CLUSTAL format seed alignment for MF_01894

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SMC_FUSNN             --------------MYLKAVEINGFKSFG-DKVYIDFNR-----GITSIVGPNGSGKSNI
E3H7H1_ILYPC          --------------MHLKAVEINGFKSFA-EKINLDFNT-----GITSIVGPNGSGKSNI
D1AK68_SEBTE          --------------MYLKALELNGFKSFA-EKTVIDFTN-----GITSIVGPNGSGKSNI
SMC_CLOK1             ------------MSMFLKTIEIKGFKSFA-DKTELIFTG-----GITSIVGPNGSGKSNI
D8GS00_CLOLD          --------------MFLKNIEIRGFKSFA-DKTELIFKG-----GVTSIVGPNGSGKSNI
Q97IA1_CLOAB          --------------MFLKSIEIRGFKSFA-DKTDLIFKN-----GITAVVGPNGSGKSNI
A0Q0Y7_CLONN          --------------MFLKSLEIRGFKSFA-DKTELVFKK-----GITAIVGPNGSGKSNI
Q895M7_CLOTE          --------------MFLKSLEIRGFKSFA-NKTEINFQK-----GITAIVGPNGSGKSNI
Q0SSA4_CLOPS          --------------MFLKSLEIRGFKSFA-DKTELNFKK-----GITAIVGPNGSGKSNV
A6LSM4_CLOB8          --------------MFLKSLEIRGFKSFA-DKTELKFKQ-----GVTAVVGPNGSGKSNI
D9SLC7_CLOC7          --------------MYLKAIELRGFKSFA-DKTEIELKD-----GITAIVGPNGSGKSNI
D7APA8_THEM3          --------------MYLKKLELQGFKSFA-DKVTLNFEK-----GVTAIVGPNGSGKSNI
Q8R9W7_CALS4          --------------MYLKKLELYGFKSFA-DKVSLNFEK-----GITAIVGPNGSGKSNI
D9TN88_THETC          --------------MFLKRLEIIGFKSFA-DKVVLNFEK-----GITAIVGPNGSGKSNI
C9YKI7_CLODR          --------------MYLKRLELKGFKSFP-VKTDIIFKE-----GITAIVGPNGSGKSNI
E3PS49_ACESD          --------------MYLKKMEIKGFKSFP-DKTEILFPH-----GLISVVGPNGSGKSNI
B0S1M4_FINM2          --------------MGLKSVEIQGFKSFK-DKIKLNFDN-----PITAIVGPNGSGKSNI
Q3AC59_CARHZ          ---------------MLKKVVIQGFKSFA-EKTEITFEP-----SITGIVGPNGSGKSNV
E4SF58_CALK2          --------------MYIKWLEIYGFKSFC-EKTRIEFEK-----GITAIVGPNGCGKSNI
SMC_RHOBA             ---------------MLKALELAGFKSFA-DRTRFDFP-----DGITVVVGPNGSGKSNI
D2QWB0_PIRSD          ---------------MLKALELHGFKSFA-DKTRFEFP-----AGITVIVGPNGSGKSNI
D5SU17_PLAL2          ---------------MLKALELFGFKSFA-DRTRFDFA-----SGITSVVGPNGSGKSNV
SMC_KORVE             -------------MLKLKKLQLLGFKSFC-DRTELKFPG----DGIAAIVGPNGCGKSNI
C1F1T5_ACIC5          -------------MLKLKKIQILGFKSFC-DRTEVALPG----NGIAVVVGPNGCGKSNI
Q01Y77_SOLUE          -------------MLKLKRVELQGFKSFC-DRTELRFNG----EGIAAIVGPNGCGKSNI
SMC_MYCPA             --------------MYLKSLTLKGFKSFA-SPTTLRFEP-----GITAVVGPNGSGKSNV
SMC_MYCTU             --------------MYLKSLTLKGFKSFA-APTTLRFEP-----GITAVVGPNGSGKSNV
SMC_MYCLE             --------------MYLKSLTLKGFKSFA-SPTTLRFEP-----GITAVVGPNGSGKSNV
A4FMG9_SACEN          --------------MHLKSLTLKGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
C8XH72_NAKMY          --------------MHLKSLTMKGFKSFA-SSTTLRLEP-----GITAVVGPNGSGKSNV
D7GEI0_PROFC          --------------MYLKSLTLKGFKSFA-SATTLAFEP-----GITAIVGPNGSGKSNI
