGMDLDLLILDVHD----GFDPDGFGAATG
Q1QTA5_CHRSD          ---------GEPGADMPAIDRLPMSQARSRLGQEHDLLIFDARTPGS-GFDPDAFGALSG
A1U6V4_MARHV          ---------REQDAIMAGLGHIRVKDYRRVLGQELPVLVWDGWE----GTSPDAFAALSG
A0A656HB11_THINJ      -------------TAPVIAGALPANKARVMLGQETDAVVFDAHS----GFDVNAFAAISG
Q2SKZ4_HAHCH          -------------TLPAQLETLEAARFQTRLGQEMDCLVFDARC----GFHADAFAALTG
A4SIB4_AERS4          -------------EGPACHGPVPAAKALQRLGQECDTLVFNAFS----GFHPDAFGALAG
A0KPS8_AERHH          -------------DGPSEHHPQPAAKALQRLGQECDTLVFNTFS----GFHPDAFGALAG
C4LD78_TOLAT          -------------NGPDSVMSQPMQHTMSWLGQEYPLVILNAFC----GLSPDMLGAVGG
TMCA_VIBCH            ---------MLGQTELEGVTCVDYRQGQQWLGRECQLLIVDLTQ----GWDANSFNAVLG
A1T0E4_PSYIN          ---------CGPSP-----ITNNSISYKEILGQETSLLVINAHP----AFDGNQFAAAEG
B6EPZ0_ALISL          ---------IYGDISILDIPSFAIKKALKKLGQESQCLIINISD----EFNANAINAICG
Q6LFR2_PHOPR          ---------WAGENAPENADSLSIKKAKKLLGQETHCLVFNAHN----GFDADAFGALSG
Q487G0_COLP3          ---------LVYGDSAIFPANVQRKRYRDKLGSES-DFIIFVDS----EFTIDAFAGLSG
A0A1H9ZCM0_THASX      ---------LFYADESDDSAQVNGKNFRQYLGTEY-QGVMFTSE----QFNAEAIAALSG
TMCA_HALMA            ---------G--PEPFLDCEHHDQSRAEELLGRTRTAVVFDAHEE----LRPDAVGRTVG
D2RVY0_HALTV          ---------G--PEDRLRCEHLSQANASELLGTTRTAIALDAHEG----LRPNALGKVVG
A8MCG8_CALMQ          ---RVFTDSMGN----IRFKPIPFKDTKLLLGQTLDYAVVDLFND----LKPNDIGRVGS
A2BLE0_HYPBU          ---EVVKRTLKAQADMIEYTIARYEESDRYLGTTFKLLVMDLVND----LKPNDVGRLVG
TMCA_THEPD            ---ELFEKGVPRE---LSVDYVSYHKLDEVLGRTYAAAVADLVNN----LEPNDLGRVMG
TMCA_METKA            EFRRVLEGFAEEANFEYELEALTFSGSKRALGTTWDLMVIDLSYD----LDPDAIGRLVE
TMCA_PYRAB            EFRKHFSVLAPNA----ELTSVTFKYSRDILGRTFDILVLDLSYD----YSPNDLGRIIE
D2RDE6_ARCPA          -----RSEFLEKSKDYFEGKFVHYKDVQYVLGETYSSLILDITNG----FHPNDLGIVVE
TMCA_SULIY            ---IEFRKKFEN------FLDIDYSNSEKYLGQSVDLVILDAIGD----FRPNYIARFVD
Q4JCC9_SULAC          ---FKFKKYIPN------LLDLDYSNYGKILGGTYDVVILDLMDD----FRPNYISALVD
Q4JBI8_SULAC          ---EELRKIVKNSE---KLIDIDYSSSERYLGSTFDVAILDLVDN----FEPNHIGRLVD
A0A0V8RU50_PYROC      -------------------CFSP-GGFRRALGLGAGLVVVATDGL----LRPSLVAGVSG
A2BKG0_HYPBU          -------------------PGSP-GGFERLLGSEADYVIIATDGL----LRPNLVAGLAG
TMCA_AERPE            -------------------SWAPPGSIERILGGEYAAAIIAVPGL----LRPSIIAGAGE
A2BLX9_HYPBU          -------------------RVLSPSAIEELLGTENDAVLLAVPGL----LRPNLLAAAAE
B1L3H0_KORCO          -----HMGINLDRIPLDDATSIDFDQTEEVLGGTWDILIADISHQ----FRANDIGRLIE
B5IHD3_ACIB4          -----------TIDFKVPGEIEELKNSEKYLGTNYELLAMDLHHS----FIPNDLGKLIN
Q15W71_PSEA6          ------------GDAPSTYQEVNSVDYRQHLGREYNTLIYNCYSG----LSANALMAYSG
Q31DY3_HYDCU          ------------HSLHPQAEATHPKQLKLLLGQETDFAIFRAEEG----IEADALGIVSG
A6FY33_9DELT          -----------------GLRSVPLRELGRWLGGSFDLVGVDARGG----LAMDALGQAHG
Q3IDD4_PSET1          ----------------ALKNAQWPAHIHQILGQEFTHAIYDGFSG----LYPDKLAAIAG
A6VTS2_MARMS          -----------------QFKTCSFKQVRHELGSNHDAILVDLTHG----VSASALAILSG
TMCA_IDILO            -------------------ADAVLSRYRDYLGHEFEQVWIDCHDG----LHADAIAALCG
D3SEZ5_THISK          ------------REAPADVARVNPAQAGHWLGREADAIVFEASWP----LPADALAIAGG
F2G4U5_ALTMD          ----------------FTGEMLKGKKRKQVLGSEWDIAFLDCRDF----FRPGDVMAVAG
                                                    :*                      .     

B3GXD0_ACTP7          TIQAQGTLYLICPNWDTLEQQLDFD---SQRWNGGK-VIATPNFYRYFKALVQKFGFQFQ
B0BNX7_ACTPJ          TIQAQGTLYLICPNWDTLEQQLDFD---SQRWNGGK-VIATPNFYRYFKALVQKFGFQFQ
TMCA_ACTP2            TIQAQGTLYLICPNWDTLEQQLDFD---SQRWNGGK-VIATPNFYRYFKALVQKFGFQFQ
TMCA_HAEDU            TIQENGTLYLICPNWHSVEQQIDVD---AIRWNGGV-AIACPHFFQHFKRLINKFGFEVT
B0BPP2_ACTPJ          TIQDNGTLYLICPHWHNLNETMDED---ALRWNDNK-LIATPHFYHYFKKCVHEFHFEVT
Q9CM04_PASMU          TLQQDGVLLILLPQWAMLSTWQDPD---SVRWSGENDPILTPHFLHYFQQKVRDYGFPVY
TMCA_HAEIN            TLKMGGTLCLVLSDWENLSQQPDQD---SLRWNGNQSAIATPNFIYHFKQCIERYHFPIL
A6VQP5_ACTSZ          TLKAGGELVLWLDK----TQRIDLD---SRRWSGAEQGIETPNFYRHFYHLLAQYNRNEL
Q65RX4_MANSM          TLRAGGRLLLWLDK----NPHVDPD---SLRWSGAEQAVETPNFYAHFNRLLQVYGCDNG
TMCA_CITK8            TLRAGSWLVLLTPPYSAWESRPDAD---SLRWSDCPQPVATPHFIQHLKRVMARDEQTLH
TMCA_SALTY            TLQAGSWLLLLMPPYETWESRPDTD---SLRWSDCAQPIPTPQFAQHLKRTLSRDPQTLL
D2TTA9_CITRI          TLRAGSWLVLLAPPLDQWPLRPDAD---SLRWSDCPQPIPTPNFVRHFCRVLLADGQTLC
TMCA_ECOLI            TLKAGSWLVLLLPVWEEWENQPDAD---SLRWSDCPDPIATPHFVQHLKRVLTADNEAIL
TMCA_SHIF8            TLKAGSWLVLLLPVWEEWENQPDAD---SLRWSDCPDPIATPHFVQHLKRVLTADNDAIL
B7LKG7_ESCF3          TLKAGSWLVLLLPAWEEWENQPDAD---SLRWSDCPDPIATPHFVRHLKRVLTADHDAIL
A6TC97_KLEP7          TLRAGSWLVLLTPPFADWPTRADED---SLRWSDTPDPIVTPNFVHRCCRQFIADPEVLL
B5XVN1_KLEP3          TLRAGSWLVLLTPPFADWPTRADED---SLRWSDTPDPIVTPNFVHRCCRQFIADPEVLL
A4WD54_ENT38          TLRAGSLLVLLVPPLSLWPEKADAD---SLRWSDSAEPIATPHFVHHFCRVITADPDVIV
A0A0H3CQ14_ENTCC      TLRAGSLLVLLAPPLAVWADTPDSD---SLRWSDSAEPIPTPNFIRHFCQTITRDPDAIV
C9XXK7_CROTZ          TLKAGSWLVLLTPPWQAWPTRVDND---ACRWSDSREPIATPHFIHHLQHLFTQDPDVIC
A7ML07_CROS8          TLKAGSWLVLLTPPWQAWPTRVDND---SCRWSDSREPIATPHFIHHLQRLFLDDPDVIC
D2T6T0_ERWP6          TLRAGSWLILLAPEWAEWPLRPDAD---SLRWSECASPLPATLFIQRLQQLLLADERVVV
D4HY71_ERWAC          TLHAGSWLIMLVPAWHRWPLQPDAD---SLRWSECASPIPAPFFIRRFRQLLLADQRAVL
B2VE48_ERWT9          TLQAGSWLVMLVPEWQRWPLQPDTD---SIRWSEGDSPIPSPFFIHRFQQLLLEDNRIVL
D4GK02_PANAM          TLTAGSWLLLLVPPWARWAQQPDAD---SLRWADVSEPIATPHFVHHLQRLTEDDKQALL
TMCA_PECAS            TLRAGSWLIMLVPSWQVWSTLPDED---SLRWSEHAQPIATPHFIQHFQRQLLADDDVVL
C6DBS4_PECCP          TLQAGSWLIMLVPPWQSWPTLPDED---SLRWSEQDQPIATPHFIHHFQRQLSADEDVVL
C6CQK6_DICC1          ALRAGSWLLLLAPDWESWPNYPDND---SLRWSEQPEPIATPRFIRHVQRQLLADSRVVL
C6CC70_DICP7          TLRAGSWLILLAPAWDDWAFVPDAD---SLRWSEQPAPIATPRFIQHMQQCLLADPEVVL
TMCA_YERE8            VLRAGSWLLLLVPAWDDWALLPDSD---SLRWSEQSAPISTPNFIHHMQRQLLASPDVFL
TMCA_YERPD            TLRAGSWLLLLVPEWDDWPQRPDKD---SLRWSEQPAPIVTANFIRHLQRQFLADPDVVL
A8GHL3_SERP5          TLRAGSWLLLLTPPWQSWHQQPDSD---SLRWSDCPQPITTPNFIHHLQQHLAADSEVTL
TMCA_PHOAA            TLKAGSWLVMMVPSWHQWNDQPDRD---SIRWNEQSGAIPTPNFIQHIQRQIANDRQVLL
Q7N3J1_PHOLL          TLKAGSWLVMMVPSWYQWRDQPDKD---SARWNEQLEAIPTPHFVQHIQQQIVSDPQVLL
D3V7B0_XENBS          TLKTGSWLVMRVPTWSQWPAQPDED---SSRWNESAGVISTPYFIQHIQQQILGFPDILL
D3VI71_XENNA          TLKAGSWLVMRVPMWSQWTEQPDED---SLRWNESGGIIPAPHFIRHIQQQILMFPDVLL
Q2NS79_SODGM          TLVAGSWLVLLVPPWSRWPRLPDGD---SLRWSEQLQPIATPHFTRYFRAALSADPAVAL
C5B7A5_EDWI9          TLRAGSWLILLTPPWSAWAKRPDDD---SLRWSEREHPIATANFVHHLQRTLSDADGVTL
D0ZEZ3_EDWTE          TLRAGSWLILLTPPWSAWAQRPDDD---SLRWSEREQPIATANFVHHLQRTLSAADGVTL
B4EY73_PROMH          TLKAGSWLILCLPDIVQWQHYIDND---SQRWNDAQGVISTPHFMAWLAKITLADKQAII
TMCA_NITHN            AIRGGGLLLLLTPP-LAAWPSFNDPEHARIVTAPYEVTEVTGRFLKRLVRILREAEGVII
Q3J7N7_NITOC          AIRGGGLLLLLTPP-LESWPSFPDPEHARIVTFPYRITDVTGRFIERLVRLIRGAEGMVF
Q0A9W2_ALKEH          TVHGGGLLLLLTPP-LADWHRAPDPERVRLAVHPLRPEQVPGRYLWRLARLLRDSPDAWV
A1WWU2_HALHL          SLRGGGLLVLLTPA-WAEWPTRPDPLLGRLIPAGHGRDEAGQRFLRRLMAELEQDPSVTL
D3RRX5_ALLVD          AIRGGGLLALLTPP-VAEWLRRPDPQSERISVWPFEPSGLSRRFIARLIAVLESDPTVVR
Q1QTA5_CHRSD          TVRAGGLLVVLTPAEWATGTAHPDNDYARLAHWPHDARSLSVHYLTRLARVLHRDAGVWC
A1U6V4_MARHV          TLRAGGLLFWLMPP-LAQWSDFDDPDYRRTGLDRAS----GHPFAARLATVLAEDPDVIR
A0A656HB11_THINJ      TLRGGGTFYLLTPP-LAEWAGFPDPDYRRFLPYPFQPGAVEGRFLRRFVGLLDAWRG---
Q2SKZ4_HAHCH          TVRGGGAVLLLTPP-APRWPSFDDPDYQRILAYPLTHQDVDGHYLRHLQGRLDNARG---
A4SIB4_AERS4          TLRAGGLLLLLTPP-RELWPAWPDPDRIRLVAQPEEASRAGHGFIARLVRLLTGD-----
A0KPS8_AERHH          TLRAGGLLLLLTPP-RAQWPEYPDPDRVRLVAQPEDIVLAGHGFLARLVRLLAGE-----
C4LD78_TOLAT          TVRAGGLLVLLMPP-LADWPQFADPDYRRYVSQPEEVTRCYPHFLQRLQRLLTQDGSVWH
TMCA_VIBCH            TLVGGGLL-LVVGE----------------PTT--LNHCARVWLERACHRLLVITPQTVP
A1T0E4_PSYIN          TLRGGGLLILLTPT----------------DIS--CDDLFYQYISAQLQHFNFLTLKQGL
B6EPZ0_ALISL          TLVGGGLVFFVKDK----------------NSQ--LPSTLIQWISGFKTEMICLSEELSI
Q6LFR2_PHOPR          TVIGGGLLLLLVPS----------------CWF--DDTPTQLPFIQRLVRLLSQPDVLLI
Q487G0_COLP3          TLKAGGILFLVIPS----------------RDEKLEQSLFFKRFYSLLSKMPSHTIITES
A0A1H9ZCM0_THASX      VLTIGGVVIVPKLI----------------EQD-GHSSLFMERFYQLALAQEEVIVVTQG
TMCA_HALMA            AVDGGGLYVLLAPPLETWPEERDGFD-ASLAVPPFGVEDVSGHFRRRFVETLRAHRGIAI
D2RVY0_HALTV          AVDGGGLLVLLTPPLEDWPNRRGAFD-ESLAVPPFSLDDVTGRFRARLVETLRAHRGIGI
A8MCG8_CALMQ          VVRGGGIYVLLMPPVDKWLNSITKFQLKLITPPHKPEEIRQYLKSRFWRSLINGEGVSIY
A2BLE0_HYPBU          IVEGGGLIVFMVPPWSKWDKWITIFKQNLVVPGYN--EPRHVFISWFKRKLLDHKGIFIF
TMCA_THEPD            VVEGGGLYIFLLPSFTRLLETVTRFQSNLIVPGYTDKDLKRYFEKRFIKKVMEHQGVAVY
TMCA_METKA            TVRGGGLVIFQTPPFDRWRNMWTAFHKSLVTPPYTLDHVGKRFNRRFIRKLKEHDGVWIV
TMCA_PYRAB            TVRGGGLIFILTNPFEKWKDMWTGFHKSLVTPPYTIDDVKKRFNRRLIRKFTEHKGIYIV
D2RDE6_ARCPA          TIAEGGMILALSPPIQEWQNLKSKWHEELVSEPYTIDDVVPRFYRRFIKRTLLAKGIIIY
TMCA_SULIY            MTKGGGMAIIYSDDILRGKLYKESLTRDGV--------VKDLFERRFMELAKRYRGIIFL
Q4JCC9_SULAC          LVRGGGLIIMYSDDLQRNKLYKNSIQRNGI--------VDNYFEERFLRMAKSYPGVFLF
Q4JBI8_SULAC          LVRGGGLIILYTNDLKNNKIFKNSILREGK--------VLDVYETRFIRKLTEHEGIFVI
A0A0V8RU50_PYROC      IVSAGGLLVVAAPPLEEWDPGVGG----------------GGYRGYLLSRLRAARVLFWA
A2BKG0_HYPBU          VVSSGGMLVIMAPPLHEWNPGPSGGV--------------GGYRRYLLSSLREARVLLWA
TMCA_AERPE            TVRSGGFLAIVADPPDRWDPGPPRGT--------------GLYREYLFSAIRDNPVHLWI
A2BLX9_HYPBU          TVRGGGVVVLVVPRLDVWQPGGGMST--------------GLYREYLLRSLGRLESLFWA
B1L3H0_KORCO          VVRGGGLAILTIPPAEEWINSMTEFQRRFMVPPFESRGVRQLFKSRFLSSIGKRGTFLLG
B5IHD3_ACIB4          IVEGGGLIILLTPPFENWPKMRNFFHEVILTPPYTMDDIKGNFARWVIKKLKEHNGITII
Q15W71_PSEA6          TIKANGLMILICPELKSWSQYTDPLS-KKRYSYGYAQYLEPSRFINRLISIIEKDQNTVV
Q31DY3_HYDCU          MIRAGGLCIICLPDQATFEHLPNPLLKHFLNFPLTPKDSLKGFNHYLWQELQHAALWCTP
A6FY33_9DELT          LVRGGGALILDLREHPGARSTRGRH----LAAFPHGVEDVGARLAAHVERTLGAAATPLE
Q3IDD4_PSET1          TVRAGGVLFVLLPELGNLNNWQDPA---LKSVQSHGHSNQYSLFNQRFSSIIKSLPALHY
A6VTS2_MARMS          TVRGNGLFAIALPD-DEWLSMADQDLSRYLPWPYEPEQVTSHFKHYLLDKLQDATSPFKL
TMCA_IDILO            TVTAGGLLSILLPA-------------------------ESNAMSHRMERFAAKHFAESN
D3SEZ5_THISK          LLRGGGVLLLLVDP------------------------PGDGAFGRRWANALRHAPVHWV
F2G4U5_ALTMD          TVKQHGCLILICPPFTKWPENAAVS------FISEGYSLKRSLYLARFIDRLQGNPSIAF
                           .                                                      

B3GXD0_ACTP7          TLEETDFSLPKQP-PQCQATES-----------------------LTPQQQKIFEKLPLD
B0BNX7_ACTPJ          TLEETDFSLPKQP-PQCQATES-----------------------LTPQQQKIFEKLPLD
TMCA_ACTP2            TLEETDFSLPKQP-PQCQATES-----------------------LTPQQQKIFEKLPLD
TMCA_HAEDU            SRPQQPF-IKTAP-SYPAKLIQ-----------------------FTDEQQNILQKLPLD
B0BPP2_ACTPJ          A----EFSYPTSG-QNPVGFHQ-----------------------FTPQQQNIFENLPLD
Q9CM04_PASMU          HTFFPSLSLPDKSTSAVDFQSE-----------------------PTVEQAQLLHRINKA
TMCA_HAEIN            REE-SAVEFPTV-FYSNEHHKN-----------------------ATLAQQQIIENILQA
A6VQP5_ACTSZ          QTSCTDHHVERD---LCDIPGQ-----------------------VTVQQEKIINRILRQ
Q65RX4_MANSM          IQAQNNQSVSTQ---KTNIAST-----------------------ATAEQQQIIRQILQA
TMCA_CITK8            WQ-QSQPFSWPRFPARPHWQPA--------------------TGEPQPEQAAILRHLLRM
TMCA_SALTY            WR-QRQPFCWPSYPSRECWRPA--------------------TGEPQPEQAAILSRLREM
D2TTA9_CITRI          WR-QPQSLSVTHFPGRPAWQSA--------------------TGEPLPEQSAILAQLRQM
TMCA_ECOLI            WR-QNQPFSLAHFTPRTDWYPA--------------------TGAPQPEQQQLLKQLMTM
TMCA_SHIF8            WR-QNQPFSLAHFTPRTDWHPA--------------------TGAPQPEQQQLLQQLLTM
B7LKG7_ESCF3          WR-QNQPFTLTHFIPRTDWHPA--------------------TGAPQPEQQQLLQQLLTM
A6TC97_KLEP7          WR-QSDRPRFPLAAPRPDWHPA--------------------DGRPQTEQAAILEQLIRL
B5XVN1_KLEP3          WQ-QSDRPRFPLAAPRPDWHPA--------------------DGHPQAEQALILEQLSRL
A4WD54_ENT38          WQ-QHQPLKIASRPPFPDWHPA--------------------SGDPLREQADILNALTQM
A0A0H3CQ14_ENTCC      WQ-QNQPLTLPPFPDAPDWQPA--------------------NGAPQREQAEILQALRAM
C9XXK7_CROTZ          WR-QEQPLQAVPSAPRPRWRPA--------------------CGEPQREQALLLDELLTT
A7ML07_CROS8          WR-QEQPLPLSPSAPRPRWHPA--------------------CGEPQQEQARLLDELLTT
D2T6T0_ERWP6          WR-QHHACTVSEIASLPSWQGD--------------------NSG---QQQQILTQLLRA
