CLUSTAL format seed alignment for MF_01891

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FLHC_BURL3      --------------------MSGRAGRHGLADDAQLTMHAAALIRLGARLQMLEIECALP
FLHC_CUPPJ      -----------------MKTTAQTAPARSALQDASDTQLAIELIGLGARPQVVEAEVTLS
FLHC_CUPMC      -----------------------MTTRKSVLREVEEFRLAVELVELGARLQVLESEVAIS
FLHC_PARP8      ------------------------MSKKSLSEDAQEVFRAIALIELGARMQVLESELTLS
FLHC_CUPNH      MDVHDIAGTAVAGSPAPVPRARPPRPGKSMLQDVEQIRLAIEMIGLGARLQVLESEVSLP
FLHC_NITEC      ------------------------MKVKSILSEGKQIQLATELVRLGARLQVLEVSTTLS
FLHC_VEREI      -----------------MSTNVAKARVKSVLNESRQIERAAVLIRMGARMQVLESETTLS
FLHC_GALCS      ------------------------MAIKTVLGEAQQIKIATDLIVLGARLQVLQEETSLS
FLHC_VARPS      ------------------------MTRKSVLGEVREVQLAIQLIQLGARLQFLESEVGLS
FLHC_THASP      ------------------------MKNKSVIEEADDVRRAVEMVQLGARMQMLEVETRLS
FLHC_ENTCC      -----------------------MCGEKSLLQEIDEVNIAMGLISLGARMQVLESETSLS
FLHC_ERWT9      ------------------------MIGKKVLDEIYEINIAMELIVLGARMQVLESETSVS
FLHC_SODGM      ------------------------MYRKSIMQESRDIQLAMELIALGARLPILENETCLS
FLHC_BURSC      ------------------------MASKSVVLEAREITLAIELIELGARLQLLEAETSLS
FLHC_PROMI      ------------------------MSEKSIVREAKDIRLAMELITLGARLQMLESETQLS
FLHC_ECOLI      ------------------------MSEKSIVQEARDIQLAMELITLGARLQMLESETQLS
FLHC_ECO57      ------------------------MSEKSIVQEARDIQLAMELITLGARLQMLESETQLS
FLHC_ECOL6      ------------------------MSEKSIVQEARDIQLAMELITLGARLQMLESETQLS
FLHC_SHIFL      ------------------------MSEKSIVQEARDIQLAMELITLGARLQMLESETQLS
FLHC_SALTY      ------------------------MSEKSIVQEARDIQLAMELINLGARLQMLESETQLS
FLHC_PECCA      ------------------------MAEKSIVQEAKDIQLAMELISLGARLQMLESETQLS
FLHC_XENNE      ------------------------MVEKSIVQEAKDIQLAMELITLGARLQMLESETQLS
FLHC_SERMA      -----------------------MMVEKSIVQEAKDIQLAMELISLGARLQMLESETQLS
FLHC_YEREN      ------------------------MVEKSIVQEAKDIHLAMELITLGARLQMLESETQLS
                                           .    :      *  :: :***  .:: .  :.

FLHC_BURL3      REHLVRLYREVRGVAAPKGLLPSSIDWYMTWLANIHASLFHNIYRFLRNQAGCPRLEALV
FLHC_CUPPJ      RSRVYRLYRELTGGSPPKGMLPFSADWFVTWRPNAHASYLLSVHEYMQQRAGLPGIRAVL
FLHC_CUPMC      RDRLTRLYKELRGVSPPKGQLPSSPEWFLTWRPNVHASLFLSAYRFLMAQGKQSRIRCIV
FLHC_PARP8      RERMIRLYREVKGVSPPKGMLPFSADWYTTWLANIHASLFYNTYRFLRDEARCSHLDALT
FLHC_CUPNH      RVRLIRLYKELCGVSPPKGMLPFSTDWFVSWRPNAHASMLLGAYRFMTSRGSLDGIRAVL
FLHC_NITEC      RERLVKLYKEVKGVSPPKGMLPYSEDWFTGWQPNMHSSLFINIYNYITQYTNVRDIDAII
FLHC_VEREI      YERLIRLYKEIAGKSPSKGQLPFSTDWFLTWQENIHSSLFLNIYEYLSKGLDLDAVELLI
FLHC_GALCS      RERLLKLYKEVRGESPSKGMLPYSTDWFISWQPNIHSSLFMGIYQFMIKNAGVDGVHALI
FLHC_VARPS      RERLIRLYKEIKGVSPPKGLLPFSTDWYMTWLANIHSSMFYNMYQFMKIHSDEEKVWILI
FLHC_THASP      REKLLRIYKEVRGASPPKGMLPFSTDWFMTWQPNVHSSLFMNLYRYFTGPAGVHGLDAIL
FLHC_ENTCC      RRRLLRLYKELRGCPPPKGMLPFSEDWFMSWEQNIHSSMFYNIYLYLKKTEQGRSIEMLM
FLHC_ERWT9      RRRLVRLYKEIRGCPPPKGMLPFSEDWFMCWEQNIHSSLFYNIYLCLQKTENERPITTLM
FLHC_SODGM      RSRLLRLYKEVKGTPAPKGLLPFSADWFLSWEQNIHSSAFYNAYLCLIRVGNIPTIEAMI
FLHC_BURSC      RDRLVKLYKELKGVSPPKGMLPFSTDWFMTWQPNFHSSLFYNIYRFMAGHGGCRAIESIV
FLHC_PROMI      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYRFLLKSGGSVGIEAVV
FLHC_ECOLI      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNVHASMFCNAWQFLLKTGLCNGVDAVI
FLHC_ECO57      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNVHASMFCNAWQFLLKTGLCNGVDAVI
FLHC_ECOL6      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNVHASMFCNAWQFLLKTGLCNGVDAVI
FLHC_SHIFL      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNVHASMFCNAWQFLLKTGLCNGVDAVI
FLHC_SALTY      RGRLIRLYKELRGSPPPKGMLPFSTDWFMTWEQNIHASMFCNAWQFLLKTGLCSGVDAVI
FLHC_PECCA      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYSFLIKNGQCSGVKAVI
FLHC_XENNE      RGRLIRLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYRFLLKSGHCEGVEVVV
FLHC_SERMA      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYLFLMKSGQCSGVEAVI
FLHC_YEREN      RGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYSFLLKSGQCTGVEAVI
                  .: .:*.*: * ...** ** * :*:  *  * *:* : .    :        :  : 