Q2J6Z3_FRACC          --------------MHLKNLTLRGFKSFA-SSTSLHLEP-----GITCVVGPNGSGKSNV
A8L599_FRASN          --------------MHLKSLTLRGFKSFA-SSTTLHLEP-----GITCVVGPNGSGKSNV
C9Z3S1_STRSW          --------------MHLKALTLRGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
D7CC86_STRBB          --------------MHLKSLTLRGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
B1VYX5_STRGG          --------------MHLKALTLRGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
E4NHH3_KITSK          --------------MHLKSLTLRGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
C7QGY1_CATAD          ----------MSPHVYLKTLTLRGFKSFA-SATTLRLEP-----GITCVVGPNGSGKSNV
A0LV82_ACIC1          --------------MYLKSLTLRGFKSFA-STTTLRFEP-----GITCVVGPNGSGKSNI
A0JXV4_ARTS2          --------------MHLKSLTVRGFKSFA-SATTFDFEP-----GVTAVVGPNGSGKSNV
A1R7H8_PAEAT          MDTDTRATQENRSALHLKSLTVRGFKSFA-SATTFDFEP-----GVTAVVGPNGSGKSNV
A6W7T9_KINRD          --------------MHLKTLTLKGFKSFA-SATTLRLQP-----GITCVVGPNGSGKSNV
D1BJA3_SANKS          --------------MHLKTLTLRGFKSFA-SATTLNLEP-----GVTCVVGPNGSGKSNV
C7NGM6_KYTSD          --------------MYVTSLTLKGFKSFA-SSTKLELEP-----GITCIVGPNGSGKSNV
B2GFM7_KOCRD          --------------MHLKTLTVRGFKSFA-SATTFHFEP-----GVTAVVGPNGSGKSNV
E1VVN2_GLUAR          --------------MHLKTLTVRGFKSFA-SATTFEFEP-----GVTAVVGPNGSGKSNV
A5CQQ2_CLAM3          --------------MHLKSLTLKGFKSFA-QPTTFQFET-----GVTCVVGPNGSGKSNV
Q6AE90_LEIXX          --------------MYLKSLTLKGFKSFA-QPTTFAFEP-----GVTCVIGPNGSGKSNV
D1AB24_THECD          --------------MYLKSLTLRGFKSFA-SSTTLRFEP-----GITCVVGPNGSGKSNV
D6Y659_THEBD          --------------MYLKKLTLRGFKSFA-SATTLRFEP-----GITCVVGPNGSGKSNV
D7BMZ9_ARCHD          --------------MHLKTLTLRGFKSFA-SQTTLHFEP-----GINCVVGPNGSGKSNV
D6ZIF1_MOBCV          --------------MYLKSLTLKGFKSFA-NTVHMSLEP-----GVTCVVGPNGSGKSNV
C7R311_JONDD          --------------MHLKTLTVRGFKSFA-SATRFDFEP-----GITCVVGPNGSGKSNV
D6ZV06_BIFLJ          --------------MYLKELTLRGFKSFA-SATTLRFEP-----GITAVVGPNGSGKSNI
Q7ZAJ9_COREF          --------------MYLKSLTLKGFKSFA-SATTLKFEP-----GICAVVGPNGSGKSNV
Q8NNW5_CORGL          --------------MYLKSLTLKGFKSFA-SATTLKFEP-----GICAVVGPNGSGKSNV
Q84F13_CORDP          --------------MYLKSLTLKGFKSFA-SATTLKFEP-----GICAVVGPNGSGKSNV
Q4JUZ1_CORJK          --------------MHLKSLTLKGFKSFA-SATTLKLEP-----GICAVVGPNGSGKSNV
C4LJD3_CORK4          --------------MYLKSLTLKGFKSFA-SSTTLKLEP-----GICAVVGPNGSGKSNV
D6Z8M0_SEGRD          --------------MHLRSLTLKGFKSFA-APTTLVFEP-----GVTAVVGQNGSGKSNI
C8WGU5_EGGLE          --------------MYLKSLVLKGFKSFA-DRSVLALEP-----GIIAVVGPNGSGKSNI
C7MMZ7_CRYCD          --------------MHLKSLVLKGFKSFA-DRSVLSFEP-----GITAVVGPNGSGKSNV