D4HY71_ERWAC          WR-QHHACTIPDLTDLPTWPGD--------------------NSG---QQQQILTKLLRA
B2VE48_ERWT9          WR-QHHGCSVPDLPDPLTRPGD--------------------NSG---QQQQVLAALLCA
D4GK02_PANAM          HQ-QPQPLALPNWSSRPAWHCQ--------------------AAS---QQQSILQELAHF
TMCA_PECAS            WQ-QGQPLVIQPLAVRSDWQPA--------------------QGEPTARQQQILHELSAA
C6DBS4_PECCP          WQ-QGQDSVIRPLAVRADWQPA--------------------NGEPTTRQQHILDALSAA
C6CQK6_DICC1          WRRQDIEPIITRPNGRADWLPA--------------------DGNPTACQYSVVQQLLHT
C6CC70_DICP7          WR-QHTNPVISLPVSRPDWTPA--------------------NGTPSAEQRALLQRLLAE
TMCA_YERE8            WQ-QGQLPPVPQFAARPNWQPP--------------------DGTPTTEQQAILQRLMQG
TMCA_YERPD            WQ-QDRPLILPAVGSRPCWQQP--------------------DGSPTAQQQHILQRLMQA
A8GHL3_SERP5          WR-QDEPLTLAPLPVRPQWQAP--------------------NGQPTFEQQALLTQLLGA
TMCA_PHOAA            WR-QNDPFYIPELPQYREWQLP--------------------DGQPTAHQHTILARLLRA
Q7N3J1_PHOLL          WR-QNDPLCIPVFPQYSAWQLP--------------------NGSPTASQHAILARLLRA
D3V7B0_XENBS          WQ-QGKPFQPMQLPQTASWQMP--------------------DGNPTASQQAILEQLLRA
D3VI71_XENNA          WR-QETPLQLQPLSQAGLWQMP--------------------DGNPTVSQQTILNELLQA
Q2NS79_SODGM          LR-QDRAPQITLLVSRLPWHPPV-------------------PGRPTADQGRLLRRLAQA
C5B7A5_EDWI9          WR-QGEVCPAPMPLGCSAWRAP--------------------DGAPTVQQQAILRALR-T
D0ZEZ3_EDWTE          WH-QGAACPAPAPLRRAAWRVP--------------------DGTPTEQQRAILRALR-T
B4EY73_PROMH          WQ-ASQPLVLPEIKNTGQQWALP-------------------QGMPTIQQRQLLAHLLQA
TMCA_NITHN            IEQGKILPSVPFAA--PARAETGG---------NPPS--PGDSACRTEDQGRAVEAIVKV
Q3J7N7_NITOC          IEQEKGFPRVQQVT--SANIRISD---------SPLADKEEDGECRTADQRRAVEAIVKV
Q0A9W2_ALKEH          VEQDG--TAVPAAP--DRLPPSQS---------ASAVVGPAGGGPLTPDQAQAVEALVRS
A1WWU2_HALHL          WTPEQPPPALEPTP--PAAPGGAY-----------------AYGCLSADQKTAVEAVMHV
D3RRX5_ALLVD          IDQDRAEPMTASVAGVPSTLPHDR---------TYQPTRTDPARPSTPDQAEAVAAILKT
Q1QTA5_CHRSD          WPAERRMPRPGRLPSSEASPPRPD-----------------DTACVTADQAAAVHRLTRL
A1U6V4_MARHV          LAADNGTVPVLNRPEPGRADFQPG---------------------QTAEQQTLVADVVRA
A0A656HB11_THINJ      -EEGECNSPLRKIVGANCIRPPQN----------------DQCSAIQAILHSVM------
Q2SKZ4_HAHCH          -WLRVSFGANAKPVIRETHTGPDI----------------QSNTCRGAVHQSTVITALRT
A4SIB4_AERS4          ------PALSLLPPTSPQPWQPIG----------------AERP-LSDDQALALPAIQRV
A0KPS8_AERHH          ------KALELTPPATTTPWQPVG----------------PARP-LSCDQARALPAIHKV
C4LD78_TOLAT          WDLSSGTLHHPLPELPAAEWQIIP----------------DRTGCLSTEQHHAREAVLAC
TMCA_VIBCH            ALPN-------SDSVTRTNTEQT-----------------------YTEQRLAIDSIIKV
A1T0E4_PSYIN          PLPNFTLPPANNCPVINKQPALN-----------------------LSGQHNAIQEIIKT
B6EPZ0_ALISL          PQYE--RPENGSTVFTSEVYAS-------------------------NDQDVAVSAIKKV
Q6LFR2_PHOPR          QQSDTFHPDLPSSYFAKNDYQDLR------------------FGCLTQEQTLAVEAIKKV
Q487G0_COLP3          QASVLPLHFDVDNPVKLSATSTYP------------------HGCITQEQYSAVIAIKKV
A0A1H9ZCM0_THASX      QA----LPKLSLEALPEIETASFA------------------YHSITQDQQEAVEAIMKV
TMCA_HALMA            VDVDRGTVEQDGLTDPPPSRP----VPSPTPPTDAWFRSETYAQCLTDDQRDAVQAFESL
D2RVY0_HALTV          VDLETERIVDDGLTEPAPKRVDGSDATSLGAPPNARFPADAYEACLTGDQRDAVAAFESL
A8MCG8_CALMQ          DTDE-----SRFIKPPQPINVQEVSQTQLSIPSVKGKAIEVYKLAKTQDQVNVISMLEGM
A2BLE0_HYPBU          DTDD-----GEIIKA-DDYPLRRRTEQKIEIPEKTEFPRELYELALTQDQVNVIKVLESL
TMCA_THEPD            DADN-----RYWVKKFGKTPSTPYARPKPVLPQKSKIPVKVFNLALTQDQVEVLKIFEHF
TMCA_METKA            DTDEWTAEPEPSEDVDLEVEVKRRERPDLDPPDDAVLPEELYRMCATEDQFRALIRFEEL
TMCA_PYRAB            DADKKKIERRPRKN---KSQAKLPEREKVEIPRDIKFPRELYELCLTRGQVEVLKALEDL
D2RDE6_ARCPA          DLDK-----RKLIKPYEFEKVEESREEIILPEEEREISKKLYKLCATQDQVRVLELFEHY
TMCA_SULIY            QGDRL--------TFTPYSSNETHKSHKKI-PKSPKVPMQLHELCLSSDQNKVLEESLFI
Q4JCC9_SULAC          VNDNLE-------SFNTFKTEQLSIINSKLNPRKSIINSKLYSLCLTDDQAKVLDESLFI
Q4JBI8_SULAC          SNSEY--------YAKPFKGEVKEKPSPQL-PKKPTMPVELHSLCLSSDQNKVLESFIGM
A0A0V8RU50_PYROC      DADSGR-VYAHR---SPRGRAGGWARGPGGYRPRGPVPRGLLELAATPGQARALDEFSLF
A2BKG0_HYPBU          DADTGE-VYAYQ---PPRGRAHEWLLGPRGYEPRFGAPRRLLGLAATPSQAEALDRFSLY
TMCA_AERPE            DDESGR-IVSESFLEYTGVGAQGWSPGRYKPSPGSGVPRRLVSACRSESQARALESLARF
A2BLX9_HYPBU          DADLDT-VYSMR---LPRGKARKP-PGPEGYRARSPVHRKLLEAAATIEQAEALDKIVAH
B1L3H0_KORCO          EEVRGELCGRVSKDRAPIERTGDP----------------LFDLCATRDQQRVLRSILDA
B5IHD3_ACIB4          ENGKITKRGNLNCEKRDRKIEIPK---------KTRFPRDAYEMCMSQDQVRVLQTIERI
Q15W71_PSEA6          ITPSSFRGHNAVIAPEHLNRQL---------------------DSATLEQDKVVSSIIKA
Q31DY3_HYDCU          QNALPDLSALKPATENSAWQGD-----------------------KTPDQVTALEAIHHV
A6FY33_9DELT          RWLARPPSARLPPDAALTGSAE------------------------QAELVARLLALWSS
Q3IDD4_PSET1          SEEFGCINNNYNYVLHSNIDFE--------------------------PQKNCVAQIVKV
A6VTS2_MARMS          LPSGKNKKHSVNPLPILKPIEP--------------------NAQLTQEQAEAQSCLFAE
TMCA_IDILO            IKPYSSVNKTETRSANETLQLTN-------------------------EQNSIFNALTQS
D3SEZ5_THISK          NDDVEQWPIPDAGVQPPWAWTE--------------------------DQRRGLVTLDEL
F2G4U5_ALTMD          YRESATSLPDIARYEVNKLDAANV---------------YRGALFKSYEQEHAFNKLSQG
                                                                                  

B3GXD0_ACTP7          SSA-----------IHLITAPRGRGKSTLAGKLAQQLAK--------TESVLITARSHSV
B0BNX7_ACTPJ          SSA-----------IHLITAPRGRGKSTLAGKLAQQLAK--------TESVLITARSHSV
TMCA_ACTP2            SSA-----------IHLITAPRGRGKSTLAGKLAQQLAK--------TESVLITARSHSV
TMCA_HAEDU            PAE-----------IHIITAARGRGKSTLAGKLAEQFAK--------TEQVILTAHRSSS
B0BPP2_ACTPJ          SAD-----------IHLIIAPRGRGKSTLAGKLAEQIVQ--------HSPVLITARSQTA
Q9CM04_PASMU          TEA-----------VLIVTAKRGRGKSALAGFWARQLKQ-------QNQTLILTAPNKAA
TMCA_HAEIN            EQD-----------IYFLTAKRGRGKSALLGMLANQI----------QAPVYLTAPNKSA
A6VQP5_ACTSZ          KSD-----------LYIITAKRGRGKSALAGMLLNRIGH----------KCYVTAPNRSA
Q65RX4_MANSM          DSD-----------IFILTAKRGRGKSALAGLLAKELRNSAQYHK-KPFNVYLTAPNKSA
TMCA_CITK8            PPG-----------VAAVTAARGRGKSALAGQLISRMSG----------TAIVTAPSKAA
TMCA_SALTY            PPG-----------VATVIAPRGRGKSALAGQFISRMAG----------TAIVTAPAKTA
D2TTA9_CITRI          PER-----------IAAVTAARGRGKSALAGQLIAHLSG----------QAIVTAPTKAA
TMCA_ECOLI            PPG-----------VAAVTAARGRGKSALAGQLISRIAG----------RAIVTAPAKAS
TMCA_SHIF8            PPG-----------VAAVTAARGRGKSALAGQLISRIAG----------SAIVTAPAKAA
B7LKG7_ESCF3          PPG-----------VAAVTAARGRGKSALAGQLISRIAG----------SAIVTAPAKAA
A6TC97_KLEP7          PPG-----------IAAVTAERGRGKSALAGMLLRQLGG----------EAIVTAPTRSA
B5XVN1_KLEP3          PPG-----------IAAVTAERGRGKSALAGMLLRQLEG----------EAIVTAPTRSA
A4WD54_ENT38          SAG-----------VAVVTAARGRGKSALAGMLLQRVEG----------RAIVTAPAKGA
A0A0H3CQ14_ENTCC      PKG-----------VAAVTAPRGRGKSALAGMLLNSIEG----------RAVVTAPAKGA
C9XXK7_CROTZ          PDG-----------VTVITAARGRGKSALAGMFIRALPG----------RALVTAPARAS
A7ML07_CROS8          TDG-----------VTAITAARGRGKSALAGMFIRALPG----------RALVTAPSRAS
D2T6T0_ERWP6          RPG-----------ICVVTAARGRGKSALAGMLAARWPG----------RCLVTAPAKVA
D4HY71_ERWAC          RPG-----------IYVVTAARGRGKSALAGMLAARWPG----------RCLVTAPAKVS
B2VE48_ERWT9          KPG-----------IYVVTAARGRGKSALAGMLAARWPG----------LSLVTAPAKVS
D4GK02_PANAM          SAG-----------VAVITAARGRGKSALAGMLA-RQNT----------RCLVTAPAKIT
TMCA_PECAS            ESG-----------VFVITAPRGRGKSTLAGMLTQRSRG----------TCWITAPSRSA
C6DBS4_PECCP          ESG-----------IFVITAPRGRGKSALAGMLTQRSRG----------ACWITAPSRVA
C6CQK6_DICC1          THA-----------VSVITAPRGRGKSTLAGMLARQCQG----------GCWVSAPSRAA
C6CC70_DICP7          KPA-----------ISVITAPRGRGKSTLAGMLARRCQS----------ECWVTAPSRSA
TMCA_YERE8            RQG-----------VWVLTAARGRGKSTLAGMLVAQSAG----------HCWVTGPGKAA
TMCA_YERPD            DSG-----------IWVLTAARGRGKSTLAGMLVTHWQG----------ACWVTGPGKAA
A8GHL3_SERP5          EPG-----------VWVLTAARGRGKSTLAGMLVANTPL----------TCWLTGPSRAA
TMCA_PHOAA            NQG-----------VWVIIAPRGRGKSTLAGMLIQQWQG----------HCWLTAPAKAT
Q7N3J1_PHOLL          SQG-----------VWVITAPRGRGKSTLAGMLMQQWQG----------NCWLTAPAKAT
D3V7B0_XENBS          SQG-----------VWVVTAPRGRGKSALAGMLIQQWQG----------KCWLCAPAKIT
D3VI71_XENNA          SRG-----------VWVITAPRGRGKSALAGMLVRHWHG----------KCWLCAPAKIT
Q2NS79_SODGM          KPG-----------IYVMIAPRGRGKSALAGMFAQTLDD----------ACCITAPTKAA
C5B7A5_EDWI9          PAA-----------VNVVLGPRGRGKSTLSGMLAAELRG----------DCLLTAPARVA
D0ZEZ3_EDWTE          PAA-----------VNVVLGPRGRGKSTLSGMLAADLRG----------DCLLTAPARVA
B4EY73_PROMH          KSG-----------VWSITAPRGRGKSALAGMLIEQWPG----------SVTVCAPARNS
TMCA_NITHN            VTG-------QRRRPVVLTSDRGRGKSAALGIAAARLL-----QR-GLKHIIVTGPRLDA
Q3J7N7_NITOC          VTG-------QRRRPVVLTSDRGRGKSAALGIGAARLL-----QR-GLKRIIVTGPRLDT
Q0A9W2_ALKEH          ASGRG-----HRRRPVVLTSDRGRGKSSALGLAAARLL-----RQ-GLADIRVTAPAAEA
A1WWU2_HALHL          VTG-------HRRRPAVLTADRGRGKSAALGIAVGELLR----QR-RVQRVVVTAPTIHA
D3RRX5_ALLVD          AHG-------RPRRPLVLTAHRGRGKSAALGLAAGRLL-----IE-GGRRLVVTAPRRDA
Q1QTA5_CHRSD          RRR----------RPVVLSADRGRGKSAALGIAAARRL-----QA-GETLLWVTAPRRAS
A1U6V4_MARHV          GQG-------RRRRPLVITADRGRGKSSALGMAAARLL-----ET-GRKRVLVTAPSADN
A0A656HB11_THINJ      --------------PVVLIADRGRGKSAALGMAASQLIA----E---GKGVLLTAPSRAT
Q2SKZ4_HAHCH          LSA-------GQQDALVISADRGRGKSAALGVAAAHRIA----EQ--AETILVTAPSFAA
A4SIB4_AERS4          LHG-------HRRRPLVLSADRGRGKSSLLGLAAAGLLR----QQ-PDLKIVVTAPSQAT
A0KPS8_AERHH          LHG-------HRRRPLVLSADRGRGKSSLLGLAAAELLR----QQ-PDLQIVVTAPSQAT
C4LD78_TOLAT          AMA-------ARPYPLVVMADRGRGKSAALGLAAQQLLA----QG-K--RIIVTAPSQQS
TMCA_VIBCH            VTG-------HRKRPLVLTADRGRGKTSALGLAAAELMS-----S-RSMHIVVTAPTLAA
A1T0E4_PSYIN          VTG-------HRRRPLVLTADRGRGKSAALGIAAAQLLSE----S-RVKKILVCAPNKQA
B6EPZ0_ALISL          VTG-------HAKRPLIITADRGRGKSSAIGIAIAELVL-----S-HKLTIAITAPQRAS
Q6LFR2_PHOPR          VTG-------HRKRPLVLTADRGRGKSSALGIAAASLMT-----E-RRIRIGVTSPSFAN
Q487G0_COLP3          LSG-------QRKRPLVLTADRGRGKSSALAIACAQLMKEH--EQ-DEFDIVITAPDVQA
A0A1H9ZCM0_THASX      ATG-------RRRRPLVLTADRGRGKSSALALACMALQSQQ--D--TPLEVVITAPHVNA
TMCA_HALMA            QTAGE---------AVVVEADRGRGKSSAAGLAAGNLAA-------ADRDVLVTGPQYRS
D2RVY0_HALTV          LESDNPDDSEGQQRAIVLEADRGRGKSSAAGLAAGAFAA-------EGLDVLVTAPRSRN
A8MCG8_CALMQ          VNE-------KGKVNAVIIADRGRGKSAAVGLAVSLIGHRLRRRR-GVARIVVTAESPDN
A2BLE0_HYPBU          LEKP-----KKKRRAIIITSDRGRGKSGAVGIASIGLAARLRKEL-GRVRIVVTAPNLSN
TMCA_THEPD            YAKA-----EKEKLVFVLTADRGRGKSSAVGLGVGWLAHRLRRAK-GKCKVVVTAPAVTN
TMCA_METKA            LES-------NGKTALILTADRGRGKSALLGIAVAGAGVTTDV-----YDVVVTASEPEN
TMCA_PYRAB            IEN-------PG--MVVLTADRGRGKSVSVGIASIGLAITSKKK---NFRIVVTAPELEN
D2RDE6_ARCPA          FDR------KKERKAVVITADRGRGKSAVLGIVTPYLIWRMFKVLKRPVRIMVVAPTPYA
TMCA_SULIY            TSP--------GKRVLVVTAARGRGKSASIGLFLSYLMTEEKFGN-----ILVTSPTYYS
Q4JCC9_SULAC          LED--------GRRVLTITAPRGRGKSSSIGLFLSHLSTLNISLD-----IIITSPSYYS
Q4JBI8_SULAC          RYG--------SRKVLVITASRGRGKSAVTGLGMAGLIFKHGFRKGRKYKIIVTAPSIAS
A0A0V8RU50_PYROC      LGS--------RARSFLVTGDRGRGKSFLLGLAVALAVRRGAVGE-----AAAVAPEPWA
A2BKG0_HYPBU          LDA--------GYRSFLVTGDRGRGKSYLLGLAVALAVKRGAAGE-----AVAVAPSPAS
TMCA_AERPE            FRG--------RWRSALVRGDRGRGKSYVIGLALAYAAWRRLIGR-----AVLVGPTPLS
A2BLX9_HYPBU          VRS--------RGRSILVLGDRGRGKSGLLGLAVAYIVASHMAGF-----VSVTAPSPAN
B1L3H0_KORCO          FKE--------RKRAFILTANRGRGKSAVIGIALSLIMNRS-----KIRSAVVTSPSIEG
B5IHD3_ACIB4          GKH----------GVVIITADRGRGKSSVLGIAAGMLAG-------KLKRIGITAPDFSN
Q15W71_PSEA6          ASGHR-------NRPLVVTADRGRGKSSALGRAARALMLE------QEKRILITAPIKHN
Q31DY3_HYDCU          AYGHR-------KRPLVLTADRGRGKSTVLGLACIELIRS------GKKRITLTAARLTQ
A6FY33_9DELT          PEP----------TRAVLLADRGRGKSSALGLALAGRTG--------QGSLAITAGSERA
Q3IDD4_PSET1          AHG-------RANRPLLINADRGRGKSAALGLAAAKLAD---------KNVIICATQFRA
A6VTS2_MARMS          LAK-----------SYVLIAPRGRGKSTLLGDSLAKLIK-------AGKRVAITAPNQDA
TMCA_IDILO            TAK--------PYETHIITAERGRGKSTLLGQALAQAKE--------HRSIIVTAPRKAN
D3SEZ5_THISK          GPG----------ECGALVADRGRGKSTLLGEWIACQRS-------AGTPVVVTAPGAGA
F2G4U5_ALTMD          FYH--------NQLNALITAPRGRGKSSLLGLFIQKLIR-------EGHRVLLTSERQEN
                                       : . *****:   .                       .     