FLHC_BURL3      KAYTLYAEQGDA-TRRALPLDLTRALPLDLTRAWMLVRFVDAGVLDIARCRDCGAAFI-T
FLHC_CUPPJ      NSYRVYAEHMKA--NNEECL-------ISFTRFWTLVRFCEGGLLQLSTCPCCGGRFV-T
FLHC_CUPMC      SAYRLYVEHISL--IGEDLT-------LSFTRAWTMLRFLDSGTLVSSTCKCCGGSFV-R
FLHC_PARP8      KGYRLYLEHCRH--NQTEPV-------LDLTRAWTLVRFFDANILQLTPCCRCSGKFI-G
FLHC_CUPNH      SSYRMYREQLCA--TGEASQ-------LSFTRAWTLVRFYERGMLRLARCRDCRGEYV-V
FLHC_NITEC      KSYQLYLEHIEV--NHLQCI-------LSFTRAWTLVRFVESKVLSVTSCVKCTGNFL-V
FLHC_VEREI      RAYRLYDEQVTT--TAIAPL-------LSFTRAWRLVKFVDAGMLTRTRCARCGGQFV-T
FLHC_GALCS      SAYRLYLDQVQG-IEGGEVV-------LSITRAWFLVRFFKAGMMQLITCRECSGKFV-T
FLHC_VARPS      KSYKLYLQQIAA--QDSEPI-------LDFTRAYTMVRFFDSDMLQLSTCCRCSGQFV-A
FLHC_THASP      KSYHLYLDHIET--GVIEPA-------LSLTRAWTLVRFFDADLLQMAACTRCGGEFV-A
FLHC_ENTCC      KTYRLYLEQCST-CSDEKPV-------LGLTRAWTLLRFIDCGIISRKACSVCGGGFI-V
FLHC_ERWT9      QAYRLYLEQCYP-HSSETPV-------LGLTRAWTLLRFIGCGMISRKSCMLCAGGFV-M
FLHC_SODGM      KAYRLYLELCPQ-RQDGGPL-------LGLTRAWILLRFIDSQLLGQTRCKLCGGAFI-T
FLHC_BURSC      KSYRLYLEHVQL--QDDEPV-------LSLTRAWTLVRFFDSGMLQLSVCRRCGGQFV-A
FLHC_PROMI      KAYRLYLEQCPP-VKDQEPI-------LALTRAWTLVRFVESGMLQLSVCTKCNGSFI-T
FLHC_ECOLI      KAYRLYLEQCPQ--AEEGPL-------LALTRAWTLVRFVESGLLQLSSCNCCGGNFI-T
FLHC_ECO57      KAYRLYLEQCPQ--AEEGPL-------LALTRAWTLVRFVESGLLQLSSCNCCGGNFI-T
FLHC_ECOL6      KAYRLYLEQCPQ--AEEGPL-------LALTRAWTLVRFVESGLLQLSSCNCCGGNFI-T
FLHC_SHIFL      KAYRLYLEQCPQ--AEEGPL-------LALTRAWTLVRFVESGLLQLSSCNCCGGNFI-T
FLHC_SALTY      KAYRLYLEQCPQ--PPEGPL-------LALTRAWTLVRFVESGLLELSSCNCCGGNFI-T
FLHC_PECCA      KSYRLYLEQCAP--QSDSPL-------LALTRAWTLVRFVDSGMLQLSSCNCCKGMFIYP
FLHC_XENNE      KAYRLYLEQCPPGNNGDAPI-------LALTRAWTLVRFVDSGMLQPTECRCCGGTFI-T
FLHC_SERMA      KAYRLYLEQCPQ-QAGEAPL-------LALTRAWTLVRFVDSGMLQLSACSCCGGAFI-T
FLHC_YEREN      KAYRLYLEQCPD-QSGIPPL-------LALTRAWTLVRFVDSGMLQLSGCNCCGGTFI-T
                  * :* :                   : :** : ::.*     :    *  * . ::  