C7N560_SLAHD          --------------MYLKSLVLKGFKSFA-DRQVISLEP-----GITAIVGPNGSGKSNI
E1QVK5_OLSUV          --------------MYLKSLTLRGFKSFA-DKTQMAFDP-----GLTVVVGPNGSGKSNI
C8W740_ATOPD          --------------MYLKSLTLKGFKSFA-DKTQMVFDP-----GLTVVVGPNGSGKSNV
SMC_RHOPA             --------------MKLTRLRLHGFKSFV-EPTDFMIEP-----GLTGVVGPNGCGKSNL
A7IGT2_XANP2          --------------MKFDRLRLVGFKTFV-EPTDLLIEP-----GLTGVVGPNGCGKSNL
B8EMM7_METSB          --------------MKFTKLRIAGFKTFV-DPTDFLIEP-----GLTGVVGPNGCGKSNL
B8IQU0_METNO          --------------MKLTRLRIVGFKTFV-EPSEFLIEP-----GLTGIIGPNGCGKSNL
Q92RE8_RHIME          -----------MLLMKFTRLRLLGFKSFV-EPTEFVIER-----GLTGVVGPNGCGKSNL
A7HQY9_PARL1          --------------MKFNRLRLSGFKSFV-DPTDLIIEP-----GLTGIVGPNGCGKSNL
D8JUP9_HYPDA          --------------MKITRLRILGFKSFV-DPTELVIEP-----GLTGVVGPNGCGKSNL
E3I0B2_RHOVT          --------------MQITRLRLLGFKSFV-EPTELLIGP-----GLTGVVGPNGCGKSNL
SMC_RHOS1             --------------MRFTRLRLNGFKSFV-DPTDLVIHE-----GLTGVVGPNGCGKSNL
Q2W040_MAGSA          -------------MIQFTKLRLSGFKSFV-DPAELVIEP-----GMTGVVGPNGCGKSNL
D3P3X3_AZOS1          --------------MQFTRLRLSGFKSFV-DATDLVIEP-----GMTGIVGPNGCGKSNL
B6IR58_RHOCS          --------------MQFTRLRISGFKSFV-DATELQIEP-----GMTGIVGPNGCGKSNL
Q2RPA2_RHORT          -------------MLHFTRLRLVGFKSFV-EPAELMIEP-----GLTGVVGPNGCGKSNV
SMC_CAUVN             --------------MQFQRLRLSGFKSFV-EPTEFRIEP-----GLTGIVGPNGCGKSNL
B0T003_CAUSK          --------------MQFQRLRLSGFKSFV-EPTEFRIEP-----GLTGVVGPNGCGKSNL
Q0AMJ6_MARMM          --------------MKFTQLRLAGFKSFV-EPTELRIDP-----GLTGVIGPNGCGKSNL
E0TC69_PARBH          --------------MEFQRLRLTGFKSFV-EPTDFEIRP-----GLTGIVGPNGCGKSNL
C6XRC2_HIRBI          --------------MHFTGLKIVGFKSFA-DPVDFAIRE-----GLTGIVGPNGCGKSNI
Q0C0X5_HYPNA          --------------MQITELRIAGFKSFV-DPQTVPIEP-----GLTGIVGPNGCGKSNL
Q1GQU3_SPHAL          --------------MQIKRLRLTGFKSFV-EPTELRIEP-----GLTGVVGPNGCGKSNL
D4YX43_SPHJU          --------------MQIKRLKLSGFKSFV-DPTELRIEP-----GLTGIVGPNGCGKSNL
Q2G9S3_NOVAD          -------------MMQFRRLKLSGFKSFV-EPAELRIEP-----GLTGVVGPNGCGKSNL
D5BSU5_PUNMI          ---------------------MAGFKSFA-EVAEVEIES-----GLTGIVGPNGCGKSNV
A5FVJ2_ACICJ          ------------MPARFARLRISGFKSFA-DPTTIDILP-----GLTGIIGPNGCGKSNV
C5B6I7_METEA          --------------MRINGLVIDGFKSFA-DRVKLPIEA-----GTTGVVGPNGCGKSNL
Q937L3_DEIRD          ---------------MIHAITLQGFKSFA-DRTRLEFSLSSGSGGVCAVIGPNGSGKSNV
Q1J060_DEIGD          ---------------MLQSITLQGFKSFA-DRTRLEFGP-----GVSAVIGPNGSGKSNV
L0A7J5_DEIPD          ---------------MITAISLQGFKSFA-DKARLDLGP-----GITAIIGPNGSGKSNV
D7BH70_MEISD          --------------MKIDRLILQGFKSFG-ERTVLEFGS-----GVTGIVGPNGSGKSNL