B3GXD0_ACTP7          LPNFWKS-AAQ------------------------------NIPFFAPDHLLQKIAAN--
B0BNX7_ACTPJ          LPNFWKS-AAQ------------------------------NIPFFAPDHLLQKIAAN--
TMCA_ACTP2            LPSFWKS-VAQ------------------------------HIPFFAPDHLLQKIAAN--
TMCA_HAEDU            IQKILQT-ASI------------------------------NIPFFAPDKLLNLIETK--
B0BPP2_ACTPJ          LPNFWRINQSE------------------------------HIQFLSPDVLIKQIEEQ--
Q9CM04_PASMU          VRILQAF-ANT------------------------------ALDFKSPDLLCEQIAQDP-
TMCA_HAEIN            VHSVIEF-SEG------------------------------DIEFIAPDELALTLQTEP-
A6VQP5_ACTSZ          VKILQDF-ADE------------------------------RLDFIAPDDLIRQINANF-
Q65RX4_MANSM          VETLQLF-AGE------------------------------KITFIAPDELCRRIGQNA-
TMCA_CITK8            TDVLAQFAGE-------------------------------KFRFLAPDALLAGTET---
TMCA_SALTY            TDILAAFAGE-------------------------------RFCFMAPDALLASGAR---
D2TTA9_CITRI          TDVLAQFAGE-------------------------------KFRFMAPDALLASEEK---
TMCA_ECOLI            TDVLAQFAGE-------------------------------KFRFIAPDALLASDEQ---
TMCA_SHIF8            TDVLAQFAGE-------------------------------KFRFIAPDALLASDEQ---
B7LKG7_ESCF3          TDVLAQFAGE-------------------------------KFRFIAPDALLASDEQ---
A6TC97_KLEP7          VEVLASFAGE-------------------------------TLRFMAPDALLASKEK---
B5XVN1_KLEP3          VEVLASFAGE-------------------------------AFRFMAPDALLASQET---
A4WD54_ENT38          TDVIARFAGD-------------------------------NFRFVAPDALLASDER---
A0A0H3CQ14_ENTCC      TEVIARFAGE-------------------------------HFHFMAPDALLASSHH---
C9XXK7_CROTZ          AEVIAAHAGD-------------------------------KFQFMAPDALLAALEDG--
A7ML07_CROS8          AEVIAAHAGE-------------------------------KFVFMAPDALLAALEDG--
D2T6T0_ERWP6          TDVLANYAGE-------------------------------RFRFIAPDRLLAEARQH--
D4HY71_ERWAC          TDVLAHYAGP-------------------------------HFQFIAPDRLLVEARQH--
B2VE48_ERWT9          TDVLAHYAGE-------------------------------HFRFVAPDRLLAEAHRL--
D4GK02_PANAM          TTVLASFAGE-------------------------------HYRFMAPDAILALPDQP--
TMCA_PECAS            TDILQQYARS-------------------------------DAPFWAPDALLAYCR----
C6DBS4_PECCP          ADILQQHART-------------------------------DAPFWAPDALLAHCR----
C6CQK6_DICC1          GEILLRQAGD-------------------------------SATFWAPDALLAFCR----
C6CC70_DICP7          SDILLQQAGE-------------------------------QVRFWAPDALLDYCR----
TMCA_YERE8            TQVLSQRAGD-------------------------------RARFWAPDALLEYCQ----
TMCA_YERPD            TQVLNQQAGE-------------------------------RARFWAPDALLDYCQ----
A8GHL3_SERP5          TEVAGEWAQG-------------------------------RAQFWAPDALLAHCR----
TMCA_PHOAA            TEVVRCYSSE-------------------------------KGQFWAVDNLLKYCR----
Q7N3J1_PHOLL          TAVIRCYAGE-------------------------------KGKFWAVDNLLKYCR----
D3V7B0_XENBS          TEVIRYYSGTSDP-----------E-----QGSP-----VDKTPFWAVDNLLKYCRLKNN
D3VI71_XENNA          TEVIRHYSGPSEQ-----------E-----------------TPFWSVDNLLKYCRSKKD
Q2NS79_SODGM          VDILRRYAGP-------------------------------GAPFFAPDALLARCRAG--
C5B7A5_EDWI9          AERVQTTAGT--------------------------------LPFVAPDLLLQRIEAG--
D0ZEZ3_EDWTE          AERVQTTTGD--------------------------------LPFVAPDLLLQRIEAG--
B4EY73_PROMH          IEVLLSHTHK-------------------------------TIEFYSPDNLLALCDTE--
TMCA_NITHN            VEPVFRHAQRLLPQATVSRAALHLP-----EA---------GMEFAPPDDLIRT------
Q3J7N7_NITOC          VVPLFRHAQRLLPQASVSRTVLTLH-----GA---------RLEFAAPDALIRT------
Q0A9W2_ALKEH          VQPLLEHAAAGLPGSRRTRTAVEWR-----GR---------SLRFAVPRALLDS------
A1WWU2_HALHL          AEGLLDHAAERCGGERVERRRLRCH-----GA---------EVVYREPEALRER------
D3RRX5_ALLVD          VETLYRHAGAVLIDVERSTGQTRDG-----ATAL-----Q-SLVFRSPAELLEY------
Q1QTA5_CHRSD          VEPLFARLAALFPHGHRAEGRFQVT-----LASR-----ACEVRFLAPDAVIEALSAPD-
A1U6V4_MARHV          VATLFAHARQALGDALALDTPTHLT-----TRSG-----H-ELCFLPPQELLSQ------
A0A656HB11_THINJ      VESVFKHAENPPD-------------------------------FFAPDDLLQT------
Q2SKZ4_HAHCH          AANLFKHAEMTATE-------LGLD-----QERL-----KQRLLFIAPDDLLQR------
A4SIB4_AERS4          VATLFAHAARALD-----------T-----TQEQ-----LVGLEFCSPDRLVHE------
A0KPS8_AERHH          VATLFAHAARALE-----------D-----VPQL-----LAGLSYCSPDRLVHE------
C4LD78_TOLAT          ARTLLQHSGQH-----------------------------PALFFYSPEALLEQ------
TMCA_VIBCH            VEPLFVHAQRTL----PQAHRQRGE-----VQTA-----QSSLRFMAPDELLRTQ-----
A1T0E4_PSYIN          TATLFRHANLIL----KPAHGQSGT-----TTID-----QGTIEFIAADTLLDEY-----
B6EPZ0_ALISL          VDEIFSHAARVSIQLGMPVEHNKNT-----LIIN-----GSSILYIAPDELVRGE-----
Q6LFR2_PHOPR          VNTLFTRAADA---LGIEYNQEKN------LSFE-----SSDMVFFAPDTLLTTQ-----
Q487G0_COLP3          LSVFYRQLKQSL--NCVEQQGN--T-----ITFG-----KVKLTFMAVDQLIRSP-----
A0A1H9ZCM0_THASX      VSTFFKLLYKHL--DITPSEKSNPT-----IEVP-----GLRISFMAVDQILAQR-----
TMCA_HALMA            AAEVFVRAAHLLEAFGVDFTRDRSSDPQRLDVAG-----AGCVRYAPP----DEAASLPD
D2RVY0_HALTV          AAELFDRAGELLETLEADATIDGRT----IETGS-----GGRVRFLEPSTAVERIESAAD
A8MCG8_CALMQ          AETLMEFAKRGFEELGY---------DVEVSRTG-----S-NIVGLSTRGIYVDYYKPYP
A2BLE0_HYPBU          VQSFFTLALKAAEKLEL---------KTHIVRRG-----D-NILEIHGKGFSIEYWEPIH
TMCA_THEPD            VQEVFRFSAAVLDLFKH---------KVEVLEDE-----SGMITKLLSKGIEIEYVTPLD
TMCA_METKA            VAVLFEFLLEALRELGV---------EYDVERDD-----KGNIVYVETDDFVVEYERPSE
TMCA_PYRAB            VQSLLKFAERSLKVLGY---------KTKTVKES------GLIKEVYAKGIGIRYYPPTK
D2RDE6_ARCPA          VQTYFKFLLKAMVRVGM---------KFRVKESG-----K-LITVVNSKYARVEYVVPRR
TMCA_SULIY            SQEIFNFVIKGLDALNV---------KYKLTTSK-----DGKIMKITTGESRVKWVSPDL
Q4JCC9_SULAC          SIEIISFLIKGLDQLGK---------RYSITRSR-----DGKVMGIMSGALRVKWLAPDV
Q4JBI8_SULAC          SSQTMEFLKRGLDALGV---------EYREKRSP-----MGFINSLEGEGFRVFFEIPEA
A0A0V8RU50_PYROC      LESFFRGLVEGLGALGV---------GYRVRRR------GGDVVAVTGPWFRVAYYPPGE
A2BKG0_HYPBU          LASFYKGLIRGLRVLGL---------RYRIRRV------GGDVVAVTGPWGRIAYAAPDD
TMCA_AERPE            VQSVMAGLLRGLDVLGLK--------GHRVVRTS-----GGEVIRVSGPWFRIAYEQPDT
A2BLX9_HYPBU          VQSFFRILRLALGKLGTR--------HWEIRRG-------NIVIGIAGPWFHVRYHTPDR
B1L3H0_KORCO          VQTIFNFLMRGLDAQGVNYEPLIRE-------GR-----IIALRFKGKDVFYLTPESA--
B5IHD3_ACIB4          IKEIFRFFEISARVRDL---------------KV-----KRRWKSIVSKNFKIEYVEPVN
Q15W71_PSEA6          VEQVFAFATAPERSTSN----------------K-----NGSLEFVAPDALVSGCYH---
Q31DY3_HYDCU          VQMAFNAIEEQIDALTYNGFECLEK-------RP-----GLVVFEHNNQSYRIEFKAPDD
A6FY33_9DELT          VVELRRFAGP-------------------------------RAPFVPMLELLAEDAPR--
Q3IDD4_PSET1          THSSFKHLAAQLNVNYDP------------LQKQ-----LANMQYIAPDALLNELPE---
A6VTS2_MARMS          IVSLKSRFEQVLD-------------------QD-----KTTLPFFAPDALISNSTHW--
TMCA_IDILO            AKVLLQQAPE--------------------------------AHFVAWDKLLEQPGNS--
D3SEZ5_THISK          VRALFRQLERHPG---------------------------PSVPFCSPDQIEALATAP--
F2G4U5_ALTMD          VKNVFDIQNPSEDTKDNHTKGIEQIQPATLPFKGKEIITNGTVKWVPPDSDLLCNTDK--
                                                                                  

B3GXD0_ACTP7          ---QIAANSWLFIDEAASLPLPMLHQLCEYF--DKVVLTTTTHNYEGTGRGFSLKFPQQL
B0BNX7_ACTPJ          ---QIAANSWLFIDEAASLPLPMLHQLCEYF--DKVVLTTTTHNYEGIGRGFSLKFPQQL
TMCA_ACTP2            ---QIAAKSWLFIDESASLPLPMLHQFCEYF--DKVVLTTTTHNYEGTGRGFSLKFPQQL
TMCA_HAEDU            ---QISADHLLFIDEAACIPLPILQQLGNYF--KKVILTTTTQNYEGTGRGFKLKLVKQL
B0BPP2_ACTPJ          ---TYNAQSWLFIDEAASLPLPLLVRFCEVF--HKVVLTTTTHNYEGTGRGFSLKLLPLL
Q9CM04_PASMU          ---HAFADKWLLIDEAAMLPLSLLELLTSTF--KGILCTTTIQSYEGTGRGFLLKFLANL
TMCA_HAEIN            ---EFSQSAWLLVDEAAMIPLPLLQEYSRYF--QHIVFSTTIHSYEGTGRGFELKFKRKI
A6VQP5_ACTSZ          ---NRFAEDWLVIDEAAMIPLSSLFQLVSTF--KHIVITTTIHSYEGTGRGFLLKFLTNL
Q65RX4_MANSM          ---RQFSQDWLLIDEAAMIPLELLFQLTSTF--KHILCCTTIHSYEGTGRGFLLKFLPNL
TMCA_CITK8            -------ADWLIVDEAAAIPAPLLHRLASRF--SRILLTTTVQGYEGTGRGFLLKFCARF
TMCA_SALTY            -------ADWLVVDEAAAIPTPLLLQLVSRF--PRILLTTTVQGYEGTGRGFLLKFCARF
D2TTA9_CITRI          -------ADWLVVDEAAAIPAPLLHRLVSRF--PRVLLTTTVQGYEGTGRGFLLKFCARF
TMCA_ECOLI            -------ADWLVVDEAAAIPAPLLHQLVSRF--PRTLLTTTVQGYEGTGRGFLLKFCARF
TMCA_SHIF8            -------ADWLVVDEAAAIPAPLLHQLVSRF--PRTLLTTTVQGYEGTGRGFLLKFCARF
B7LKG7_ESCF3          -------ADWLVVDEAAAIPAPLLHQLVSRF--PRTLLTTTVQGYEGTGRGFLLKFCARF
A6TC97_KLEP7          -------AAWLIVDEAAAIPAPLLRQLVSRF--PRTLLTTTVQGYEGTGRGFLLKFCASL
B5XVN1_KLEP3          -------AAWLIVDEAASIPAPLLRQLVSRF--PRTLLTTTVQGYEGTGRGFLLKFCASL
A4WD54_ENT38          -------ADWLVVDEAAAIPGPLLEQLVSRF--SRVLLTTTVQGYEGTGRGFLLKFCARF
A0A0H3CQ14_ENTCC      -------ADWLIVDEAAAIPGPVLEKLVARF--PRVLLTTTVQGYEGTGRGFLLKFCAQF
C9XXK7_CROTZ          ---TLAPCDWLIIDEAAALPGPVLQKLVRAF--PAALLTSTVQGYEGTGRGFLLKFCAGI
A7ML07_CROS8          ---TLAPCDWLVIDEAAALPGPVLQKLVRAF--PATLLTSTVQGYEGTGRGFLLKFCAGI
D2T6T0_ERWP6          ---QAG-IDWLLIDEAAAIPAPQLQQLVALF--PYVLLTTTVQGYEGTGRGFMLKFCATL
D4HY71_ERWAC          ---RAG-IDWLLIDEAAAIPAPQLQQLVALF--PYVLLTTTVQGYEGTGRGFMLKFCATL
B2VE48_ERWT9          ---RAG-IDWLLIDEAAAIPSPLLQQLVALF--PYVLMTTTVQGYEGTGRGFLLKFCAAL
D4GK02_PANAM          ---E---FDWLIVDEAAAIPAPLLHALVARF--PRVLLVTTIQGYEGSGRGFMLKFCAEL
TMCA_PECAS            -LHGAPDVDWLLIDEVAAIPSSVLTALLPYF--PRILMTTTVQGYEGTGRGFLLKFCAAL
C6DBS4_PECCP          -LHGTPDIDWLLIDEAAAIPSSVLSALLPYF--SRILMTTTVQGYEGTGRGFLLKFCATL
C6CQK6_DICC1          -QYGKPPVDWLLIDEAASIPAPILQALLPFF--RRVVMTTTVQGYEGTGRGFLLKFCAAL
C6CC70_DICP7          -QPGSVTAEWLLIDEAAAIPTPQLAALLPFF--RHVVMTTTVLGYEGTGRGFLLKFCASL
TMCA_YERE8            -QHDVSDVDWLLVDEAAAIPTALLSALLAYF--PRALLTTTVQGYEGTGRGFLLKFCATL
TMCA_YERPD            -RHDVSDIDWLLIDEAAAIPTPLLSALLAYF--PRALLTTTVQGYEGTGRGFLLKFCATL
A8GHL3_SERP5          -EHDVSDVGWLLVDEAAAIPGPLLRQWVNHF--PRILLTTTVQGYEGTGRGFLLKFCAGL
TMCA_PHOAA            -QNSVSDIDWLLIDEAAAIPTPQLFELISYF--PRILLTTTVQGYEGTGRGFLHKFCAEI
Q7N3J1_PHOLL          -QNSVSDIDWLLIDEAAAIPMPQLSELIGYF--PRILLTTTVQGYEGTGRGFLLKFCVGL
D3V7B0_XENBS          REGHDIDADWLLIDEAAAIPTPQLAELIRYF--PRVLLTTTVQGYEGTGRGFLLKLCATL
D3VI71_XENNA          NKENQHNVDWLLIDEAAAIPTPQLAELIRYF--PRVLLTSTVQGYEGTGRGFLLKLCAEL
Q2NS79_SODGM          -----MSARWLLVDEAAALPLPLLRQLMGYF--SHVLLTTTVAGYEGTGRGFLLKFCETL
C5B7A5_EDWI9          ----EALPGWLLIDEAAAIPAPLLQRLIVAF--PHVLMTTTVQGYEGTGRGFLLKFCAAL
D0ZEZ3_EDWTE          ----ERLPGWLLIDEAAAIPTPLLQRLIAAF--PHVLMTTTVQGYEGTGRGFLLKFCAAL
B4EY73_PROMH          ----HLCRDWLIIDEAATIPIAQLIALCQHF--PRVLMTTTVQGYEGTGRGFILKLGDSI
TMCA_NITHN            ---SRPA-DLLLVDEAATIPTPLLERLLQGY--SRIAFATTIHGYEGTGRGFALRFHRVL
Q3J7N7_NITOC          ---LQPA-DLLLVDEAAALPTPLLEQLLQRY--PRIAFATTIHGYEGTGRGFALRFHKVL
Q0A9W2_ALKEH          ---SDTP-DLVLVDEAAAIPTPVLAALLRRH--PRMAFATTVHGYEGTGRGFALRFNALL
A1WWU2_HALHL          ---PESG-DLLAVDEAAGLPVDLLAQLLEHA--GRIAFATTVHGYEGSGRGFDLRFRAIL
D3RRX5_ALLVD          ---DEPAADLLLVDEAASIPAPLLTALLERH--GRVVFASTVHGYEGTGRGFEIRFRETL
Q1QTA5_CHRSD          --VDRRAPPTLFVDEAAAIPTPLLARWLEAF--PRLAFATTVHGYEGTGRGFQIRFYARL
A1U6V4_MARHV          ----RPEAEVVLVDEAAGLPAQWLKAVLLGW--PRVVFASTVHGYEGTGRGFALRFRQIL
A0A656HB11_THINJ      ----LPQADVLMVDEAAAIPVTLLLQMLEHY--PRCVFSTTLHGYEGSGRGFILRFQKRL
Q2SKZ4_HAHCH          ----LPTAEMLLVDEAAAIPTPILASLLEHY--PTVVFATTIHGYEGTGQGFPLRVFPLL
A4SIB4_AERS4          ----ALQPDLLLVDEAAAIPTPLLEAMLARH--SRIVFATTEHGYEGTGRGFHLRFKRVL
A0KPS8_AERHH          ----PLQPDLLLVDEAAAIPTPLLEAMLARH--GRIVFATTEHGYEGTGRGFHLRFKRVL
C4LD78_TOLAT          ----DIPADLLLIDEAAAIPAALLRQLQQRY--QRVVYATTIHGYEGSGHGFELRMCRWL
TMCA_VIBCH            -----PESDLLLVDEAAALPLPFLKRWVERY--HRAVFSSTIHGYEGCGRGFSLKFQSWL
A1T0E4_PSYIN          -----PQCDLLIIDEAAAIPVPTLESLVIHY--SRLVFATTLHGYEGSGRGFALRFQKRL
B6EPZ0_ALISL          -----HLVDVVCVDEAAAIPAPMLLSLSEKY--SRMIFSTTINGYEGTGRGFEIKFKQSL
Q6LFR2_PHOPR          -----PDIDFLIVDEAAAIPAPLLSQMLTHY--NRVAFASTIHGYEGTGRGFAIKFRQQL
Q487G0_COLP3          -----IKLNLLLVDEAAAIPVYLLEQLLRSY--HRMVFSSTVHGYEGAGRGFTLKFKKVL
A0A1H9ZCM0_THASX      -----PTVNLLLIDEAAGIPVYLLKKLLSHY--ARVVFASTIHGYEGAGRGFTGKFFGYL
TMCA_HALMA            G------PDVVIVDEAAALPVRRLEQFLDA---PAVTFATTVHGYEGAGRGFSVRFRDRL
D2RVY0_HALTV          GD-GTGPADIVVVDEAAALPVSVLESLLAA---DRVAFATTIHGYEGAGRGFSVRFRDRL
A8MCG8_CALMQ          LMSLQRPIDLVVVDEAAMMPLPILYGIHNRF--TRVIYSTTIHGYEGAGRGFSVRFLKYL
A2BLE0_HYPBU          VPRLKA--DIVIVDEAAGMHIPLLHKIWRSH--RKLVFATTIHGYEGAGRGFSVRFLPAL
TMCA_THEPD            VLKAKG--DLLVVDEAASIPVPLLFKMLKRF--NKVVYSSTIHGYEGAGRGFSLRFLKRL
TMCA_METKA            ASEIEC--DLMVVDEAASIHVPILERILDNN--DKVVYSSTIHGYEGAGRGFSVRFLQNV
TMCA_PYRAB            GYRQKA--DLYIVDEAAGIHVPILHRYLEK---ERVVFSSTIHGYEGAGRGFSVKFLKKA
D2RDE6_ARCPA          AMIEKDYADIVIVDEAAGIDVPVLWKITEGV--RWMIFSTTIHGYEGAGRGFSIRFLKRL