FLHC_BURL3      YRHALRRHPVCVACRLPARAGK--RAVAAPQRATADTRHARRQDARTAVVACRDGSTTTG
FLHC_CUPPJ      HAHEPLASFICTLCQPPSRVRRSVRRETPHA-------------TANAPAAVLGNR----
FLHC_CUPMC      HKYDLQTNFVCGLCAPPPRAAK--GKKLATS------------AEPFVVPEDLQQT----
FLHC_PARP8      HKHDLQHNVVCDACQPPSRAGK--TKKAAAA-------------KRDAQPQLVEVQHAAN
FLHC_CUPNH      QADDARHRYVCGLCLPPARAGK--GRKPAPA--------------------ALAG-----
FLHC_NITEC      HSLDIQSNHVCGLCHVPSRAGK--TKRAAAQ--------------KAKEAQEVEIR----
FLHC_VEREI      ELYESRH-FICGLCHPPARAGK--SRVAGAL--------------------MLH------
FLHC_GALCS      HTNELHNNYVCGICHPPARAGK--T---------------------NAKARLLAGH----
FLHC_VARPS      HAHDHKSGYVCVLCRPPSRAGK--ARGAKRG------------AEGEAGALGIEGM----
FLHC_THASP      HAHDPVHDYVCGLCNMPSRAGS--ARRKTTT-------------RKAVAPTHKTTA----
FLHC_ENTCC      TTEFIKNPFTCSLCSPPSRALK--KSQVSNT----------GLLGTFAAPEIMTA-----
FLHC_ERWT9      VTEFIKEPFTCSLCCPPSRALK--KFSATSG-------------SS--------------
FLHC_SODGM      YAFHPPHNFVCSFCHPPSRAVK--KRKLSHA-------------AADNRIYNLRQR----
FLHC_BURSC      HAHDPQHAFVCGLCQPPSRAGK--TKKAAQT--RPERQSAVAGIPAEV-PQVAEARAHEA
FLHC_PROMI      HAHQPASNYVCSLCQPPSRAIK--KRKLSAN-------------PADINLQLLDGL----
FLHC_ECOLI      HAHQPVGSFACSLCQPPSRAVK--RRKLSQN-------------PADIIPQLLDEQ----
FLHC_ECO57      HAHQPVGSFACSLCQPPSRAVK--RRKLSQN-------------PADIIPQLLDEQ----
FLHC_ECOL6      HAHQPVGSFACSLCQPPSRAVK--RRKLSQN-------------PADIIPQLLDEQ----
FLHC_SHIFL      HAHQPVGSFACSLCQPPSRAVK--RRKLSQN-------------PADIIPQLLDEQ----
FLHC_SALTY      HAHQPVGSFACSLCQPPSRAVK--RRKLSRD-------------AADIIPQLLDEQ----
FLHC_PECCA      RLHQPKNSFVCSLCQPPSRAVK--RLKLSQN-------------LADIIPRLLDEQ----
FLHC_XENNE      HAHQPVNSFVCSLCQPPSRAVK--KRKLSPQ-------------PADTNSQLLDGF----
FLHC_SERMA      HAHQPLNGFICSLCQPPSRAVK--RRKLSPQ-------------LADIIPQLLDEQ----
FLHC_YEREN      HAHQPRNSFVCSLCQPPSRAVK--KRKLSPQ-------------SADITSQLLDEQ----
                          *  *  *.*.                                        

FLHC_BURL3      GASGERHAV-------------------
FLHC_CUPPJ      ----PPVAMPGFGMVPAL----------
FLHC_CUPMC      ----ISIEPAAMNRPKDAPLRRMGSLKP
FLHC_PARP8      DVETIAVESLAAVETVAPGVFEEAVLAA
FLHC_CUPNH      ----------------------------
FLHC_NITEC      ----EACAV-------------------
FLHC_VEREI      ----------------------------
FLHC_GALCS      ----AE----------------------
FLHC_VARPS      -GFGVEAAPGGAGFH-------------
FLHC_THASP      ---ASRKAVVA-----------------
FLHC_ENTCC      ----------------------------
FLHC_ERWT9      ----------------------------
FLHC_SODGM      -NMCNVKPC-------------------
FLHC_BURSC      RCTAPTLDTFVTAEV-------------
FLHC_PROMI      ----EQFRM-------------------
FLHC_ECOLI      ----RVQAV-------------------
FLHC_ECO57      ----RVQAV-------------------
FLHC_ECOL6      ----RVQAV-------------------
FLHC_SHIFL      ----RVQAV-------------------
FLHC_SALTY      ----IEQAV-------------------
FLHC_PECCA      ----VKHAV-------------------
FLHC_XENNE      ----AQKAM-------------------
FLHC_SERMA      ----VKRAI-------------------
FLHC_YEREN      ----VRRAV-------------------