SMC_THASP             --------------MRLSKLKLAGFKTFV-DPTTVLTPG-----NLVGVVGPNGCGKSNI
A1K715_AZOSB          --------------MRLAKLKLAGFKTFV-DPTTVLMPG-----NLVGVVGPNGCGKSNI
C7RKG8_ACCPU          --------------MRLTKLKLAGFKSFV-DPTTIALPG-----QLVGVVGPNGCGKSNV
Q3SJI0_THIDA          --------------MRLTHIKLAGFKSFV-DPTVIPVPA-----QLTGVVGPNGCGKSNV
SMC_DELAS             --------------MRLNSIKLSGFKSFA-EPTNFMLPG-----QLVGVVGPNGCGKSNI
D6CTE6_THIA3          --------------MRLTSLRLAGFKSFA-EPVTLPFPG-----RISGIVGPNGCGKSNV
SMC_BORPD             --------------MRLTQLKLAGFKSFV-DPTVIPVPS-----QLVGVVGPNGCGKSNI
SMC_BURP1             --------------MRLSSIKLAGFKSFV-DPTHFQVPG-----QLVGVVGPNGCGKSNI
A4SYV7_POLAQ          --------------MQLKSIKLSGFKSFV-DPTHFEMPG-----QLIGVVGPNGCGKSNI
D5CRW3_SIDLE          --------------MRLAHIKLAGFKSFV-DPTHIALPG-----QLVGIVGPNGCGKSNV
D9SGR3_GALCS          --------------MRLSQIKLAGFKSFV-DPTTIDLPG-----QIVGVVGPNGCGKSNV
Q2YBB9_NITMU          --------------MRLSHIKLAGFKSFV-DPTEIPFPG-----DLVGVVGPNGCGKSNV
Q0AE88_NITEC          ----------MPSKLRLTEIKLAGFKTFV-DPTVVPVPG-----NLVGIVGPNGCGKSNV
D7DI79_METV0          --------------MRLTHLKLAGFKSFV-DPTTLHIHG-----QRVGVVGPNGCGKSNV
C1D4R7_LARHH          --------------MRLTHIKLAGFKSFV-DPTAIPVPG-----QLVAVCGPNGCGKSNV
Q7NR76_CHRVO          --------------MRLTHIKLAGFKSFV-DPTSIAVPG-----QLVAVIGPNGCGKSNV
A1KSF4_NEIMF          --------------MRLTHIKLSGFKSFT-DPTTIHVPG-----QLVAVIGPNGCGKSNV
A1WY82_HALHL          --------------MHLKRIKLAGFKSFV-DPTSVPLPG-----RMVAVVGPNGCGKSNI
Q0AAV4_ALKEH          --------------MRLKKIKLSGFKSFV-DPTQVAMPG-----DLVAVVGPNGCGKSNI
SMC_XANOR             --------------MRLSTIKLSGFKSFV-DPTTLHLPT-----NMTGIVGPNGCGKSNI
B8GTL2_THISH          --------------MRLSKIKLAGFKSFV-DPTTIDLPS-----NLVGIVGPNGCGKSNT
Q3JAH9_NITOC          --------------MRLKKIKLVGFKSFV-DPTSLPLPS-----NRMAIVGPNGCGKSNI
D3RSW0_ALLVD          --------------MRLERIKLAGFKSFV-DPTTVHFPS-----NLVGIVGPNGCGKSNV
B3PGR0_CELJU          --------------MRLKCIKLAGFKSFV-DPTTVNFPS-----NLCAVVGPNGCGKSNI
A6V7X5_PSEA7          --------------MRLKSIKLAGFKSFV-DPTTVNFPS-----NMAAVVGPNGCGKSNI
Q0VR03_ALCBS          --------------MRLKSIKLAGFKSFV-DPTTTYFPE-----NLTAVVGPNGCGKSNI
C7RBE2_KANKD          --------------MRLKQIKLAGFKSFV-DPTTVSLPS-----NLTAIVGPNGCGKSNL
Q2SD45_HAHCH          --------------MRLKSIKLAGFKSFV-DPTTVHFPS-----NMAAVVGPNGCGKSNI
E4PL89_MARAH          --------------MRLKSIKLSGFKSFV-DPTTVPFPS-----NMTAVVGPNGCGKSNI
E1V8E9_HALED          --------------MRLTSIRLAGFKSFV-DPISVPFDG-----NMTAIVGPNGCGKSNI
D3SAL9_THISK          --------------MRLARIKLAGFKSFV-DPTTLVLPG-----NRVGIVGPNGCGKSNT
SMC_METCA             --------------MRLEKLKIAGFKSFV-DPTTLPLPG-----NLVGVVGPNGCGKSNV