TMCA_SULIY            ARNEEG--DLIVVDEAAAIGMEFLDYILQGW--DKTILVTTVHGYEGSGKAF-LKYVNRL
Q4JCC9_SULAC          AKDYQG--DIIVVDEAASIGTETLDYIVRSW--EKVILVTTIHGYEGTGKAF-LKYLNGL
Q4JBI8_SULAC          TLEHEG--DLLVVDEAAAIGIGYIDSALKTW--KKVVLVTTVHGYEGSGKAF-LRYLNRL
A0A0V8RU50_PYROC      AR----AAGMLVVDEAAAVGAARLRRLSWRS--GRTLTATTVHGYEGSGMVFAHMVGEIL
A2BKG0_HYPBU          AK----PTGLLVVDEAAAVGVARLRRLAWKS--GRVLAATTIHGYEGSGRVFQHMVEDVL
TMCA_AERPE            AE----PSPLVVVDEAAAVGVARVRRLSWRS--GKSLVATTIHGYEGSGRAFARLLPNIL
A2BLX9_HYPBU          AD----PGSFTVVDEAAALGPSRLRSIARRA--PRLLAATTIHGYEGSGRVLAKIAEEIL
B1L3H0_KORCO          ---AEVEVSLKVVDEAASIPVTTLFKFLGG---GFTIFSSTIHGYEGAGRGFSLRFLGRL
B5IHD3_ACIB4          VE--PKKYDLLIVDEAAGIPVPLLLKYLKS---KRVIYSTTTHGYEGTGRSFSIRFMKEV
Q15W71_PSEA6          -------ADLLFVDEAAAIPPPILKTLLDTY--PRVVLSSTVHGYEGAGRGFELRFKPYL
Q31DY3_HYDCU          LIATPHTSDILLIDESAHLPLPMLKQLLQQY--SRTVMATTQQGYEGSGRGFQLKLSHYL
A6FY33_9DELT          -------FDTIVVDEAAQLPVPFLRRLVLRHPEAHLAFATTTHGYEGTGRGFGLRFLSWL
Q3IDD4_PSET1          -------CDVLLVDEAAAIPVPMLLSMLAHY--PRIVFASTLVGYEGNGRGYTIRFSQYI
A6VTS2_MARMS          --------DFLFVDEASMIPLPMLIELNQKA--EHCLFSTTDYGYEGAGKGFGIRFCHYL
TMCA_IDILO            -------EVTLIIDEAAGLPLWATEQLCQKF--NPWLLATTVAGYEGCGRGFAVHFTDWA
D3SEZ5_THISK          --------DTLVIDEAAALPVDRLVRLAGRA--RRLVLSTTTGGFEGSGQGFRLRALPAL
F2G4U5_ALTMD          -----QDYDVVIVDEAASLPLPLVHKIIKHN--KQWILSTTLLGYEGSGSGFIHKLLPNL
                                  :** : :                    :*  .:** *           

B3GXD0_ACTP7          TKP-------YQEWQLSKPLRWYENDPLEQFIDELLIMSPP-TGSNRY------------
B0BNX7_ACTPJ          TKP-------YQEWQLSKPLRWYENDPLEQFIDELLIMSPP-TGANRY------------
TMCA_ACTP2            TKQ-------YREWRLTKPLRWHENDPLEQFIDELLIMSPP-SETNQY------------
TMCA_HAEDU            HRT-------TKEWQLFQPLRWSNHDRLEQFTNELLLLNDELIPLDQN------------
B0BPP2_ACTPJ          NRS-------VKQWQLTQPLRWQENDPLEHFVDRLLLLDDEIHHAHQKN-----------
Q9CM04_PASMU          DRT-------FAHFELHQPLRWQVDDKLEAFMDDLLLLHAEDLPF---------------
TMCA_HAEIN            HRT-------FQHFELKQPLRWQENDPLEHFIDDLLLLNAEDDFQHFDYSNITYNIEENA
A6VQP5_ACTSZ          HRT-------FQHFQLTRPMRWREDDKLEPFIDELLLLECEDNLV---------------
Q65RX4_MANSM          HRS-------FQQFELIRPLRWAENDKLEKFIEELLMLEAEDRLI---------------
TMCA_CITK8            PH--------LRRFELRQPVRWAQGCPLEQWVGEALIFDDETFAH---------------
TMCA_SALTY            PQ--------LHRFTLRQPVRWAPECPLENIVSEALIFDDEAFAQ---------------
D2TTA9_CITRI          PA--------LLRFELQQPVRWAKGCPLEKTVSEALAFDDDNFAT---------------
TMCA_ECOLI            PH--------LHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTH---------------
TMCA_SHIF8            PH--------LHRFELQQPIRWAQGCPLEKMVSEALVFNDENFTH---------------
B7LKG7_ESCF3          PH--------LHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTH---------------
A6TC97_KLEP7          PH--------LQSFTLSAPIRWAAGCPLESAISQLLIFNDEAFRD---------------
B5XVN1_KLEP3          PR--------LQSFSLSAPIRWAAGCPLESAIRQLLIFNDEAFRN---------------
A4WD54_ENT38          AH--------LHYFTLTTPVRWAAGCPLERVVSNALLFDDETLNA---------------
A0A0H3CQ14_ENTCC      SA--------LQRYTLSTPVRWAAGCPLERVVASALLFDDTLIDQ---------------
C9XXK7_CROTZ          DG--------LRYRTLSTPVRWAQDDPLERLVSQALLFDDDDFAR---------------
A7ML07_CROS8          DG--------LRYRTLSTPVRWAQDDPLERLVSQALLFEDDDFAR---------------
D2T6T0_ERWP6          PD--------VTRYQLDLPLRYAANDPLEQFISQALLLEDAVAVP---------------
D4HY71_ERWAC          PD--------VTRYQLDLPLRYAVNDPLEQFISQALLLDDAVSVP---------------
B2VE48_ERWT9          PN--------VTAHQLDLPLRYAAEDPLEQFISRALLFEDAVSAP---------------
D4GK02_PANAM          QQ--------VRYFTLDEPLRWARHDPLEHWLNQALLFEDAAETP---------------
TMCA_PECAS            PQ--------CRVFSLDDPLRWAANDPLERVLDQALLFNEPASLHFPLNPT---------
C6DBS4_PECCP          PQ--------WKAFTLDDPLRWAVNDPLERVLDQALLFNEPEAFY---STP---------
C6CQK6_DICC1          PD--------WHVIELTEPLRWAQQDPLENIVDRLMLFDAEKQVP---------------
C6CC70_DICP7          PA--------WREMSLTEPLRWAVDDPVERVLDRIMMFDAEQSVA---------------
TMCA_YERE8            SD--------WHHITLTEPIRWASHDPLEQIIDDIMLFDDDRINDKLSPT----------
TMCA_YERPD            GD--------WHHLTLTDPIRWATDDPLERVMDNAMLFHDELLGNHPLPK----------
A8GHL3_SERP5          PE--------FQPLELQQPMRWAPGDALERVIDNALLF------NELPPW----------
TMCA_PHOAA            PG--------CHILNLTEPMRWAESDPLENWLEEALLFDDAVPANHS-------------
Q7N3J1_PHOLL          PD--------RHVLNLTAPVRWAENDPLENWLESALLFEDAIPVNNS-------------
D3V7B0_XENBS          PD--------CHVRELETPMRWAENDPLETWLDSTLLFDEKS-LSGK-------------
D3VI71_XENNA          PE--------CQIRELKIPMRWAENDPLETWLDSALLFDDKKRLDDKFQIDG--------
Q2NS79_SODGM          PC--------WCPLRLDAPLRWAANDPLERWLTETLMLEDAEVVAPAGKGAPQN------
C5B7A5_EDWI9          PD--------CRIHSLDRPLRWASGDPLEAWLNAALLFSDTCGAV---------------
D0ZEZ3_EDWTE          PD--------CRIHSLDRPLRWASDDPLEAWLNAALLFSDTCGAA---------------
B4EY73_PROMH          PK--------LQNYQLTVPIRWAQDDPLENWLNQLLLLDEPSFHH---------------
TMCA_NITHN            DEK---T-RGWKGLRLETPIRWRSGDPLEHFVFRALLLDATAAP---DSAVASARPETVA
Q3J7N7_NITOC          DER---T-RGWKALRLETPIRWRSGDPLEHFAFQALLLNAKAAP---ASAVALARPENTL
Q0A9W2_ALKEH          DRE---T-RGWQAVRLQTPVRWSPGDPVEALVFRLLLLDAEPGE---VPPTASGAPR---
A1WWU2_HALHL          DAE---T-PGWQAVRLEAPIRWDRNDPLEAWLGRVLCLDAEPAT---LEDGGGSAAE---
D3RRX5_ALLVD          ERL---T-PDWRAITLDTPIRWAADDPLERLVFRALLLDAAPAARQDIQESASADPAGPN
Q1QTA5_CHRSD          SRD---T-PDWREVRLAAPVRWAEGDPLERLTRDMLLLDAAPAD--DAEVTAALAASPVH
A1U6V4_MARHV          EQE---T-PNWRAVSVREPIRWAQGDPLERLVFQLYLLSADAPE--------PQPFVAGD
A0A656HB11_THINJ      DVI---A-PGWQSIRLYQPIRWAENDPLEHFINHALLLDVDLEEGGHRGPPLRAPVGADP
Q2SKZ4_HAHCH          DKR---R-PGWRHMTMSQPMRWSQGDPLEAFINDALLLN------QYQPAPLPTTWNENE
A4SIB4_AERS4          DRQ---T-PDWQEIHLAEPIRWSTRDPLEPLVFRLLGLNTEVDAPQPPTNP---------
A0KPS8_AERHH          DRE---T-PGWQEIHLAEPIRWSSRDPLEPLVFRLLGLNAEVETPPAPTQP---------
C4LD78_TOLAT          ASQ---W-PQWQQVTLTAPLRWAASDPLEPLLARILLLDADACEPPAPTSAL--------
TMCA_VIBCH            QVQ---R-PQMRSLHLEQPIRWAAGDALEQWQNQVFLLQSELPEVALEQ-----------
A1T0E4_PSYIN          TEL---A-PQWRKLHLDQPIRWAKNDPLEAFTLSSICLTEAVAQQPVYK-----------
B6EPZ0_ALISL          AKI---R-PNYRTLEMIKPIRWNDNDPLELWLSHVFLLNHATSVDIESESFSI-------
Q6LFR2_PHOPR          DLQ---T-PQWRQLSITQPIRWAINDPLESWVFSALLLDTDVMPRHRLS--TK-------
Q487G0_COLP3          DRL---C-PQWVNLHINQPIRWRENDPLEQLVFDACLLNAELPKLKTTLAPQPPTYGKGS
A0A1H9ZCM0_THASX      REQ---Y-SGWQHYSMHTPIRWRHEDALEQFIYRAFLLDADIKTVGYDTELPA-------
TMCA_HALMA            AES---D-LAVTDVSMTTPIRYSDADPVEVWAFRALLLDARPPVDQLIEDA---------
D2RVY0_HALTV          AES---D-HEVVDRTLVEPIRYAAGDPVEVWAFRALLLDARPPVEPLVADA---------
A8MCG8_CALMQ          RGR---RGIRVLEYEMTEPIRYARDDPIERWLFKTFLLDAEPAHIDEDDLKLVN------
A2BLE0_HYPBU          KND---PNTELIEVEMHEPIRYAEDDPIERWLFDALLLDAEPAELDEEDLKAIE------
TMCA_THEPD            KNE---EGVKLYEYEMSEPIRYAPEDPIEKWTFDLLLLDAEPCEITEDDLSLVS------
TMCA_METKA            RKR---RDVRLIEFKMHEPIRYDSDDPIERWLFDTLLLDAEPADLDKEDLECVK------
TMCA_PYRAB            KEK---R--EYKEIHLSVPIRYAEGDPIERWLFDVLLLDAEPVELTEEDYELIR------
D2RDE6_ARCPA          ESC---EDVEIEKIHLNEPIRYGKGDPIEKWLYDVLLLDAQPAEITEEDIQAIK------
TMCA_SULIY            KS-----KVLLKHIKMDYPIRYAKGDPIEKFMFDVFLLDAEPAEVMY-------------
Q4JCC9_SULAC          RED---KSIKFKHVTLEKPIRYAKGDPIERFIYDVMLLDAEPKKE---------------
Q4JBI8_SULAC          LKQ---RKTTVYWEEMRKPLRYAEGDPIEKWLYDSLLLDAEPEDVQQE------------
A0A0V8RU50_PYROC      PR-------PLVRVELAEPVRYPPGDPLEEWVYETFLLRAEPGEPPPPER----------
A2BKG0_HYPBU          PK-------PLERVELREPIRYPPGDPLEDWVNRVFVLKPEP-DYPAPAS----------
TMCA_AERPE            PK-------PFIELELREPIRYLPGDPLEEWLYTVFMLRAEPQEPGDPS-----------
A2BLX9_HYPBU          PE-------PRLVVELRTPVRYPPGDPLEGWLYDTFMLRVSEPEPPSLDG----------
B1L3H0_KORCO          RKS---G-IPHAEERMDEPIRYPPDDPVERWLYDFLLLDAEPGEPPK-------------
B5IHD3_ACIB4          RRR---V-KNLILIEMNEPIRYSKDDPVERWLFDTLLLDSEPPKLEKVEI----------
Q15W71_PSEA6          ETA---H-KGWKSLTLSTPIRWYVNDCLEHFWFTVFIMQDSNSSSHAQPQSKVTGQNKIP
Q31DY3_HYDCU          NQH---Y-PGWKHLKLKTPIRWHAQDPLEKSLNQLLLLEDELPTVTTRQPP---------
A6FY33_9DELT          EGR---G--PVARFELNAPIRWAAGDPVERAVFEALLLDAEPARLEAAPE----------
Q3IDD4_PSET1          KNH---Y-KASKVITLDEPLRFAKHDPLEQHIRSLLALDAQYQETNSNK-----------
A6VTS2_MARMS          ESQKTCKALALQQLTLSLPIRWGGNDPLENWINDCFFLTKPEPDFDTPNNTNKS------
TMCA_IDILO            RKT----LPQVSVHQLTQPLRWPANDPLEQWLTETFLLNEQPVTQFG-------------
D3SEZ5_THISK          QRM----GFRIRQIGLEQPVRWESGDPLEAWLDDLFLMRARSRAPA--------------
F2G4U5_ALTMD          PPS-------AIHLTLTAPLRWYQHDPLETFLNETCLFESDSSALIDDKHI---------
                                     :  *:*:     :*                               

B3GXD0_ACTP7          ----------------------------------------------------AEFYHLLA
B0BNX7_ACTPJ          ----------------------------------------------------AEFYHLLA
TMCA_ACTP2            ----------------------------------------------------AEFYHLLA
TMCA_HAEDU            ----------------------------------------------------SQFYHLLA
B0BPP2_ACTPJ          -------------------------------------------------ITKTDFYRLLA
Q9CM04_PASMU          -----------------------APLASAEGVQFQRYSQHTLYQQ----QKIAPLYGLLT
TMCA_HAEIN            KNLSFPCLRGKVPEGPKGDLDIASLPQALEALLTSKGSEGKYNRQ----FFFRDFYGLMT
A6VQP5_ACTSZ          -----------------------QPDFSMQSAVKIRQVF-QPEIV----DRIRDFYGLLT
Q65RX4_MANSM          -----------------------QPPYSIKSAVKIRQIS-QNELV----EHITDFYGLLT
TMCA_CITK8            -------------------------APQGAIRFSAFTQALWHTGP----AQPLAVYQLLS
TMCA_SALTY            -------------------------APHGAIEISAFYQQAWVNTP----ALPRAVYQLLS
D2TTA9_CITRI          -------------------------TPQGEVTIAPFTPLSWQTHP----ELPLAVYRLLS
TMCA_ECOLI            -------------------------TPQGNIVISAFEQTLWQSDP----ETPLKVYQLLS
TMCA_SHIF8            -------------------------TPQGNIVISAFEQTLWRSEP----ETPLKVYQLLS
B7LKG7_ESCF3          -------------------------TPQGNIVISAFEQTLWRSES----ETPLKVYQLLS
A6TC97_KLEP7          -------------------------APMGEIALEAVNQSCWQTQP----ALPEAMYQLLS
B5XVN1_KLEP3          -------------------------APTGEVVLEAVNQSCWQSQP----ALPEAMYQLLS
A4WD54_ENT38          -------------------------IPDDVAQVTALGQLLWESHP----DLAADIYKLLC
A0A0H3CQ14_ENTCC      -------------------------QPKGEVQLTSLAPDAWEHTP----ALAASVYELLC
C9XXK7_CROTZ          -------------------------TPAGEVRFYPVHQRDWQTMP----DRAAALYRLLA
A7ML07_CROS8          -------------------------TPAGEVRFYSVSQNDWQTRP----DRAAALYRLLA
D2T6T0_ERWP6          -------------------------HSD-AVVIRSFKQRDWARHP----AFMTAIYQLLT
D4HY71_ERWAC          -------------------------QSD-TVVIQSLEQADWARRP----ASMAAIYQLLT
B2VE48_ERWT9          -------------------------RPD-AVDIRSLEQGDWARRP----DRMAAVYRLLT
D4GK02_PANAM          -------------------------SLE-ERAPRRAEASDFAAQ--------QAAYQLLT
TMCA_PECAS            --------------------DGALTLPSAKLDIRTECADDWLTHP----ERLTWCYALLC
C6DBS4_PECCP          --------------------QAALPISPSTLESRTERTDDWLTYP----ERLAWCYALLC
C6CQK6_DICC1          ------------------------EQLHGSLTIQPERRDDWSDLP----ARLEGCYGLLC
C6CC70_DICP7          ------------------------ARVDAPFVDSDESRDRWQSEP----TRLAECYGLLC
TMCA_YERE8            ------------------------GSATASIGITVCEQSNWLSNS----ELLRHFYGLLS
TMCA_YERPD            ------------------------RPPVAQIEIPLYEQRDWRDNP----ELLRRFYGLLS
A8GHL3_SERP5          ------------------------QATDRPVSITGAEQRALCADP----QRLVRFYALLS
TMCA_PHOAA            ---------------------------AKAIGYHVYQQQQWIQQP----ELLKQFYGILT
Q7N3J1_PHOLL          ---------------------------DQAISYQVYHQQQWIKQP----ELLRQFYGILT
D3V7B0_XENBS          --------------------PLVYSEPEKNLHFYPITQAMWLRQP----ELLRQFYGLLT
D3VI71_XENNA          --------------------QLTYINLAKALSFYPIKQSMWLEQP----ALLGQFYGLLT
Q2NS79_SODGM          --------------------TDAGAAGAGRWRIGKVGAQTWRRQP----AARQAFYQLLT
C5B7A5_EDWI9          ---------------------------APVSALRWLDQRQWQTAP----VLMAAFYALLT
D0ZEZ3_EDWTE          ---------------------------APVSALRWLAQRQWQTDP----ALMADFYALLT
B4EY73_PROMH          ----------------------------ANQSGEVVITSCQHFDS----EQRANFYQLLT
TMCA_NITHN            --------------------------------VERLDRDALVRDE----ATLSELFGLLV
Q3J7N7_NITOC          --------------------------------VEQLDREVLVKDE----ATLSELFGLLV
Q0A9W2_ALKEH          --------------------------------WEWLVRDRLAADE----PLLTQVFGLLV
A1WWU2_HALHL          --------------------------------IVPVTQDALAQEE----RRLRQAFGLLV
D3RRX5_ALLVD          --------------------------------AHWLDRDALLRDE----PTLRELFGLLV
Q1QTA5_CHRSD          --------------------------------IRWLDRAALAEDE----SMLAALFGLLV
A1U6V4_MARHV          --------------------------------VRIERWQPAATSE----QTLAEAFGLLV
A0A656HB11_THINJ      C-------------------------VCPVCQYRLLNRHDLAQNE----PLLRQLFGLLV
Q2SKZ4_HAHCH          ------------------------------LRFERLDGESLLCSP----QRLSEIFQLLT
A4SIB4_AERS4          -------------------------------SWRLIGQGTLAADE----ALLNQVFGLLV
A0KPS8_AERHH          -------------------------------GWRRLEQDALAADE----GLLHRVFGLLV
C4LD78_TOLAT          -------------------------------KAEQITSAQLLQDE----DLLRQLFGLLI
TMCA_VIBCH            --------------------------AREPLSFSLFSQPECVEQP----ERLAQVFALLV
A1T0E4_PSYIN          --------------------------AQQALSFEKLTPAELLADK----TLLQALFSLLV
B6EPZ0_ALISL          --------------------------SSRDIYFRRVNTDELLSSA----SLSQSLFSLLV
Q6LFR2_PHOPR          --------------------------ASSEITYRTVPTEELIADE----ALLSSLFGLLI
Q487G0_COLP3          SV-----------------EKAEVLNKSNEPVFKVISAKELVADE----ALLKQVFAILV
A0A1H9ZCM0_THASX      -------------------------------ELHCLSVETLVRKE----DILKQVFSMLV
TMCA_HALMA            --------------------------TPETVEYRQLSAADLLADT----HLLREVFGLLV
D2RVY0_HALTV          --------------------------RPETVAYHSLEPDDLLADD----RLLREAFGLLV
A8MCG8_CALMQ          ---------------------------EGKVKYIAPSIEEFFFKD---EEALRQFFGIYV
A2BLE0_HYPBU          ---------------------------AKQFEYVKFEPRELFSPE--GEKTLRQLFGIYV
TMCA_THEPD            ---------------------------AGEVYYDAPNEEELFLKN---EEELRQFFGIYI
TMCA_METKA            ---------------------------EMRVEFEKPDLRYWFEDPEG-EEELRQFIGIYV
TMCA_PYRAB            ---------------------------KMEVYLEEPDLDDWFEN--D-REDLRHFVGIYV
D2RDE6_ARCPA          ---------------------------DGKLEFEEIDKDKLVENE----KLLREFFGIYV
TMCA_SULIY            ---------------------------NGELKIEDVSQEELFQDN----NLLKSVYGILV
Q4JCC9_SULAC          ---------------------------NENLEFTEIDRKELFEKD----HLLRQVYGILV
Q4JBI8_SULAC          ---------------------------IDKVYFETLDKEELFSDD----RKLRQVYGILV
A0A0V8RU50_PYROC      ---------------------------LGGVAYERLDAGRLSRDP----GLLRKAYGLLA
A2BKG0_HYPBU          ---------------------------VDECRVEQLEPRSLAEQP----EAVRRLVQLLA
TMCA_AERPE            -----------------------------AARPVEVSREVLARDR----EVLRSVYGILV
A2BLX9_HYPBU          ---------------------------V-ELRPAKLDRKELVEKQ----QLLRAVYSILV
B1L3H0_KORCO          ---------------------------NLEATYREISLDSISEEY------LRKFYGIYI
B5IHD3_ACIB4          ----------------------------EKLEYKKYEIEELLSDE----NKLREYYGIFV
Q15W71_PSEA6          EN------------------RETSPMRLNEFKCQEVSKKRLVDSP----ELLSKIFSLLI
Q31DY3_HYDCU          --------------------------SIEDCHIERCSVLELLHSP-EGKARLKQIFQLLT
A6FY33_9DELT          ---------------------------LARLRFEAVDRDALAADR----PRLRELFGLLV
Q3IDD4_PSET1          ---------------------------SQIPKHSEVTQQQLVTDE----ALLCQVVALLA
A6VTS2_MARMS          --------------------------ITKATSFSHLTGADWLENT----NLLADTFQLLV
TMCA_IDILO            ----------------------------NRESGTFIKHASELEEA-----LLQQCFQLLL
D3SEZ5_THISK          ---------------------------RQAVIFHWLCGKGLVCDT----RRLEDVAGLLA
F2G4U5_ALTMD          --------------------------EKSAADIIEHSAFNLSTFENVSEQTLQQIMSLLA
                                                                               :  

B3GXD0_ACTP7          EAHYKTTPSDLRRLFDAQDQLLHS-FSEHQ-------------RLVGGIWAVPEGDLE--
B0BNX7_ACTPJ          EAHYKTTPSDLRRLFDAQDQLLHS-FSEHQ-------------RLVGGIWAVPEGGLE--
TMCA_ACTP2            EAHYKTTPSDLRRLFDAQDQLLHS-FSEHQ-------------RLVGGIWAVPEGDLE--
TMCA_HAEDU            NAHYKTTATDLRRLFDADQQLFHQCYDKNQ-------------RLMAGIWAVKEGELS--
B0BPP2_ACTPJ          AAHYKTTPTDLRRLFDGENQILFP-YSENG-------------QLIGGIWAINEGGLD--
Q9CM04_PASMU          RAHYRTSPLDLRRLFDAPNQHFYL-AQKDE-------------HLLGAAWLVQEGSLQ--
TMCA_HAEIN            IAHYRTSPLDLRRLLDGKNQRFYF-AEYQQ-------------NLLGAIWALEEGNMA--
A6VQP5_ACTSZ          LAHYRTSPSDLRRLFDAPKQQFWL-AETDS-------------ALLGGVWLVEEG-LR--
Q65RX4_MANSM          LAHYRTSPLDLRRLFDAVKQHFLI-AEWEC-------------YLLAGVWALEEGGFS--
TMCA_CITK8            GAHYRTSPLDLRRMMDAPGQHFLGAFT--------------AERVAGAAWLVEEGRLS--
TMCA_SALTY            GAHYRTSPLDLRRMMDAPGQHFLQATA--------------NNRVAGALWLVEEGGLS--
D2TTA9_CITRI          GAHYRTSPLDLRRMMDAPGQHFFHAAC--------------AGEVAGALWLVEEGGLS--
TMCA_ECOLI            GAHYRTSPLDLRRMMDAPGQHFLQAAG--------------ENEIAGALWLVDEGGLS--
TMCA_SHIF8            GAHYRTLPLDLRRMMDAPGQHFLQAAG--------------ENEIAGALWLVDEGGLS--
B7LKG7_ESCF3          GAHYRTSPLDLRRMMDAPGQHFFQAAC--------------ENESAGALWLVDEGGLS--
A6TC97_KLEP7          GAHYRTSPLDLRRMMDAPGQAFRCART--------------GGAVAGALWLVAEGGLS--
B5XVN1_KLEP3          GAHYRTSPLDLRRMMDAPGQAFRCARA--------------SCAVAGALWLVAEGGLS--
A4WD54_ENT38          SAHYRTSPLDLRRMMDAPGQHFAIARA--------------AEKLIGALWLVDEGGLS--
A0A0H3CQ14_ENTCC      AAHYRTSPLDLRRMMDAPGQHVAVAQT--------------DPVIAGALWLVDEGGLS--
C9XXK7_CROTZ          GAHYRTSPLDLRRMMDAPNQSFIAAEA--------------GGVTVGALWLVAEGGLE--
A7ML07_CROS8          GAHYRTSPLDLRRMMDAPGQSFIAAEA--------------GGETVGALWLVAEGGLD--
D2T6T0_ERWP6          SAHYRTSPLDLRRMMDVPGMHFSAALQ--------------GDNVQGALWLVDEGGLS--
D4HY71_ERWAC          SAHYRTSPLDLRRMMDAPGMHFSAALQ--------------GDNVQGALWLVDEGGLS--
B2VE48_ERWT9          SAHYRTSPLDLRRMMDAPGMHFSAALQ--------------GDDIQGALWLVDEGGLS--
D4GK02_PANAM          SAHYRTSPLDLRRLLDAPGMHLWLAGE--------------VPALQGALWLVEEGGLT--
TMCA_PECAS            SAHYRTSPLDLRRLMDAPGMHIASAQV--------------AGDIRGVLWLVEEGGLS--
C6DBS4_PECCP          SAHYRTSPLDLRRLMDAPGMQVASVQV--------------AGNLCGVLWLVEEGGLS--
C6CQK6_DICC1          SAHYRTSPLDLRRLMDAPGIHVASAGV--------------GTKIGGVIWLVDEGGLP--
C6CC70_DICP7          SAHYRTSPLDLRRLLDAPGMHITSVRG--------------RQGIVGVVWLVDEGGLS--
TMCA_YERE8            SAHYRTTPLDLRRLMDAPGMHFSAAKV--------------ADSVVGALWLVDEGGLA--
TMCA_YERPD            TAHYRTTPLDLRRLMDAPGMHFSAARV--------------ADAVIGALWLVDEGGLS--
A8GHL3_SERP5          SAHYRTSPLDLRRLMDAPGMHFGLAQV--------------EDEVVGALWLVEEGGLS--
TMCA_PHOAA            SAHYKTSPLDLRRLLDAKGMQFVAALG--------------NNTLIGALWMVEEGGLS--
Q7N3J1_PHOLL          SAHYKTSPLDLRRLLDAKGMQFVAALG--------------NNALMGALWMVEEGGLT--
D3V7B0_XENBS          SAHYRTSPLDLRRLLDGNGMTFLAATSRSAVN---------NQQLIGALWMVSEGGLP--
D3VI71_XENNA          SAHYRTSPLDLRRLLDGNEMEFLAAISCFPAD---------KPQLVGALWMVNEGGLS--
Q2NS79_SODGM          RAHYRTSPIDLRRLLDAPGMSFFTAHH--------------HRQLMAGLWLVEEGGLT--
C5B7A5_EDWI9          SAHYRTSPLDLRRLMDAPGQRLCAALG--------------EARVQGALWLVEEGGLS--
D0ZEZ3_EDWTE          SAHYRTSPLDLRRLMDAPGQRLCTALG--------------EARVQGALWLVDEGGLS--
B4EY73_PROMH          SAHYRTTPLDLRRLFDGQKQHYWSAFI--------------HRHLVGAVWCIEEGGLA--
TMCA_NITHN            LAHYQTRPYDLRHLLDGPNLSVYVMRYRG--------------HVVATALLAAEGGF---
Q3J7N7_NITOC          LAHYQTRPYDLRHLLDGPNLLVYVMRYRG--------------HVVATALLALEGGF---
Q0A9W2_ALKEH          QAHYRTRPLDLRHLLDGPNVRVGALWLDG--------------RLVGTLMVAEEGGF---
A1WWU2_HALHL          AAHYRTRPFDLHQLLDGPRRHLFLAEEAG--------------AVVGVVVAAEEGGL---
D3RRX5_ALLVD          LAHYQTRPLDLRMLLDGPNVRVLVLRQAG--------------HLIGTLLVAEEGGMG--
Q1QTA5_CHRSD          QAHYRTTPGDLRQLLDGPDVRLAVAYAGT--------------TCLGVCQVQSEGGF---
A1U6V4_MARHV          NAHYRTTPADLRQWLDDPAAMTWRASVEG--------------RTIGLLWASTEGGL---
A0A656HB11_THINJ      TAHYQTRPSDLRQMLDAPGISIHILELAG--------------EIVAVALLSREGG-L--
Q2SKZ4_HAHCH          LAHYRTTPDDLRTLLDSPGLDVFASTVQG--------------RVLGAVLLSHERPFT--
A4SIB4_AERS4          LAHYQTTPSDLRSLLESPDLDIHLLEQAQ--------------SLLGVALVAREGN-I--
A0KPS8_AERHH          LAHYQTTPSDLRYLLESPTLDIHLLEQGP--------------HLLGVALVAREGE-I--
C4LD78_TOLAT          LAHYQTSPTDLRLLLDCPDIEIWLWRDEV--------------AIYGVALLMREGP-I--
TMCA_VIBCH            NAHYQTSPNDLFALLQDEAMTLFVAYQ--------------GEVCVGCVLAVREGELD--
A1T0E4_PSYIN          LAHYQTKPSDLEKLLNDSSVHIFIARQ--------------QGQILGVALIKEEGNFD--
B6EPZ0_ALISL          SAHYQTSPNDWISLLTDTSLECWVGIDKKTK------------ALIACTLISIEGNLD--
Q6LFR2_PHOPR          NAHYQTSPNDISQLLDDANIQLLVAELKNDEDDSEQ-----AASIVGCCLVSLEGGFD--
Q487G0_COLP3          TAHYQTKPSDLQLLLDNPQVQLTCLYSSKNN----------DAEMLAVALLMNEGKGNNV
A0A1H9ZCM0_THASX      IAHYQTSPSDLQLLLDNPQAKLFVYRQGE--------------QILAVAFVLIEGSNN--
TMCA_HALMA            LAHYRTEPSDLARLLDAPNLTVRALTH--------------EGHVVAVALLAQEGGLS--
D2RVY0_HALTV          LAHYRTEPNDLARLLDAPNLEARALVHRPDGADGEPGDGRGDGHVVSVALLAREGNLP--
A8MCG8_CALMQ          QAHYRNEPDDLGMMMDAPHHIVRALTLE-------------NGKIVVSMELAEEGGLD--
A2BLE0_HYPBU          LAHYRNEPDDLAILADAPHHIIRGVRLP-------------SGKIVCALQIAQEGGLD--
TMCA_THEPD            MAHYRNNPNDLGIMMDAPHHFLRMVRLK-------------NGKIVVSLELASEGNLG--
TMCA_METKA            MAHYRNRPSDVMVLADAPHHEAYALKTE-------------TGKIVTALQVAREGTIP--
TMCA_PYRAB            LAHYRNRPSDVALLADAPHHEARVLRLK-------------NGKIVTAIQIAKEGGIP--
D2RDE6_ARCPA          LAHYRNRPSDLVILLDMPNHKPFAVKV--------------NGKVVCSLHIAIEGKMD--
TMCA_SULIY            TAHYRNSPDDLMLLGDMAFQKIVVGY--S------------SEKPIAVCQVVSEGDLT--
Q4JCC9_SULAC          SAHYRNSPDDLMILGDHHFQRIF------------------SLGKIAVAQVIEEGALE--
Q4JBI8_SULAC          TAHYRNNPNDLMIMGDGIHHTIKGLSIEG------------TNSYIGVVQIANEGGLS--
A0A0V8RU50_PYROC      LAHYRTEPDYLLVLLEPGGHTLHMLRAG--------------GSLVAVADTATEEPGA--
A2BKG0_HYPBU          LAHYRTEPDYLLVILESRNHILHALVCG--------------GSLAAAADVALEEWGL--
TMCA_AERPE            QAHYRNTPDDLLAMLESPHHRIYALEAD--------------GTPVAVADVVLEGPDV--
A2BLX9_HYPBU          SAHYRNEPDDLALLLDAPHHRVYVLLAG--------------NTPVAVAHAALEGPEL--
B1L3H0_KORCO          LAHYRNRPNDLATLLDAPHHFARSLEAEG--------------EPIVSIHLAEEGGLP--
B5IHD3_ACIB4          LAHYRNNPNDFGILCDAPNHEIRTLEYNG--------------HVVCSVQLAREGGIE--
Q15W71_PSEA6          SAHYQTSPDDLFRLLDAPEQRVYVCTLNE--------------DVIGVALICLEGGSA--
Q31DY3_HYDCU          QAHYQTRPNDLMQILEVPNQQLWVAQVSG--------------QIIGVLLSVEEGQLP--
A6FY33_9DELT          HAHYRTTPGDLERLLDAPNLELHAGLLDG--------------HVVAATLVAREGSLP--
Q3IDD4_PSET1          LAHYQSSVNDLRQLLDAPSQRIFISKIDK--------------QLVGVCLIAIEGGLS--
A6VTS2_MARMS          SAHYQTSPDNLRWVLDDPSVSTYLYLSEG--------------DAQSVAIITKEGNLP--
TMCA_IDILO            SAHYQSSPNDLNLLLTEPGHKLAYQSTNG--------------EVTAVAWLMSEGPIL--
D3SEZ5_THISK          DAHYRTRPSDLARWLDDPDAYLMLLLGAQD------------RALFGVALVQKESGLA--
F2G4U5_ALTMD          LAHYQTTPDDFMRLMDSPDVLIASLSLDN--------------IIIAASIINIEGGSR--
                       ***:.                                               *      

B3GXD0_ACTP7          PE-LAEAIWRGERRPQGNLVAQYLCFQGNLLEACQLRSVRISRIAVQPELQKQGIGKRLI
B0BNX7_ACTPJ          PE-LAEAIWRGERRPQGNLVAQYLCFQGNLLEACQLRSVRISRIAVQPELQKQGIGKRLI
TMCA_ACTP2            PE-LAEAIWRGERRPQGNLVAQYLCFQGNLLEACQLRSVRISRIAVQPELQKQGIGKRLI
TMCA_HAEDU            QD-LAEAIWAGKRRPAGNLVAQYLCCQGNLIEACQLKSIRISRIAVQPDLQNQGIGSQLV
B0BPP2_ACTPJ          NE-LSQAIWRGERRPQGNLVAQYLCYQGNLPEAPQLYSIRISRIAVEPHFQNQGIGKRLI
Q9CM04_PASMU          SEQLIGEIERGLRRPRGNLVPQLLCFQAHLPQACRLSSLRISRIAVQPNWQQQGIGQQLV
TMCA_HAEIN            DDELIIQIQQGKRRPKGNLVPQALCFHENLSQACKLRSLRISRIAVQPNWQQKGIGQNLM
A6VQP5_ACTSZ          DETLIRDVCAGLRRPKGNLAVQKLAHHQNVPEFLTLKSLRISRIAVQPDWQRHGLGRQLV
Q65RX4_MANSM          DKALIRAICRGERRPKGNLVAQSLAFNCNLPEACALKSLRISRIAVQPDWQGRGLGLQLV
TMCA_CITK8            AA-LSQAVWAGYRRPRGNLVAQSLAAHGGDPLAATLTGRRVSRIAVHPARQREGIGQQLI
TMCA_SALTY            AE-LSQAVWCGFRRPRGNLVAQSLAAHGSDPLAATLVGRRVSRIAVHPARQREGIGQQLI
D2TTA9_CITRI          AG-LSQAVWAGFRRPRGNLVAQSLAAHGGDPLAATLTGRRISRIAVHPGRQREGIGQRLI
TMCA_ECOLI            QQ-LSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLI
TMCA_SHIF8            QE-LSQAVWAGFRRPRGNLVAQSLAAHGSNPLAATLRGRRVSRIAVHPARQREGTGRQLI
B7LKG7_ESCF3          QE-LSQAVWAGFRRPRGNLVAQSLAAHGSNPLAATLRGRRVSRIAVHPARQREGVGQQLI
A6TC97_KLEP7          PE-LSRAVWAGFRRPRGNLVAQSLAAHGGSPLAATLRGLRVSRIAVHPTRQREGLGRKMI
B5XVN1_KLEP3          PE-LSRAVWAGFRRPRGNLVAQSLAAHGGSPLAATLSGLRVSRIAVHPARQREGLGQKMI
A4WD54_ENT38          TA-LSQAVWAGYRRPRGNLVAQSLAAHGGSPLAATLIGRRITRVAVHPRRQREGIGQALI
A0A0H3CQ14_ENTCC      PA-LSRAVWAGFRRPRGNLVAQSLAAHGGTPLAATLKGRRITRIAVHPHRQREGIGRALI
C9XXK7_CROTZ          AA-LSQAVWAGYRRPRGNLVAQSLAAHGGDPLAATLRGLRISRVAVHPGRQREGVGRQLI
A7ML07_CROS8          AA-LSQAVWAGYRRPRGNLVAQSLAAHGGDPLAATLRGLRISRVAVHPGRQREGIGRQLI
D2T6T0_ERWP6          AE-LAAAVWAGDRRPRGNLVAQSLAAHGGLTEAAQLRSRRISRIALAPALRGRGIGQQLI
D4HY71_ERWAC          AE-LAAAVWAGYRRPRGNLVAQSLAAHAGLAEAAQLRSRRISRIALAPALRGRGIGQQLI
B2VE48_ERWT9          AE-LATAVWAGYRRPRGNLVAQSLAAHAGQPEAPQLRSRRISRIALAPTLRGRGIGQQLI
D4GK02_PANAM          DE-LAQAVWAGHRRPRGNLVAQSLAAHAGLKEAATLRALRISRIAIAAPARRRGIGQQLV
TMCA_PECAS            DS-LAHDVWAGRRRPRGNLVAQSLAAHAGLWNAPTLRARRVSRIAVASSSRRQGIGRALI
C6DBS4_PECCP          DS-LAHEVWAGRRRPRGNLVAQSLAAHAGLWHAPTLRARRVSRIAVASAYRRQGIGRALI
C6CQK6_DICC1          AS-LAQDVWAGRRRPRGSLVAQSLAAHGNQWQAPVLRSRRISRIAVLAAHRGEGIGLALV
C6CC70_DICP7          EA-LAREVWAGRRRPRGNLVAQSLAAHGNQWRAPVLRSRRITRIAVLAAHRCQGIGQALV
TMCA_YERE8            SA-LAHAVWAGQRRPKGSLVAQSLAAHSGQWQAPILLSRRISRVAVAPLWRQQGIARQMI
TMCA_YERPD            EA-LALDVWAGRRRPRGNLVAQSLAAHSGQWQAPTLLSRRISRVAVTAAWRQQGIARRMI