SMC_COXBU             --------------MYLKTIKLAGFKSFV-DPTLIPIRG-----SMNAIVGPNGCGKSNV
Q5WTI1_LEGPL          --------------MHLKQLKLAGFKSFV-DPTTVHFPS-----RLVAVVGPNGCGKSNI
Q12L80_SHEDO          --------------MRLKQIKLAGFKSFV-DVTKIPFEQ-----QLSAIIGPNGCGKSNI
Q080K7_SHEFN          --------------MRLKQIKLAGFKSFV-DPTKIPFDN-----ALSAIIGPNGCGKSNV
A4Y804_SHEPC          --------------MRLKQIKLAGFKSFV-DSTKIPFLQ-----ALTAIIGPNGCGKSNV
D4ZIY3_SHEVD          --------------MRLKQIKLAGFKSFV-DSTKIPFLN-----PLSAIIGPNGCGKSNI
B0TKB4_SHEHH          --------------MRLKQIKLAGFKSFV-DPTKIPLLS-----PLSAIIGPNGCGKSNV
A3QFJ7_SHELP          --------------MRLTQIKLAGFKSFV-DVTKIPFNQ-----PLTAIIGPNGCGKSNV
A1S5R5_SHEAM          --------------MRLKQIKLAGFKSFV-DPTRIPFPN-----PLTAIIGPNGCGKSNV
Q5QUJ9_IDILO          --------------MRLKHIKLVGFKSFV-DPTKVPFPD-----QMTCVVGPNGCGKSNV
E1SMV2_FERBD          --------------MRLKQIKLAGFKSFV-DPTKVPFPD-----QMTAIVGPNGCGKSNV
F2GBA5_ALTMD          --------------MRLKKIKLAGFKSFV-EPTTIPFPG-----EMTAIVGPNGCGKSNV
Q15UZ3_PSEA6          --------------MRLKKIKLAGFKSFV-DPTSIPFVD-----DMTAIVGPNGCGKSNV
Q3IKC0_PSET1          --------------MRLSTIKLAGFKSFV-EPTKIPFPD-----QMTCVVGPNGCGKSNV
A4SKA4_AERS4          --------------MRLKLIKLAGFKSFV-EPTRIEFSA-----DMTAVVGPNGCGKSNV
D0KWM8_HALNC          --------------MRLTRLYLAGFKSFA-APTEILLPA-----ERVAIVGPNGCGKSNL
A0A2W1K6W8_ACIFR      --------------MRLSAIILQGFKSFR-ESTRIQFDA-----NPVVIIGPNGCGKSNT
A0A0J1A050_ACIBA      --------------MRLSSLKLSGFKSFA-DSTTLNFKA-----NRTAVVGPNGCGKSNV
B3E294_GEOLS          --------------MKIKRLEIAGFKSFA-DKVVLDFQQ-----GVTGVVGPNGCGKSNI
A1AU91_PELPD          --------------MKIKRLEICGFKSFA-DRVVLDFQQ-----GVTGVVGPNGCGKSNI
B9M6F0_GEODF          --------------MKIKRVDIIGFKSFH-DKVSLDFQQ-----CITGIVGPNGCGKSNV
Q39WG2_GEOMG          --------------MKIKRLDISGFKSFV-DKVSLDFQQ-----GITSIVGPNGCGKSNV
B5EFS9_GEOBB          --------------MKIKRLEIHGFKSFQ-DKAVLDFNQ-----PITGVVGPNGCGKSNV
Q3A212_PELCD          --------------MQIKRIEIVGFKSFV-DRVALDFGP-----GIAAVVGPNGCGKSNV
A9FIZ2_SORC5          --------------MRIRKLEISGFKSFV-DRTVVHFDT-----DVVGIVGPNGCGKSNI
D0LY52_HALO1          --------------MRIKRIEIIGFKSFC-DRTVLNISS-----PVTSVVGPNGCGKSNI
Q1D2R5_MYXXD          --------------MRIKRLDITGFKSFM-ERSVFTFDE-----GVTGIVGPNGCGKSNV
B4UDF6_ANASK          --------------MRIRRLDIVGFKSFM-DKTVIAFDD-----GVTGVVGPNGCGKSNV
Q6MNS9_BDEBA          --------------MRIKKIELIGFKSFK-DRTVIHFDA-----GITGIVGPNGCGKSNI
A9A0M3_DESOH          --------------MRLKRLEINGFKSFP-EKATISFPP-----GIFSIVGPNGCGKSNI
B8FHS3_DESAL          --------------MKLKQLELCGFKSFP-DKTTIPFPG-----GVSAVVGPNGCGKSNI
E1QL74_DESB2          --------------MKVKRLEISGFKSFA-QRAVLDFPD-----GLCAVVGPNGCGKSNV