A8GHL3_SERP5          AE-LAHEVWAGRRRPRGNLVAQSLAAHGGQWWAPTLRSRRITRIAVLPAMRQQGIARRLI
TMCA_PHOAA            AE-LAHEIWAGRRRPRGNLVAQSLAAHSGLPQAAVLKSQRISRVAVQVNRRRQGIAQGMI
Q7N3J1_PHOLL          LE-LAHEIWAGRRRPRGNLVVQSLAAHSGLPQAAVLKSQRISRVAVQANHRRHGIAQGMI
D3V7B0_XENBS          QT-LAHEVWAGRRRPRGNLVAQSLAAHSGFPQAAMMRSQRVSRIAVRAQYRRRGIAQRLV
D3VI71_XENNA          PE-LAHEIWASRRRPRGNLVAQSLAAHAGFPLAATLKSQRVSRIAVQAQYRRRGIAQHLI
Q2NS79_SODGM          SR-LAHDVWAGYRRPPGSLVAQSLAAHGSAWRAPRLRSRRISRIAVTPTERRRGIGLELI
C5B7A5_EDWI9          AA-LAQAVWAGERRPRGSLVAQSLAAHGGEPCAPRLRSWRVSRIAVMPALRRRGVASALI
D0ZEZ3_EDWTE          AA-LAQAVWAGERRPRGSLVAQSLAAHGGEPCAPQLRSWRVSRIAVMPTLRRRGVASALI
B4EY73_PROMH          KA-LAQDVWRGIRRPKGNLVAQSLVTYGLSIEAMCLTSLRISRIAVLPAYRRQKVAAKLV
TMCA_NITHN            VEETARGIWEGRTRPHGHLLPESLAAHLGLAQAPRLHCARIMRIAVHPAVQGQGLGTHLV
Q3J7N7_NITOC          DEETARGIWEGCIRPHGHLLPESLAAHLGLAQAPRLRCARIMRIAVHPTVQNQGLGSQLV
Q0A9W2_ALKEH          DAAFAEAVWRGRARPMGHMLPETLAAHCGLRQAPERRGLRVVRIAVHPDARRRGLGRRLL
A1WWU2_HALHL          DPETAHEVWAERRRPHGHLLPQALATHAGIEMAPTGRALRIQRIAVHPRRRGHGIGAALV
D3RRX5_ALLVD          DPDLRAAIFRGQRRPRGHLLPQTLSAHAGLPEAPIHRYWRVIRIVVHPAVTGRGLGRRML
Q1QTA5_CHRSD          PEDLAERVVLGERRPRGHLLAQSLAAHGGWQAALTSRWWRIMRIAVHPATRRRGIGRALV
A1U6V4_MARHV          APDLAEEVVAGKRRLRGHMLAQSLANHGGAPAAATLKTLRVVRVAVAESARRLGVGQRLV
A0A656HB11_THINJ      DADLTAAIHAGKRRPHGHPIPQTLTFHAGIAGAAQRVCERVMRIAVHPGLQGQGLGSKLL
Q2SKZ4_HAHCH          EPPLIDAIWLGARRPRGHLLQQLFAQQMGVRKALQRPMARVIRIAVHPERQGRGVGLWML
A4SIB4_AERS4          APELAEAIWAGRRRPRGHLLPQSLLAHAGFKTAGGRSYARVMRIAIHPTLHRHGLGSRLL
A0KPS8_AERHH          ADELAEAIWAGRRRPRGHLLPQSMLAHAGFKTAGARSYARVMRIAIHPALHRHGLGSLLL
C4LD78_TOLAT          DAALAEQIRAGRRRPRGQLLPQTLLAHCGYLAAAGYRYLRVMRIAIHPACQQQGQGGRFI
TMCA_VIBCH            -APTIEAIQLGTRRPKGHLTPVTLANQLGISQAARQSCWRILRIAVHPDCQRQGIGSQLL
A1T0E4_PSYIN          -HNLCEQIWRGSRRVPGHLIAQSLTFHSRFQLAASNSYARIQRIAIHPDCQNRGIGKQFI
B6EPZ0_ALISL          -NDLISAIQCGTRRPKGHLVPVSLTQILCIDEPAIQHCARIMRIAIAVDYQGRGIGSEFI
Q6LFR2_PHOPR          -IDLAQQVMLGKRRVKGHLLAQSVAAHIGIPQGATQYCARILRIAVHPFLQQQGIGSSLL
Q487G0_COLP3          SDADIRAIKHSERRLRNHFLPQSLFSHCGFEQAFNYKYLRIMRIAVHPQIQQQGIGAQFI
A0A1H9ZCM0_THASX      -TVSLTAISEGKRRAASQFLPQSLLTHLGHKEAFDYRYWRIMRIAVHPDIQSKGVGSEFV
TMCA_HALMA            --ASTRATMYEGGRVRGNMLPDVLSTQLRDEAAGVPVGQRVLRIATHAAVRSRGLGSKLL
D2RVY0_HALTV          --PETRAMMYEGGRVRGNMLPDVLTSQLRDEDAGKPAGLRVVRIATHHAARSRGLGSHLL
A8MCG8_CALMQ          --DETINNMVLGFKPPGNIIPDRMVKYWKIPEFAKLRGWRIVRIATHPELQDKGLGSTAL
A2BLE0_HYPBU          --DEMVEELLRGGKTPGNIIPDRTLKHLRVREFGHARGWRIVRIATHPEVQGRGIGSFAL
TMCA_THEPD            --EDLSKESAKGAWLMGNIIPDRLIKHYKILDFGNLRGIRVVRIATHPSVMGKGLGSFAL
TMCA_METKA            --RDVITKMRRGYRPPGNVIPDLMVQHHDALDFPRMKGLRIVRIATHPDIMRHGLGSRAL
TMCA_PYRAB            --KAVIDKMAKGYKPPGNIIPDMMVKHHYAKEFAKLRGYRIVRIATHPDAMDLGLGSKAL
D2RDE6_ARCPA          --DETIKKIAKGYKPKGQIIPDLMLKHYWDYDFPKYVGLRVVRIATHPSVMRMGIGSWSL
TMCA_SULIY            --DRQIEDISNGLKNEGHLIPHRLIKYMRAFDFGKLKGWRIMRIAVSPENQGKGIGSRII
Q4JCC9_SULAC          --KGEIDRILNGSGLEGHLIPYKLTLYERLQEFGKYKGWRIMRIAVQPDVQNKGFGSKLL
Q4JBI8_SULAC          --DELIHSALMGVTFDGDLIPDRMIKHSRLIEFGKMKGWRIVRIAVMQELQDKGFGSQML
A0A0V8RU50_PYROC      --GGGGR------------LLHSLLRLHAEGAA-EARAVRVVRIAVHPSLQRRGLGSTLL
A2BKG0_HYPBU          --EEPAR------------IALKILWLQADSAAKELKAARIVRIAVHPELQRRGLGRKLL
TMCA_AERPE            --EEEAR------------IALERLLYMAGSPGSGVVSWRVSRIAVHEDLQRRGLGSRLL
A2BLX9_HYPBU          --PVTAR------------ILPDILAQYAPEAG-KLSGVRIVRIAVHSRLQRRGLGSKLL
B1L3H0_KORCO          -NSLLEDMVRGMRDLPGHMIASRIVLHYSFKSFGRLRGWRIVRIATHPELQGMGFGTRAL
B5IHD3_ACIB4          ---KYVDELYYGTTPPGNIVPDVMIKHHRMKDFAKYSGFRIVRIATHPEFMDMGIGSLML
Q15W71_PSEA6          LADISQEIRLGHRRVNGHLVSQNLALHTADDKFVTYEQWRIVRIAVSQDYRRTSIASTLL
Q31DY3_HYDCU          ------TALGENRRAQGHLFPQLMAKNTADRSWLVLKTLRIQRIAVQLNAQQQGIGSQLL
A6FY33_9DELT          -PELCEAAAQGKTRLRAHALPDTLVAHLGRTAAGELDMRRSVRIAVHPRLRRRGLATALV
Q3IDD4_PSET1          -EELTEQVISGERRPQGHLMAQTLAQLSFNSDFLTHLSARVVRIAIDPSSHNCGLGKALL
A6VTS2_MARMS          -SSLCQEVMQGKRRPRGHLVPQSLLAHEGVEGAGQYGYWRISRIATEQSQQNKGLASQLL
TMCA_IDILO            -SPLKEEVRQGQRRPKGNLLPQAIGYFLQQDWAMDLHWLRVARIAVPAAKRRRKAASELL
D3SEZ5_THISK          -PELAEAVWAGERRPQGHFLPCTLAAR-GEFALATRAWWRIQRLAVHPAWQGRGLGGRLL
F2G4U5_ALTMD          LEETAEAIASGKRRPKGHLGAQRLCLLSANGNAATFTYWRINRIAVHTRLQGKGIGSELL
                                                             *  *:.          .   :

B3GXD0_ACTP7          SDFIL-QKIQQNR-P---LVDYISVSFGLTEHLLHFWQQCGFQLVQITPTKEASSGYHSA
B0BNX7_ACTPJ          SDFIL-QKIQQNR-P---LVDYISVSFGLTEHLLHFWQQCGFQLVQITPTKEASSGYHSA
TMCA_ACTP2            SDFIL-QKIQQTR-P---LVDYVSVSFGLSEPLLHFWQQCGFQLVQITPTKEASSGYHSA
TMCA_HAEDU            TDFMQ-KMQKNNKNR---PLDFISVSFGITPHLLTFWRRNGFQLVQITPTKEASSGYHSA
B0BPP2_ACTPJ          SDFIL-QISKQKQ-P---LVDFISVSFGQTAALTHFWQQCGFELVQITPNKEASSGYYSA
Q9CM04_PASMU          ------KNICQDA-----QVDFLSVSFGYTTKLAAFWQKCGFLLVHLGEQKEASSGCYSV
TMCA_HAEIN            -------QAMENA-----DVDFLSVSFGYTDELAKFWQKCGFVLVHLGEHQEASSGCYSA
A6VQP5_ACTSZ          ------AGLLQHA-----NADFVSVSFGYTPELAYFWQKCGFILVYIGESREASSGCYSA
Q65RX4_MANSM          ------EKLAQTA-----QADFLSVSFGYNEELAHFWQKCGFILVNIGEYKEATSGCYSA
TMCA_CITK8            A------EAYGGAS----RCDYLSVSFGYTAELWRFWQRCGFVLVRMGNHKEASSGCYTA
TMCA_SALTY            A------CACMQAA----QCDYLSVSFGYTPKLWRFWQRCGFVLVRMGNHREASSGCYTA
D2TTA9_CITRI          A------RAC--DA----HCDYLSVSFGYTPELWRFWQRCGFTLVRMGNNREASSGCYTA
TMCA_ECOLI            A------GALQYTQ----DLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTA
TMCA_SHIF8            A------GALQYTH----DLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTA
B7LKG7_ESCF3          A------RALNYTH----DLDYLSVSFGYTAELWRFWQRCGFVLVRMGNHREASSGCYTA
A6TC97_KLEP7          A------DIAADAA----GYDYLSVSFGYTAELWRFWQRCGFTLVRLGTHREASSGCYTA
B5XVN1_KLEP3          A------TIAADAA----GYDYLSVSFGYTPELWRFWQRCGFILVRLGTHREASSGCYTA
A4WD54_ENT38          A------GASK-HI----QQDYLSVSFGFTDELWRFWQRCGFVLVRMGTHRDASSGCYTA
A0A0H3CQ14_ENTCC      H------EAC--------GEDYLSVSFGFTNALWHFWQQCGFELVRIGSHREASSGCYTA
C9XXK7_CROTZ          E------QARAQAPD---GCDYLSVSFGYTPALWHFWQRCGFTLVRFGSHREASSGCYNA
A7ML07_CROS8          E------QARAQAPE---GCDYLSVSFGYTPALWRFWQRCGFTLVRFGSHREASSGCYNA
D2T6T0_ERWP6          S------RSCQAAH----GLDFLSVSFGFTPQLWRFWQRCGFQLVRFGSQREASSGCYTA
D4HY71_ERWAC          T------RCCQAVH----GLDFLSVSFGFTPRLWRFWQRCGFQLVRFGSQREASSGCYTA
B2VE48_ERWT9          S------RSCRAAS----GLDFLSVSFGFTPRLWRFWQRCGFQLVRFGSQREASSGCYTA
D4GK02_PANAM          A------AACADAA----GYDYLSVSFGYTEPLWAFWQACGFTLARIGSQREASSGCYAA
TMCA_PECAS            AD-----QTREAQKQ---ALDYLSVSFGYQPDLWAFWQSCGFQLVRIGSHLEASSGCYSA
C6DBS4_PECCP          AE-----QTREAQRQ---GLDYLSVSFGYQPELWAFWQSCGFQLVRIGSHLEASSGCYSA
C6CQK6_DICC1          RE-----QQQHARRQ---QLDFLSVSFGFQPDLWRFWQRCGFQLVRIGSHIEASSGCYSA
C6CC70_DICP7          AA-----QVRQARQL---GIDFLSVSFGFQPDLWQFWQRCGFQLARIGTHVEASSGCYSV
TMCA_YERE8            AA-----EQARAQGE---GLDFLSVSFGYTVELACFWHACGFHLVRIGSHKEASSGCYAA
TMCA_YERPD            AA-----EQAHARQQ---QCDFLSVSFGYTAELAHFWHRCGFRLVRIGSHKEASSGCYTA
A8GHL3_SERP5          -------EQQRQQAQ---GLDYLSVSFGYTEPLWRFWQSCGFELARIGSKIEASSGCYSV
TMCA_PHOAA            AF-----QRERAEEQ---GMDFISVSFGYTAELWALWQKCGFQLVRIGTHLEASSGCYTA
Q7N3J1_PHOLL          AY-----QRERAEKQ---GVDFISVSFGYTAELWALWQKCGFQLVRMGTHLEASSGCYTA
D3V7B0_XENBS          AQ-----QCQEARTQ---KQDFLSVSFGYTAELWSLWQTCGFRLVRIGTHLEASSGCYTA
D3VI71_XENNA          TQHLITRQCQGSHQH---SLDFLSVSFGYTDELWSLWRKCGFQLVRMGTHREASSGCYTA
Q2NS79_SODGM          AK-----AAEQAAGE---GRDFLSVSFGYTAALWRFWQRAGFKLVRMGTHREASSGLYSA
C5B7A5_EDWI9          AEA----LTQARA-G---AMDFVSVSFGYTGALWAFWQRCGFTLVRVGTQREASSGCYTA
D0ZEZ3_EDWTE          AAA----LTQARAAG---AVDFVSVSFGYTDALWAFWQRCGFTLVRMGTQREASSGCYTA
B4EY73_PROMH          AD-----IAKQCQKQ---NIDYLSVSFGYTDALANFWQQCGFYLVRLGVHKEASSGCYTT
TMCA_NITHN            DT-----IIRETGGE---GLDYLGSSFGATVELLRFWERLDFLPVRLSVKRGATSGAHSA
Q3J7N7_NITOC          GI-----LIKALSAE---NLDYLGSSFGATEELLRFWERLDFLPVRLSVKRGATSGAHSA
Q0A9W2_ALKEH          LE-----ALADARRR---GLDYLGTAFGTTDELLRFWQCEGLAPVRVSLRRGAASGAHSV
A1WWU2_HALHL          AA-----VTERARGA---GCALVGTSFGATPGLIGFWRACGMHAVAVGARRDAASGEHSA
D3RRX5_ALLVD          TA-----LEQAARVE---RIDLLGASFGATTELLAFWQTCGFVPAQIGTSRNAASGEHAA
Q1QTA5_CHRSD          EA-----VAEAAPAA---GIDRLGVSFGAEASLIAFWHRQGFVSLRLGLTRDAASGEHAL
A1U6V4_MARHV          AA-----AREACVQD---GMDALGTSFGGEPGLLAFWHRCGLRVVRMGLSQEASTGEFPL
A0A656HB11_THINJ      EH-----LVKYAESS---GADYIGVSYAMTSALLRFWERAGFVLARVGHRKDTASGSYSA
Q2SKZ4_HAHCH          QA-----LKKILIQT---DCCLIGASFGASDSLLQFWEQAGYRLLRLGGKRDHVAGAYAA
A4SIB4_AERS4          GQ-----LEDYYREE---GLDYLGSAFSASADLLPFWRKAGLVTLRIGLQRDAASGNHAA
A0KPS8_AERHH          AH-----LEQHYQAA---GLDYLGSAFSASADLLPFWRKAGLKVLRIGLQRDAASGSHAA
C4LD78_TOLAT          AA-----LTAHYLLH----ADFLGCSFAATPELLHFWRKQGWQAVRLGLSKDVATGCHAA
TMCA_VIBCH            TH-----FIA---QH---HADYYATSFGVSEDLLPFWLANHFVPIKLGSHRDQASGCYSL
A1T0E4_PSYIN          NH-----LIGWAKKQ---AFDHLCVSYGVTADLLSFWQKRHFVPLRIGLSQDASSGTHSL
B6EPZ0_ALISL          HT-----LSEYYADE---GMDYLGTSFGSTFELNLFWSQLGFGFVRLGITKDKASGTHSL
Q6LFR2_PHOPR          GF-----AQKWATQQ---QLDYIGTSFAAAPELVSFWRKAGFLPIRLGVTKDASSGTHSL
Q487G0_COLP3          HY-----IELLAKEQ---GVDFIGASFGVNPELLSFWLNAGFSTARIGFTKDKASGEHSA
A0A1H9ZCM0_THASX      DK-----ICQQAERE---GVEFVGSSFGANASLVNFWHQSSFALARLGFTRDKSSGEHSA
TMCA_HALMA            SEIRAEFAD---------HVDWVGVSYGATPELVRFWADNGYNTVHLATSRNATSGEYSV
D2RVY0_HALTV          ERVREEFTDGLEADDNGDEIDWLGTGFGATPGLLEFWRENGYRTVHVSTTRNDASGEYSA
A8MCG8_CALMQ          SM-----LENEAKVR---GLDWVGVGFGVNAQLLRFWVKNGYLPIHISPERNPVSGEYSV
A2BLE0_HYPBU          EK-----VYEEAKEL---GLDWVGSGFGVNEQLLKFWVKNGFYPVHMSPDRNPVSGEYTI
TMCA_THEPD            SR-----LEEEARRN---GYDWVGAGFGVTYELLKFWLKNGYIPVHMSPEKNPVSGEYTV
TMCA_METKA            KE-----LAKIAKKK---DYDWIGTGFGANEELTRFWLRNGFVPVHISPNRNPVSGEYSV
TMCA_PYRAB            EL-----LVKEAQEK---GLDWVGSGFGASEELIRFWVRNGFAVVHLSPTRNPVSGEYTA
D2RDE6_ARCPA          SR-----IIDWAKSR---DMDWVGSGFGVSPELLRFWLRNGFIPVHITPQRNEISGEHTV
TMCA_SULIY            EE-----VIKMAK-----GVDWVGSSFVADYSVLRFWIKNGFTPVYLSSIKNEELNGYSV
Q4JCC9_SULAC          RS-----VVERGKRE---GIDWIGASFVADYRVVNFWLNNGFTPVHLSNRKNEGLNGYSI
Q4JBI8_SULAC          EM-----IIEDAKRQ---EIDWVGSSFMGDMRVLNFWIRNGFYPVHVSPKKNEKLGDYPV
A0A0V8RU50_PYROC      RR-----VEEWARGL---GADLVGAVFA-RHDVLGFWLRAGYTPFYVSPRYNRFTGEKNI
A2BKG0_HYPBU          SA-----VEDWARGK---GVDIVAALFG-RHDVIGFWVKTGYTLFYVSPRYNKATGEKNL
TMCA_AERPE            RH-----VEAQARES---GASLVTTMFS-RHDVIPFWLKNGFKPFYVSPRYNRVTGEKNV
A2BLX9_HYPBU          RY-----VEEVASSD---GYDWVGAVFG-RPDVLGFWLANNYTPIYVSPLPNKVTGEHNI
B1L3H0_KORCO          AE-----VEREARGK---SVDWLGAGFGATEDLLRFWVRSGYHPVHISPSRNTVTGEYSV
B5IHD3_ACIB4          EN---------IKRE---QGDWIGSSFGATERLMHFWTRNEFYPIHISPKINESTGEYSV
Q15W71_PSEA6          KF-----VESSAIEH---DIPLITSSFGATTNLLKFWGHSDYVPLKLGFKRDASSGEVSL
Q31DY3_HYDCU          NE-----FLQANQAD----YDCLTTSYGATPELIQFWRKHQFVPLHLGLKRDKASGMHSL
A6FY33_9DELT          EH-----VHRHAPPS----VELFGTLFGATPGLLAFRRSLGYRLVRVSASRGARAGEPSV
Q3IDD4_PSET1          SYS-----ESQVKEQ----CTWFGASFGATAQLLKFWQSLGFNAVKLGYQRDKSTAEHAT
A6VTS2_MARMS          TN-----IETAASDR----CDFLCSSFAATPDVVSFWLKNGYMPVRLGTAKDQASGSYSL
TMCA_IDILO            AE-----IYRWALDN---NYQMLGTSFAWSPGLDNFWKKNGYALWRLSSRIDSVSARPAA
D3SEZ5_THISK          RA-----VEECAAHH---DIALLGTSFGLQPALVRFWGQAGWQPVRVGERPDPASGEVSI
F2G4U5_ALTMD          RK-----ITNESYRH---GIDAICTSYGTTAKLDAFWCRNGFEVVDYGRKPNKASGETSA
                                                :     :  :                        

B3GXD0_ACTP7          MMLYPISAEGQRFVQQATARFERDLALQPFYAELQNMLPIRPLV----------------
B0BNX7_ACTPJ          IMLYPISAEGQQFVQQATAQFERDLALQPYYAELQNMLPIRPLV----------------
TMCA_ACTP2            MMLYPISAEGQRFVQQATARFERDLALQPFYAELQNMLPIRPLV----------------
TMCA_HAEDU            MMLYPLSQQGKQFVTKAVKQFERDLALQPFYPTLKNCLAIPAQV----------------
B0BPP2_ACTPJ          MMLYPLTEKGKQFVKKAQMQFSRNQALLPHIQNGNQ----KMTK----------------
Q9CM04_PASMU          IGLKPLSSAGISFCQQAYQQFQRNLSLSRHSLATAFPS---LPS----------------
TMCA_HAEIN            IALKGISKEGLALVDTAYKQFQRNLPLSFHPFAINFEQ---NQL----------------
A6VQP5_ACTSZ          IMLQGISAVGIELVRRAESDFKRNFPLGFHPLRKLFD----FPY----------------
Q65RX4_MANSM          IALRPLTAAGEDLVKRAQQYFRRNLAFTFHPL----------------------------
TMCA_CITK8            MALLPISEAGARLAHREHQRLRRDAEILARWNGEA-IPVIPLK-----------------
TMCA_SALTY            MALLPLSDAGKRLAQQEHRRLRRDADILTQWNGEA-IPLAALR-----------------
D2TTA9_CITRI          MAMLPLTEAGKRLAENEHQRLRRDAEILSQWSGEA-LPVTPLK-----------------
TMCA_ECOLI            MALLPMSDAGKQLAEREHYRLRRDAQALAQWNGET-LPVDPLN-----------------
TMCA_SHIF8            MALLPMSDAGKQLAEREHYRLRRDAQALAQWNGEM-LPVDPLN-----------------
B7LKG7_ESCF3          MALLPMSDAGKQLAEREHYRLRRDAHALTQWNGET-LPVDPRN-----------------
A6TC97_KLEP7          MALYPLTAAGRQLAQREAQRLQRDEYWLRPWREES-APLPAVA-----------------
B5XVN1_KLEP3          MALFPLTAAGHQLAQRETQRLLRDEYWLRPWRDES-APLPAVA-----------------
A4WD54_ENT38          MALLPISEAGRALCVQEHQRLCRDARIIERWNGEK-IPVDEAW-----------------
A0A0H3CQ14_ENTCC      MALLPQSEAGHRLCEQARLRLHRDARVLSLWNGEK-IPVADEW-----------------
C9XXK7_CROTZ          MALLPLSTAGARLAREEHQRLARDAAMLQRWVDET-LPLTPAA-----------------
A7ML07_CROS8          MALVALSAAGARLVREEHQRLARDATLLQRWVDET-LPLTPAP-----------------
D2T6T0_ERWP6          MAIYPLSTAGQQLAERATRRLARDGYWLRQLLDQDDLPLVAQC-----------------
D4HY71_ERWAC          MAIYPLSASGQQLAERATRRLARDGYWLRQQSEQEELPLDAQR-----------------
B2VE48_ERWT9          MALYPLTRAGQRLTERATGRLARDGYWLRQLLDQENLPLATGF-----------------
D4GK02_PANAM          MAVLGLTTAGKALQQKAEGSLARDWPLLRPHIPLD-LPLPAAC-----------------
TMCA_PECAS            MAILPLSEAGYELAQQGSQQLARDWYWLQRMIPLN-LALPQTENIER-------------
C6DBS4_PECCP          MAILPLSDAGHQLAQQGCQQLARDWRCLQRLIPLN-LALPQTD-----------------
C6CQK6_DICC1          MALFPLSEEGRALTASAHHELLRDGYWLRRDIPLT-LDLPLME-----------------
C6CC70_DICP7          MAILPLSEEGHRLAQDAYRQLCRDGVERYNAQLLP-LTLPSMD-----------------
TMCA_YERE8            MAVLPLSRAGDMLCEAARQQLVRDWYWLQQWIGLE-TPVSLFPP----------------
TMCA_YERPD            MALLPLSPAGEALCQAAQQQLKRDWYWLQQWIGIP-TPVFLRLP----------------
A8GHL3_SERP5          MAILPLSEQGEALRHAAHKHLARDWRWLQPRIDLQ-LEVTG-------------------
TMCA_PHOAA            MAIFPLSQQGIALCVQAQQQLARDAYWLESQIGFS-LPVDDQA-----------------
Q7N3J1_PHOLL          MAIFPLSEQGILLGIQAQQQLARDAYWLELQIGFS-LPVDYQT-----------------
D3V7B0_XENBS          MAILPLSEKGKWLAESAQQQLCRDAYWLELLIGFS-LPIDHHD-----------------
D3VI71_XENNA          MAILPLSEQGHRLAQSAQQQLSRDARELGKMLGFT-LPITYDD-----------------
Q2NS79_SODGM          MALLPLSDAGRKLTLRAANGFERDCRLAAGE-----------------------------
C5B7A5_EDWI9          MALCPLTAAGEALTRRLARRLARDARWLMAQTGLT-LPLTPLV-----------------
D0ZEZ3_EDWTE          MALCPLTAAGAALTRRLARRLARDARWLMAQTGLV-LPLTPLA-----------------
B4EY73_PROMH          MAIYPISAQGQQLLQVAQQALALQSDYITQQTGIS---LATAL-----------------
TMCA_NITHN            IVLHPLSSSGQALVKRARERFLVHLPHQLADPLRELEPQLAAWLLRRGDPAGPLPLDSQD
Q3J7N7_NITOC          LVLYPLSNSGQALVKVARHRFQAHLPHQLSDPLRELEPPLAACFLRCGGQASPLSLDRQD
Q0A9W2_ALKEH          VMLRAVSAAGESLLGRARARFLDGLPHLLADPLRRLEPALADQLLRAPDQGAAPPV-ADD
A1WWU2_HALHL          LMARGLDEQGVAWVRQAGFRLGAGAPALLGEPLARMEPQVVLAVLRAAQGAEPPVLSDWQ
D3RRX5_ALLVD          VVLRAISVAGERLLEDAGRRLTSSLPVWLAGPLRTLDPEIAATLIGALPVPDSAECALHA
Q1QTA5_CHRSD          MMGRSPAGAGDGSLETWAHALQDALPGLLAFELNALEGEVATALLR--EGPVPVVSAALA
A1U6V4_MARHV          QMLMGTSEPGQQLQQQLSSRFARHWQHLVPRHWCQLDHELLLAICDA--LPSSAWLDDDD
A0A656HB11_THINJ      VQIRGLTAAGKGLCA---------------------------------------------
Q2SKZ4_HAHCH          CVATSLNSEGEALISQAHDRFVRRSAFDSRHIFAHEPWILSQLPI----SAQNALQAQEI
A4SIB4_AERS4          LLLKALKPEWQAELDLWRQRFVQQLPTLLAGELKELDPELVWQCVKGQELAVPELDEFEQ
A0KPS8_AERHH          LLLKALQPTCAAELTDWHQRFVRQLPTLLAGELKNLESELVWQCLRDGEASLSRLDAFDQ
C4LD78_TOLAT          VLLTALRPELQPQLSAWQQQFQQHLPVWLAHILNDLAADIVLPLL--QPATSEPLTAQEQ
TMCA_VIBCH            LM---VRGEHLDWLEQAKQQFSAHWIFELSDSLQALEPQIIQQLLPSTVALPQPLIPLEL
A1T0E4_PSYIN          IMNLPLSKRAHLLHQLIVQQFRQQLPTQLSRHLQHLDTEVVLKLLLNSSKVQSDQPS---
B6EPZ0_ALISL          LAIKPLSLKSLEWNQIAVEYFHTSFPEQLMSVFSHLGMNESKGLLSSCITSNRLTPIMLK
Q6LFR2_PHOPR          LAVQPISDAAQSWQQCAVSLFAANFLSQRVEQFNNLESELFISLFQYSFTQIDIKKYMPL
Q487G0_COLP3          LLIKGLVVKSKQEQQSFKRNFYQSFDYLLLEEYRALTTELVFLLLRQNSKGDVSALSERD
A0A1H9ZCM0_THASX      LMLKPMTLAAERFFKQIHTNFYKQFLYLLTLEYADLQCKLVWQILHRMPLEYVPALTKSD
TMCA_HALMA            VMLDPCSDDAAALAARHREWFQDRIAAVLSDPLDDCDPDVVRAVLRATDGERP-------
D2RVY0_HALTV          LMLAPTSDAGRALHDRHADWFARRFPALCTDALSDLEPDVARAVLRSVDADAAP------
A8MCG8_CALMQ          LMIKPISDTAREAVYYANREFRIRLLSSLSGPYVGLEPDVALMLLTSSEPVAQSLE----
A2BLE0_HYPBU          LVIKPITETMTRLVDIANREFKRKLLESLHDPYRDLEPEVAMLILKTGNPIFDNYY----
TMCA_THEPD            IVVKPLSEKAKRIVDVIAKEFKQKLLGSLASPYFDLEPEVALLLLKSTP--SFEVK----
TMCA_METKA            AVIRPISEEAEEIINRANFEFRIKLADWLGETHRDLEPEVARLLFEPM--SSLRYR----
TMCA_PYRAB            IVIKPISERAKEIVKKANDEFRLRLTEWLGDTHRDLEPEIARWLFETPFGEAVNYP----
D2RDE6_ARCPA          IVLKPLKMHVEEKVDMINTDFTRRLIEYLADELRDLETETAIGLLKSLRRDLEVDM----
TMCA_SULIY            IVIRALSEKSKGFVVKLSSLLKDKLLRTSHQVYYNLNPQLIALLMRNTYSERRRE-----
Q4JCC9_SULAC          VVLKALNEAIEPIINRLSVLLRFKILHTAHQLYFNVNPLLLSKILRGTNIDSKSSNYP--
Q4JBI8_SULAC          IVIKPISEIATKAVRVAAYVLKEKLLNTLHDVYFSMDPEIAQIILSGIKVHKEVK-----
A0A0V8RU50_PYROC      AVAKPLTGLGERLVLEAAGELRLKLLLSSHSVYRDLAAEKIAAML-ERLPRVEPPV----
A2BKG0_HYPBU          GFAKPLTPKGAEVLTNASRRARRKLVLGAHSTYRDLAAEKTAILLRATQPLHDAPI----
TMCA_AERPE            ALAKPLDSAGAEILEKASKTLALKLALAGSSIYRDLAAEKLALLL-HHTPATAPPL----
A2BLX9_HYPBU          AVVKPIANKAAKILGGVAAAARKRMLLASHSLYRGLPAEILVEIFSHQVPAQQPLS----
B1L3H0_KORCO          LVLKPLSEEASKLTEEVLKEFKRRVLASLHDVYFSLNPMVARLLLKSKLDGG--------
B5IHD3_ACIB4          VIIYPKKDDIKEKVEMARRKFGERFITSLGEIHKHMEPEIAREILNSLPKYK--------
Q15W71_PSEA6          IVGKSLSPTTSTLLNKLSLQFGEELIYHASRYHRSMDTSLLANLLTYCQ-----------
Q31DY3_HYDCU          AMCRPFSTTAKALTKSTLAAFQNQFAWNLTDGFKALDSALVITLLQGCEFP---------
A6FY33_9DELT          MMLRPLSDRARALVDGLRRELASELAVQLQLLAADDGLPLEPELVAALSAGLDLPLDD--
Q3IDD4_PSET1          LVVKSLNAP-QQSLQSLIKQFQYELFYGLLSHFKSLEWQLVSTLLRSFNDEVIASDTL--
A6VTS2_MARMS          MMVKPMTKHAALLANKWQARFIEQFLLNLLLQYSDLSTDLVMLILGQKYYQQDE------
TMCA_IDILO            IYALPLTNEFTELYRVCQLLGQWGQNQLQWLSGGKETLQLTEER----------------
D3SEZ5_THISK          VLTRALTQDTAALVDAAAASFARDWREGGAALLRDQTGRRRRVLEAIQPSAVTAP-----
F2G4U5_ALTMD          LAVLAHTNKVKMLVSELITLQKSYQSTLGLFSLPTSVINTYQQKLHHFIDGSRALDDVWP
                                                                                  

B3GXD0_ACTP7          --------QLQMDEQDWRNIEGFALAQRSLAASYVSLTRLYRQDPR--------------
B0BNX7_ACTPJ          --------QLQMDEQDWRNIEGFALAQRSLAASYVSLTRLYRQAPR--------------
TMCA_ACTP2            --------QLQMDEQDWRNIEGFALAQRSLAASYVSLTRLYRQDPR--------------
TMCA_HAEDU            --------ENEMNQDDWQNLHGFAFAQRSLANCYTSLKRLYITHQA--------------
B0BPP2_ACTPJ          --------YLKLDKTDWHDLYGFAYAQRSFQASYASLKRLYWQYPE--------------
Q9CM04_PASMU          --------TWQLDPQDWRALVHFAYFQGSFTAALPAIQRLLAQTNR--------------
TMCA_HAEIN            --------DWQLDDFDWMSLKNFANFHRTLFSSIPAMRRLLKLAGK--------------
A6VQP5_ACTSZ          --------CWRYTLQDEVSLKNFAENHRTLAATVPAIRRKMTSLDW--------------
Q65RX4_MANSM          --------------HDKLSVEK-------------SSAEKITQLNG--------------
TMCA_CITK8            --------ASTLNDDDWDELAGFAFAHRPLLTSLGSLSRLLERCEL-------------A
TMCA_SALTY            --------EQALNDEDWRELVGFAFAHRPLLTSLGCLHRLLQYSAL-------------P
D2TTA9_CITRI          --------ATTLNEEDWRALAGFAFAHRPLLTSLGCLSRLLASSPL-------------A
TMCA_ECOLI            --------DAVLSDDDWLELAGFAFAHRPLLTSLGCLLRLLQTSEL-------------A
TMCA_SHIF8            --------DAILSDDDWLELAGFAFAHRPLLTSLGCLLRLLQTSEL-------------A
B7LKG7_ESCF3          --------DAVLSEDDWLELAGFAFAHRPLLTSLGCLTRLLQTSEL-------------A
A6TC97_KLEP7          --------DAMLSDEDWLEAASFAFAHRPLAAALGCLNRLLMQADM-------------P
B5XVN1_KLEP3          --------DAMLSDEDWLEAASFAFAHRPLAAALGCLNRLLMQVDM-------------P
A4WD54_ENT38          --------EPILNNDDWLELGGFAFAHRPFATSAAALTRLLLAVDL-------------P
A0A0H3CQ14_ENTCC      --------EATLNSDDWLELAGFAFAHRPFATSVAALTRLLLAVDL-------------P
C9XXK7_CROTZ          --------QATLNEDDWLALAGFAFAHRPLETSLGPLYRLLEASPQ-------------A
A7ML07_CROS8          --------QATLNSDDWLALAGFAFAHRPLETSLGPLYRLLEASPQ-------------T
D2T6T0_ERWP6          --------DGQLTEDDWQELAGFAWAQRPFGASFAALGRLVSQEAC-------------Q
D4HY71_ERWAC          --------DLLLNDDDWQELAGFAWAQRPFEASFAALGRLVSQGG--------------H
B2VE48_ERWT9          --------DGQLNEDDWQELAGFAWAQRPYEASLAALGRLVSQKAC-------------R
D4GK02_PANAM          --------DHAFTRRDAWLAAGFAWAQRPLEASLAVLQRLVGISQQ-------------P
TMCA_PECAS            -----DTESIALNDDDWRELAGFAFAHRPMEASFAAICRLLIHTSL-------------P
C6DBS4_PECCP          --------SNALNEDDWRELAGFAFAHRPMEASFAAICRLLIHTSL-------------P
C6CQK6_DICC1          --------EQMLTADDWRNLAGFALAHRPPEACQGVLSRLVFHSPM-------------P
C6CC70_DICP7          --------VDSLTSQDWMNLAGFALAYRTPEACRDALVRLLRHSPL-------------P
TMCA_YERE8            -----EQPDITLNDDDWRELAGFAFALRPLEASLPALQRLLLQDKALQI--------KAP
TMCA_YERPD            -----EPPEVTLTDDDWRELAGFAFAFRPLEASLPALQRLLLHTEL-------------P
A8GHL3_SERP5          -----DDGDTRLGEDDWRELAGFAFAHRPLEASLGALQRLLLASAL-------------P
TMCA_PHOAA            --------DQRLNQNDWQELAGFAFAHRPLSASLPALQRLLLNCGL-------------P
Q7N3J1_PHOLL          --------DHHLNQHDWQELSGFAFAHRPFSASLPSLQRLLLNSDL-------------P
D3V7B0_XENBS          --------DNQLSDNDWQELAGFAFAHRPLSASYFALQRLLLALDL-------------A
D3VI71_XENNA          --------DQRLNGRDWQELSGFAFAHRPLSASYFALQRLLLVSTL-------------T
Q2NS79_SODGM          --------QQDLRMEDWRCLAGFAFAQRPPEACRSALTRLINRSTL-------------P
C5B7A5_EDWI9          --------AAGPDEADLRELDGFAHHARPYDSACPALLRFLTCRRT-----------SAL
D0ZEZ3_EDWTE          --------ADKLDEADLRELDGFAHHARPYDSACPALLRFLAGRPA-----------STL
B4EY73_PROMH          --------PSASEADHWLMMAGFAFAHRSILTVYQSVGYFLQGDRS-------------R
TMCA_NITHN            WS-----DVLAFAFGRRVYEVCIGPIWKLTWGALAAPESATLLGEVE-------------
Q3J7N7_NITOC          WC-----DVLAFAFGRRMYEVCIAPIWKLACGALPVPESEALLREME-------------
Q0A9W2_ALKEH          WE-----DLRAFAASERIFEACLPALRRWTLWLLADPERAARLTPAE-------------
A1WWU2_HALHL          RQ-----ELVGFAHSLRGYAAALPALWVLAEVVLMDPHGSRGRMAHC-------------
D3RRX5_ALLVD          GSGGWRRELESFVAGHRTLEASLPLLSVLTRRHLADALSAGRIDRRE-------------
Q1QTA5_CHRSD          AR------LAHYARGAGELSLARPWLCEAWLAWWRARPAVDDETPCE-------------
A1U6V4_MARHV          RR-----DLTNFAYGFRGFELTLPVLQELSACKGM---AHRIQSHPE-------------
A0A656HB11_THINJ      -----------------------------LMPATTTTADQTESGK---------------
Q2SKZ4_HAHCH          EL---------LQLFVEGGRPY--ENVEDLLQILSAYAELTHLGEKA-------------
A4SIB4_AERS4          DE---------LDCFAHHHKPFELCQSTLQRWLTGNLPRLASLTPSE-------------
A0KPS8_AERHH          DE---------LACFAHHHKPFELCQPSLQRWLAGNLTQLAELDPAE-------------
C4LD78_TOLAT          QD---------LLAFTDHHRSPDHSWPAVTRAMQVSAGELAQLPAAM-------------
TMCA_VIBCH            --------IERYARGGANYESVAVWLYAWLLATAPSLESLSP------------------
A1T0E4_PSYIN          --------LLSYTQGHLPYEFIEHDLIDLMLNCDLTGLSKAQQ-----------------
B6EPZ0_ALISL          -------RVSVYTKGGLGVEVIGYELRMFVLSNILLLDSLSLIQ----------------
Q6LFR2_PHOPR          PQSFRDLQLSCYCRGGLGYDLAIASIESWLTEWVASDDFIHDPT----------------
Q487G0_COLP3          IA-----NVQAFSRGERLYSSCCYSLYLWLKQDLLSETKCHSTEVLQQ------------
A0A1H9ZCM0_THASX      RQ-----AVEDFTSKRRQLSPCSYGLRHWLIHHCQHDYHNDMAP----------------
TMCA_HALMA            ---------VSLSEWEWRLVAGVPGGASVLDTNPKPFRDLTRRHLSHPADA--TALSPRE
D2RVY0_HALTV          --------ELALSAHDWRVVAGAAYGPGLFDADPGPFRDLVVRYFVENPDD--VDLTARE
A8MCG8_CALMQ          ---------LNLTSGQLNRLIAYAWGPMTYENTVDALIELFKAYFMRITRA-GFRIPEIM
A2BLE0_HYPBU          ---------PALTPIQVDRLWIYAYGPMTYEAVADVLHELIRAYWIMYPKTKGLSLSKKE
TMCA_THEPD            ---------VNLTKLQLARFLTYAWSDMTLENCIDVVGIMTRLYFLSKKKP---SLSELQ
TMCA_METKA            ---------PTLTEGQLRRLKKYADMVHTYEIAADAVRELAKAYFLDTEDR--PELSEEE
TMCA_PYRAB            ---------IHLTKVQRKRLEMFIKRVLTYDTVVDAVKPLVKLYFLDGWMR--PYLDDRQ
D2RDE6_ARCPA          ---------PNFGKIERRRIKKYFQGQSLYEYVSDLIRPLVRYYYSKRDKV---DLDEEE
TMCA_SULIY            ---------GEVPDLYVNKIKAYIEGKVPYNVIAETAHFLITKHFLELKVN--LSIE--A
Q4JCC9_SULAC          ---------VSFPKEYCYKIESYLKGILEYNSVADGIHAVTQYYFLYPDHF--LEER--E
Q4JBI8_SULAC          -----------INPIYVDKAVAFLQGVSPYESSADGIHLLALKYFWDAKRE--WSLEPEQ
A0A0V8RU50_PYROC      ----------SLARGQARRLCLYLRGALEAEQAMDALYLAAVIALSRPRGV--ERLRGSL
A2BKG0_HYPBU          ----------VLEQLDHKALNTYMEGVVELEQVIDSAYLATASAL-LAGCE--DRLDDRS
TMCA_AERPE            ----------YLTRIQARHLEGFLKGEVMADQAFDAVYIALLSTLLATRSW--NPVEPG-
A2BLX9_HYPBU          ----------DIDEWQRYRLSLFLCGSLEAESVLDVLWLLLVNDILARGRL--DLEDPKA
B1L3H0_KORCO          --------KAKLSTSQRSRLLGYVKGSYVYELASDAIHEVVRSYFWQGKD----CLTPRE
B5IHD3_ACIB4          --------NLELDPIDWKRLIVYSWGPGNYETMVDVIYRIASSYFFLKCKPKLSR---EQ
Q15W71_PSEA6          --------PEESCTRTRYRVGQFIASSSPYMPFSQLLAKYVLNKLT--------------
Q31DY3_HYDCU          --------TASFPKGYLQQQPYETVAYELRQWTLAHIDRFTAQPLA--------------
A6FY33_9DELT          --------APPTPAQARRAARGYAHGPRTFESRATALRAYLALPEVQPRLA---ALEPSL
Q3IDD4_PSET1          --------RLFTQQLSSNRFTISPTLWRLISQSPAAMTKLASNQQQ--------------
A6VTS2_MARMS          -----LPALAKLSLQDLQDIGLFVEHHRQFDSIRPVFLKATLSLALTGQLTS-----KDP