B3EFQ6_CHLL2          --------------MYLSKIEILGFKSFA-HRVRISFDK-----GLTAIVGPNGCGKTNV
A1BDT4_CHLPD          --------------MYLSKIELFGFKSFA-HRVTIKFDK-----GLTAIVGPNGCGKTNV
A4SG64_CHLPM          --------------MYLSKIELFGFKSFA-NRVRISFDK-----GLTAIVGPNGCGKTNV
SMC_CHLTE             --------------MYLSKIELFGFKSFA-HRVRIHFDK-----GLTAIVGPNGCGKTNV
Q3ATI3_CHLCH          --------------MYLAKIELLGFKSFA-QKVRIRFDK-----GLTAIVGPNGCGKTNV
B4S519_PROA2          --------------MYLSKIELFGFKSFA-HRITIRFDK-----GLTAIVGPNGCGKTNV
B3EM83_CHLPB          --------------MYLSKIELFGFKSFA-HKVKITFDK-----GLTAIVGPNGCGKTNV
B3QRZ4_CHLT3          --------------MYLSKLELFGFKSFA-QRVQVKFDS-----GLTAIVGPNGCGKTNI
D0MFL5_RHOM4          --------------MYLSKLELQGFKSFA-DRTVLHFDP-----GITAIVGPNGCGKSNL
Q2S457_SALRD          --------------MYLSKLELQGFKSFA-DETTLTFDP-----GVTTIVGPNGCGKSNI
C7PLU2_CHIPD          --------------MRLKTLEIKGFKSFA-DKTVLHFDE-----GVTGVIGPNGCGKSNI
E4TVF1_MARTH          --------------MQLTKLEIKGFKSFG-DRMVINFDK-----GITGIVGPNGCGKSNV
B2KBE7_ELUMP          --------------MYLKAIEIIGFKSFA-DRQRLDFEK-----GITCVVGPNGCGKSNV
B1H0P2_ENDTX          --------------MHLKKVEVCGFKSFA-DRTVLDFEP-----GISGIVGPNGCGKSNI
E4TEW8_CALNY          --------------MKFKKLIIQGFKSFV-DKTVIDFPD-----GITCIVGPNGSGKSNI
D3PDY1_DEFDS          --------------MKFRKLILQGFKSFV-DKTVIEFPD-----GITCIVGPNGSGKSNI
D4H2V6_DENA2          --------------MKFKSLVVQGFKSFV-DKTVIEFPG-----GITCVIGPNGSGKSNI
D6YSC9_WADCW          -------MHFRRSFLFLKKIKILGFKSFA-DSTVLEFHP-----GITAIVGPNGCGKSNI
Q04TU9_LEPBJ          --------------MYLKSLNIVGFKTFA-DETEILLDP-----GFTAVVGPNGSGKSNI
E1R6H6_SEDSS          --------------MFLKSIQIFGFKSFA-DRSVIEFRD-----GISALLGPNGCGKSNV
Q73ML2_TREDE          --------------MFLKNLEIFGFKSFP-DRVKIEFAD-----GITALLGPNGCGKSNV
A0A0H3BKB7_TREPS      -------------MLFLKTLEVFGFKSFA-DRVRVEFAD-----GVTALLGPNGCGKSNV
E0RSK7_SPITD          --------------MILKAVELFGFKSFG-EKTRIEFRE-----GVTAIVGPNGCGKSNI
D5EMY0_CORAD          --------------MYLKEIVISGFKSFA-DRTRLDLRR-----GVTAVVGPNGCGKSNI
B1ZZB8_OPITP          --------------MYLKALKLHGFKSFA-DPTMLRFEP-----GVTAVVGPNGCGKSNI
SMC_DESHY             ------MAKADTLPVFLKSITIQGFKSFA-DKVKLELGQ-----GLSVVVGPNGSGKSNV
A4J682_DESRM          --------------MVLKRMDIQGFKSFG-DRVKLELHS-----GLSVVVGPNGSGKSNI
Q67PF3_SYMTH          --------------MYLKRLEILGFKSFA-EKTELEFTP-----GITAVVGPNGSGKSNV
B0TGW8_HELMI          --------------MVLKRIELNGFKSFA-DKTEILLSP-----GLTVVVGPNGSGKSNV
Q2RJX0_MOOTA          --------------MFLKGIEIQGFKTFV-DRVRLELGP-----GVTGIVGPNGSGKSNI
SMC_BACSU             --------------MFLKRLDVIGFKSFA-ERISVDFVK-----GVTAVVGPNGSGKSNI
C5D8T7_GEOSW          --------------MFLKRLDIIGFKSFA-DRVSIEFVP-----GVTAVVGPNGSGKSNI
D5DQR5_BACMQ          --------------MFLKRLDIAGFKSFA-EKVSIDFVP-----GVTAVVGPNGSGKSNI