TMCA_IDILO            ------------NKIRTSLIQAYRSKTIPFDAAHFALAQWFYWQHSN-------------
D3SEZ5_THISK          ---------DRDHARDIEEIRAFARRQRPLQWIRAALRRSLVAHPPQG-----------P
F2G4U5_ALTMD          ILCKIAKFDGGTFNDKPGDASGLDNANSADSADSADSADSADSADSADSAK-------YS
                                                                                  

B3GXD0_ACTP7          ---NHGVLANLWQQFERIQG-----KKEWLENLRSLLANYLQYTR---------------
B0BNX7_ACTPJ          ---NHGVLANLWQQFERIQG-----KKEWLENLRSLLANYLQYTR---------------
TMCA_ACTP2            ---NHGVLANLWQQFERIQG-----KKEWLENLRSLLANYLQYTR---------------
TMCA_HAEDU            ---QLTILAPLFTHRYPAN------QKVWLQQCRIAIRPFIQ------------------
B0BPP2_ACTPJ          ---QFSAMKGIFEREEPLPNN----KKQWLNHYRTLVQKILQENDG--------------
Q9CM04_PASMU          ---CICPLLSALLQPSSNEMKFVGGKKNGIKICREEVKKLLQNHTAVLS-----------
TMCA_HAEIN            ---ENFPLISAYLTKKQF----PINKKKGVECLRLEIKQYLERGTL--------------
A6VQP5_ACTSZ          ---RDYPVLNDFCRTGKADTTGWGGKKNWLTQCRSEVKKMLNSD----------------
Q65RX4_MANSM          ---QDFGILENFADYHRTFYSSQGAIYRLFIRLGADTSPHVG------------------
TMCA_CITK8            LPALRGRLEEKCSDANLCIRLGLPGRKALLVAQRREVAHALTALDDERAQRLRERVLQWQ
TMCA_SALTY            LPALRGRLEEKASDAELCARLRISGRKALLALQRAQAAQALIALDAGRTQSLRDVMPGGG
D2TTA9_CITRI          LPALRGCVQERQSDAQLCRALQLSGRKALLEQQRAEAAQALSALEPARAQQERDRIMQWQ
TMCA_ECOLI            LPALRGRLQKNASDAQLCTTLKLSGRKMLLVRQREEAAQALFALNDVRTERLRDRITQWQ
TMCA_SHIF8            LPALRGRLQKNASDAQLCTTLKLSGRKMLLVRQREEAAQALFALNEVRTERLRDRITQWQ
B7LKG7_ESCF3          LPALRGRLQKNASDAQLCTTLKLSGRKMLLARQREEAAQALFALDNVCTERLRDRITQWQ
A6TC97_KLEP7          LPALRGRLQGK-EEAALCAVLQLTGRKALQARWRREAADALRFLDAARAEALRQQVAHLQ
B5XVN1_KLEP3          LPALRGRLQGE-EEAALCAALQLTGRKALLARWRVEAADALRFLDAARAEALRQQVAHLQ
A4WD54_ENT38          LPALRGKIESQRDDAQLCAELSLQGRKQLLAMQRCEAHQALDSLDIQRSQQLKSDILQWQ
A0A0H3CQ14_ENTCC      LPALRGKIEARREDAALSDELSLTGRKAVLARLRAETAQALECLDKARSQQLKSDILQWQ
C9XXK7_CROTZ          LQALRGRLALQTPVDALCRQLGLSGRKALLAALRQETALALEALDAQRAAALNAQLMQWQ
A7ML07_CROS8          LQALRGRLALQMPVDALCRKLGLSGRKALLAALRQETALALEALDAPRAATLNAQLMQWQ
D2T6T0_ERWP6          LPLLHAALLEGQSAAVLCSRFALPGRKALLSAWRQEARQALIMLDQPRALRWQQWVNGLN
D4HY71_ERWAC          FPLLYAALIEGQSAAQLCSRFAVAGRKALLNAWRHEAQQALIALDKANALHWQQWVNGLN
B2VE48_ERWT9          LPLLYAALIEGQSVTQICQHFSLAGRKALLIDWRREAEQGLLLLDEPRALCCRRWVSGLG
D4GK02_PANAM          LPLLRQAVNADTSLAELAQSARLNGRKMLITALRAEAAAALLALPGREGEALREQLQ---
TMCA_PECAS            LPALRLLAETPSEGEQTAATLGLTGKKALLKRWREETTSALIELDAQRGERWRLWVLPDD
C6DBS4_PECCP          LPALRLLVETPGEGEQIAATLGLTGKKALLKRWREEAANALFDLDAQRVERWREWVISTR
C6CQK6_DICC1          LAALRLWLEQGKSAAECVQQLQLAGKKALVQRWRTETAQALQQLDAAQWQHWYDIIAIAK
C6CC70_DICP7          LEALRLWLERQWSVGEIAAYLQISGRKALVRLWRGECADALQRLDACLYQRWRDWVVLAD
TMCA_YERE8            LPALRQYLQQGRTTAEIVHQLGLSGRKALVTKWRQEAAEAMAELKPVGNFLVNINNFQ--
TMCA_YERPD            LSALRHYLQLRTPQSEIINTLGLIGRKALVALWRQEAAEGMAMIDVDKMIMSAKPSARCS
A8GHL3_SERP5          LPALRLHLQQQTTSAGCVELLGFSGQKALLRRWRQETGMALEQLDAQHCLRWHDWSQSLQ
TMCA_PHOAA            LTALRNHLQREMSIEQCVTELRLNGHKALTLLWRQETAQALVSLDEKLAMYWQEWTTVF-
Q7N3J1_PHOLL          LIALRNHLQQEMRVEQCITVLQLSGYKALMRLWRQETAQALSSLDKKLAKDWQEWTTAF-
D3V7B0_XENBS          LPALRKYLQQQIDIEQCARDLFLSGRKALLKRCREETAGALASIDEILANQWKNWTISCG
D3VI71_XENNA          LPALRKHIQQGIDIEQCACDLSLSGRKALLKRWRDEAAHALASIDEILANQWKSRVISYD
Q2NS79_SODGM          LPALRLWLTQPMPDATLVARLALSGKKALWRHWRQETAAAMAAADARLTHRWQRICQQQA
C5B7A5_EDWI9          PPLLAQLLQVQGDLARLPPQGGISGRRALIAALRRALAAALTTTA---------------
D0ZEZ3_EDWTE          PPLLVQLRQAQGDLARLPPQAGVSGRRALIVALRQALAAALATAA---------------
B4EY73_PROMH          YPLLVAFFIDKQSVEACVKQFSLSGKKALVTTLRRQCQQLMAEKDEQLAQAYQHWLTTTS
TMCA_NITHN            RNALIVKVLQKRSWQEAAAALELSGRAQVIEVLRRTLRPLVLHFGNEAVRREAERLAGG-
Q3J7N7_NITOC          RNALIVKVLQKRSWREAAAVLELSGRVQVIEALRQALRPLVLHFGSEAVRREAERLREH-
Q0A9W2_ALKEH          RNALILRLLQHRDWGETARALSLPGRRQVTRLLREAVAGQLPEPLG--------------
A1WWU2_HALHL          EAAFIGKVLQHRPWADTAQRLGVPGRRPALAALRQAVADSLPE-----------------
D3RRX5_ALLVD          AALLVAAALQCRPLTGLARHFDARGREALLERLRQVCGRLIDHPPGIRP-----------
Q1QTA5_CHRSD          ETRALREWASVLFQGRDAETTPSRGRQARLAHWRHMAAALHRRLTATA------------
A1U6V4_MARHV          AKLWCRAVLQGWSWVQLQEAGLCRGQRDAEAQLRLLARELLQNETEL-------------
A0A656HB11_THINJ      -----------------SRMSGM-------------------------------------
Q2SKZ4_HAHCH          ARLWRAKVQQQQDWSEVARLTGLSGRKQIIAQLRECARVLLASLETAGTPAG--------
A4SIB4_AERS4          CQLLIATIWQYADWSRLAARLQLAGKPAIIKALRALLARLLDAPTTR-------------
A0KPS8_AERHH          RQLLIATIWQYADWGALAARLQLAGKPAVIKALRSLLARLLPPATTR-------------
C4LD78_TOLAT          AALLIQRFWQGKSWAWLAEQHQLAGQKAVVQQLRRVVKRLLSPPGCSGEEQ---------
TMCA_VIBCH            --LLISKILQRKSWAACAEQFQLSGKRQVEQAVRTEILALLVNLQCKYTLPI--------
A1T0E4_PSYIN          -CLAIQKILQNNSWAEICRKNNLTGKKQAQYILKETIKQLTTNVTKRGNQ----------
B6EPZ0_ALISL          QQLVITKLLQLNEWSEVIKITGLSGRREAELVLRESIQSILINLQCKSS-----------
Q6LFR2_PHOPR          AALAVVKVLQKQSWNTVVAQFSLPSRKHAEHALRSYITQHYQSSL---------------
Q487G0_COLP3          SLVLVARLIQKHDSDSVCQQFGLTGKKMLNNHIKNYVHLRLNTAIN--------------
A0A1H9ZCM0_THASX      ---LIARLLQRKAIEDIATAFDFTGRKAVITAFINYIEEQAE------------------
TMCA_HALMA            ERLLVRKVLQAHPWSTVTEELAFVSERECMRTLGGIVERLTRLYGDPWVQEELDRHL---
D2RVY0_HALTV          ERLLVLRALQGRDWESVADRLEYHSTGQCMRALGGAFCPLVDRYGSDAALDVRERFLEE-
A8MCG8_CALMQ          EKGIIAKVFQSKTWSAAARELGVKPTVLMLGLRAVSRVLLVYFYGNGFNIPI--------
A2BLE0_HYPBU          EYIAISKVLQGRSWDSVAEGLHTRPHSVMVALKELARKILKHYYGKDSESPVG----IPA
TMCA_THEPD            ELLLVSKILQAKSWHLTCQELNLSLAEATSNMKQIAQIFSKEFLGVNSEEEA--------
TMCA_METKA            ELLLITKCLQRWKWADVADVLGEEVPDLMRSLRDLVGLLYEEYKEDLQRSAAVEGIRKAV
TMCA_PYRAB            IALLIHRVLQAHDWKETAKLLNRTELYTMIELRDIVRGLWYYYKHMLK------------
D2RDE6_ARCPA          ERILVAKCLQLKSWKDLGENFKVYKTLLKAVQKIWKKYYEEA------------------
TMCA_SULIY            EASLVARVLQGKSWYHAGLMLGLSSREVEERVKQGLEVLLRTYS----------------
Q4JCC9_SULAC          EAVLIARTLQGKSWHHISLSTGIDRRVVEEYMRSSIDKIYMKYCDRVL------------
Q4JBI8_SULAC          EILLIAKILQGRPWRFTSASLNSNRTGVNEMLYQAIAELLYRYYSLNSETKVGISLDKLD
A0A0V8RU50_PYROC      LVLAVARLLQGKPPDEAAEAAGLGLEELPAALREA--AGLLAGEAGLDCGGTQPRDGGGK
A2BKG0_HYPBU          LVALVARILQGKPIGETAEILGASVEEAQALLREA--LKALIGCRRSRTQRRSP------
TMCA_AERPE            LVGAVARVVQGKPYSEVASIIGASTVDEAVGKVEEYIRGILEGARSLWSGRVIP------
A2BLX9_HYPBU          ELVAVMRILQGKTLADITAAIRVDSSEVRKHLRSL--ALLLAKRAGIEAGDSCEAASEPS
B1L3H0_KORCO          EAILVAKVLQGKPWETLKSRFGVKEPYELLREIVSNLLSCLDGLRDEA------------
B5IHD3_ACIB4          EIILISKVLQHGQWEEVGRGIGKGGTYVVIELREIMRKFIGGRYNDEVLEFQRRFHGEN-
Q15W71_PSEA6          -KVNSANTLTKETEILVAALIQFKSTQDLVIEFNLNGKKELNTYIRNAIASI--------
Q31DY3_HYDCU          -EIWVEKVLQTHPWQQVCLKESLNRKALELEFKTWLKAFVQTR-----------------
A6FY33_9DELT          RRVVETRALALRSWSDARAAADLDSLPATMRALRRAFRALVSADAIS-------------
Q3IDD4_PSET1          --LLIQTVLQHHTDEQLIKNLNLNGKKQLEQQFRNTTNILAKQLSS--------------
A6VTS2_MARMS          THQLLIEAALGRNTEQTRLKAQLSGKKAMHQTFKRLLAQILK------------------
TMCA_IDILO            HPLTELLCNSSTTLKHLGEYWGGVSQRQANENLCKEVCLLH-------------------
D3SEZ5_THISK          EGRLLQSAIESLDDEALARELGFSGRREAVRRLRQAAQTWLAHPEA--------------
F2G4U5_ALTMD          DYKPIQNIAKIINENSRLIDVFITSNIELKQLCSALDAKGLKEATKKLREKLKPALF---
                                                                                  

B3GXD0_ACTP7          ---------------------------------------
B0BNX7_ACTPJ          ---------------------------------------
TMCA_ACTP2            ---------------------------------------
TMCA_HAEDU            ---------------------------------------
B0BPP2_ACTPJ          ---------------------------------------
Q9CM04_PASMU          ---------------------------------------
TMCA_HAEIN            ---------------------------------------
A6VQP5_ACTSZ          ---------------------------------------
Q65RX4_MANSM          ---------------------------------------
TMCA_CITK8            FFH------------------------------------
TMCA_SALTY            DHAG-----------------------------------
D2TTA9_CITRI          FFH------------------------------------
TMCA_ECOLI            LFH------------------------------------
TMCA_SHIF8            FFH------------------------------------
B7LKG7_ESCF3          FFH------------------------------------
A6TC97_KLEP7          FF-------------------------------------
B5XVN1_KLEP3          LF-------------------------------------
A4WD54_ENT38          FFQ------------------------------------
A0A0H3CQ14_ENTCC      FFQ------------------------------------
C9XXK7_CROTZ          FFH------------------------------------
A7ML07_CROS8          FFH------------------------------------
D2T6T0_ERWP6          AN-------------------------------------
D4HY71_ERWAC          AH-------------------------------------
B2VE48_ERWT9          ---------------------------------------
D4GK02_PANAM          ---------------------------------------
TMCA_PECAS            AAEDALHP-------------------------------
C6DBS4_PECCP          LTGNAPHP-------------------------------
C6CQK6_DICC1          ---------------------------------------
C6CC70_DICP7          ---------------------------------------
TMCA_YERE8            ---------------------------------------
TMCA_YERPD            TVRLPGRKNLTICQC------------------------
A8GHL3_SERP5          ---------------------------------------
TMCA_PHOAA            -SEANRLHHPICH--------------------------
Q7N3J1_PHOLL          -FEANHLHHPTCY--------------------------
D3V7B0_XENBS          VSGNNRPHHPIYH--------------------------
D3VI71_XENNA          PVEANCPHHPIDR--------------------------
Q2NS79_SODGM          R--------------------------------------
C5B7A5_EDWI9          ---------------------------------------
D0ZEZ3_EDWTE          ---------------------------------------
B4EY73_PROMH          SGHFCWANRPHHPIYH-----------------------
TMCA_NITHN            ---------------------------------------
Q3J7N7_NITOC          ---------------------------------------
Q0A9W2_ALKEH          ---------------------------------------
A1WWU2_HALHL          ---------------------------------------
D3RRX5_ALLVD          ---------------------------------------
Q1QTA5_CHRSD          ---------------------------------------
A1U6V4_MARHV          ---------------------------------------
A0A656HB11_THINJ      ---------------------------------------
Q2SKZ4_HAHCH          ---------------------------------------
A4SIB4_AERS4          ---------------------------------------
A0KPS8_AERHH          ---------------------------------------
C4LD78_TOLAT          ---------------------------------------
TMCA_VIBCH            ---------------------------------------
A1T0E4_PSYIN          ---------------------------------------
B6EPZ0_ALISL          ---------------------------------------
Q6LFR2_PHOPR          ---------------------------------------
Q487G0_COLP3          ---------------------------------------
A0A1H9ZCM0_THASX      ---------------------------------------
TMCA_HALMA            ---------------------------------------
D2RVY0_HALTV          ---------------------------------------
A8MCG8_CALMQ          -----------YMIQPSKRQKQAY---------------
A2BLE0_HYPBU          ESIISTYEAQEFFVKPRQLQHKSRSEEQSSIDDANEREA
TMCA_THEPD            --------LRYFFLRMDDLNEGVSA--------------
TMCA_METKA            ERLADKGLTGTVIVEVEEGEPKEVIIRREERLEL-----
TMCA_PYRAB            ------------------DEEKDIS--------------
D2RDE6_ARCPA          ---------------------------------------
TMCA_SULIY            ---------------------------------------
Q4JCC9_SULAC          ---------------------------------------
Q4JBI8_SULAC          DDQID----------------------------------
A0A0V8RU50_PYROC      GWRGGGL--------------------------------
A2BKG0_HYPBU          ---------------------------------------
TMCA_AERPE            ---------------------------------------
A2BLX9_HYPBU          SISTNPRLATS----------------------------
B1L3H0_KORCO          ---------------------------------------
B5IHD3_ACIB4          ---------------------------------------
Q15W71_PSEA6          ---------------------------------------
Q31DY3_HYDCU          ---------------------------------------
A6FY33_9DELT          ---------------------------------------
Q3IDD4_PSET1          ---------------------------------------
A6VTS2_MARMS          ---------------------------------------
TMCA_IDILO            ---------------------------------------
D3SEZ5_THISK          ---------------------------------------
F2G4U5_ALTMD          ---------------------------------------