B7IUK7_BACC2          --------------MFLKRLEIAGFKSFA-ERVSVDFVP-----GVTSVVGPNGSGKSNI
Q9KA07_BACHD          --------------MFLKRLEIVGFKSFA-EQMTVEFVK-----GVTAVVGPNGSGKSNI
Q5WFM8_BACSK          --------------MFLKRLEVKGFKSFA-EPILVDFVP-----GVTAVVGPNGSGKSNI
Q7ZAM6_OCEIH          --------------MYLKRLESKGFKSFA-ERIGVDFVS-----GVTAVVGPNGSGKSNI
D6XTT7_BACIE          --------------MFLKRLELTGFKSFA-EKLGIDFVP-----GVTAVVGPNGSGKSNI
Q81ZN4_ENTFL          --------------MYLKRIEITGFKSFA-DKTIIEFED-----DVTAVVGPNGSGKSNI
A0A0E0UX46_LISMM      --------------MLLKRLEMNGFKSFA-DKVAIDFVP-----GMTAVVGPNGSGKSNI
B1HQH6_LYSSC          --------------MFLKRLEVIGFKSFA-ERIGIDFVP-----GVTAVVGPNGSGKSNV
C6D303_PAESJ          --------------MFLKRIELSGFKSFA-DKTEMEFVT-----GITAVVGPNGSGKSNI
C0ZFN9_BREBN          --------------MYLKRLELAGFKSFA-DRTELEFVP-----GVTAVVGPNGSGKSNV
C8WWA4_ALIAD          --------------MYLKQIDILGFKSFA-DKTQIVLSP-----GITAIVGPNGSGKSNI
D5WPA2_KYRT2          --------------MHIKRLEISGFKSFA-DRTEIELPP-----GITAVVGPNGSGKSNI
C4L5Z7_EXISA          --------------MHLKRIELAGFKSFA-KRIELDFRP-----GVTAVVGPNGSGKSNI
B1YIN0_EXIS2          --------------MYLKRIEINGFKSFA-SRTELDFLP-----GVTAVVGPNGSGKSNI
D3R1B0_MAGIU          --------------MHLKSIELQGFKSFP-ERTVIEFHT-----GMTAIVGPNGSGKSNV
D2RLB2_ACIFV          --------------MRLKSFSAHGFKSFA-DKVNIDFEP-----GITAIVGPNGSGKSNI
D1BLY1_VEIPT          --------------MQLLRLELKGFKSFA-DKTIVKFSP-----GMTAVIGPNGSGKSNI
A5UQ60_ROSS1          --------------MYLRRLEIQGFKTFA-GHTLFEFQP-----GITAVVGPNGSGKSNL
B8G556_CHLAD          --------------MYLKRLEIQGFKTFA-SRTVFEFQP-----GIIAVVGPNGSGKSNL
A9B100_HERA2          --------------MYLKRLEIQGFKTFA-NRTVIEFPL-----GVTAIVGPNGSGKSNV
D1C6T1_SPHTD          ------------MPTRLKRLELHGFKSFA-TPTTFVFDP-----GITAIIGPNGSGKSNI
D7CMX2_SYNLT          --------------MYLKRLELKGFKSFA-ERTEIEFMP-----GVNVIVGPNGCGKSNI
Q0AYV7_SYNWW          --------------MYLKRLDIKGFKSFA-DNTELQLNP-----GLNIVVGPNGCGKSNI
SMC_LACPL             --------------MQLKSLEISGFKSFA-DKTKIDFQA-----GMTGIVGPNGSGKSNI
Q03RT7_LACBA          --------------MRLKTLEISGFKSFA-DKTRIDFLP-----GMTGIVGPNGSGKSNI
B2GD41_LACF3          --------------MRLLSLEIEGFKSFA-DKTVIDFRP-----GMTGIIGPNGSGKSNI
A5VKP1_LACRD          --------------MQLLSLTLDGFKSFA-QKTTIKFEP-----GMTGIVGPNGSGKSNI
Q03FW9_PEDPA          --------------MKLRTIEISGFKSFA-DNTKIEFKD-----GITGIVGPNGSGKSNI
A0A249N2C3_LACRH      --------------MELKRLIINGFKSFA-DKTEIDFVS-----GLTGIVGPNGSGKSNI
Q38XR7_LACSS          --------------MQLKSLVLSGFKSFA-DKTEINFSD-----GLTGIVGPNGSGKSNI
Q1WU99_LACS1          --------------MKIKSLTLNGFKSFA-NKTIINFQD-----GLTGIVGPNGSGKSNI
Q04GL1_OENOB          --------------MKLKSLEINGFKSFA-DKTVIDFMP-----GMTGIVGPNGSGKSNI
Q03VW6_LEUMM          --------------MKLKSLEISGFKSFA-DKTMIELMP-----GMTGIIGPNGSGKSNI
A0A0U5K8Z4_LACDE      --------------MPLTSLILEGFKSFA-DKTVIDFTK-----GITGIVGPNGSGKSNI
E4SKB3_LACAR          --------------MPLTELVLDGFKSFA-EKTTIHFND-----GITGIVGPNGSGKSNI
Q74IP9_LACJO          --------------MPLQQLVLNGFKSFA-DKTTIRFNN-----GITGIVGPNGSGKSNI
A0A0T8KIP4_STREE      --------------MYLKEIEIQGFKSFA-DKTKVVFDQ-----GVTAVVGPNGSGKSNI
A4VVL7_STRSY          --------------MYLKSIEMQGFKSFA-DKTKVVFDR-----GVTAVVGPNGSGKSNI
C0MCR5_STRS7          --------------MFLKEIQMQGFKSFA-DKTRIIFDK-----GVTAVVGPNGSGKSNV
A2RLZ7_LACLM          --------------MYLKKMEIVGFKSFA-DKTKVEFDK-----GITAVVGPNGSGKSNI
B9EBB4_MACCJ          -------------MIYLQSVEATGFKSFA-DKTTVLFDE-----GVTAIVGPNGSGKSNI
SMC_MYCHR             -------------MLKLIKIEIEGFKSFA-DPISINFDG-----SVVGIVGPNGSGKSNI
E0TKT8_MYCHH          -------------MLKLIKIEIEGFKSFA-DPISINFDG-----SVVGIVGPNGSGKSNI
Q4A770_MYCH7          --------------MKLIKIEIEGFKSFA-EPVSIKFDG-----SIVGIIGPNGSGKSNI
C5J708_MYCCR          --------------MKLIKIEIEGFKSFA-DPVSIAFDG-----SVVGIVGPNGSGKSNI
A5IYM7_MYCAP          --------------MKLIKVEAHGFKSFA-EPITLHFNG-----GVAGIVGPNGSGKSNI
D5E4P4_MYCCM          --------------MKLIKIEAHGFKSFA-DPVVLHFDG-----GVTGIVGPNGSGKSNI
Q6KHN4_MYCMO          --------------MKLIKIEAKGFKSFA-DGITLNFDG-----GIVGIVGPNGSGKSNI
Q98PK8_MYCPU          --------------MKLIKIQAHGFKSFA-EPIQLSFDG-----GVAGIIGPNGSGKSNI
D1J8Q8_MYCHP          --------------MKLIQVEAHGFKSFA-DKVTLKFDG-----GIVAIIGPNGSGKSNI
Q4A588_MYCS5          --------------MKLIKIEAHGFKSFA-DPISLKFDG-----GVIAIIGPNGSGKSNI
SMC_MYCGE             -------------MVFLKRFRAYGFKSYA-DEITIDFTH-----SMTGIVGPNGSGKSNV
SMC_MYCPN             -------------MVFLKRFRAYGFKSYA-DEITINFTH-----SMTGIVGPNGSGKSNV
Q7NBU0_MYCGA          -------------MLFLKKFHAQGFKSYA-DNISFTFDE-----HVTGIVGPNGSGKSNV
Q8EVS6_MYCPE          -------------MIFLKKFEAIGFKSFA-DFTKLNFDS-----TMIGIVGPNGAGKSNV
Q9PR04_UREPA          -------------MIFLKKIEAHGFKSFG-EPVVIEFKH-----PMTGIIGANGTGKSNI
Q6F1N4_MESFL          -------------MLFLKQIRAVGFKSFA-EPTTLNFTK-----EMIGVVGPNGSGKSNI
Q6MTD2_MYCMS          -------------MLFLKQIRASGFKSFA-DLTVMDFNY-----DMTGVVGPNGSGKSNI
E3GP81_9FIRM          --------------MYLKKLALAGFKSFA-EPVELEFSK-----GVSAIVGPNGSGKSNI
SMC_HALOH             --------------MFLKKLELKGFKSFA-KPITINFES-----PITAIVGPNGSGKSNI
E4RL35_HALHG          -----------MVNIFLTKIRLKGFKSFA-NKTDIELEE-----NITAVVGPNGSGKSNI
D9QRN7_ACEAZ          --------------MHLKKIEMHGFKSFA-EEVKVEFEP-----NITAVLGPNGSGKSNI
A8MHB7_ALKOO          --------------MQLKKLEIQGFKSFA-NKIEINFES-----GITGVVGPNGSGKSNI
A6TRT3_ALKMQ          --------------MYLKRLEIQGFKSFA-NKIEMNFEQ-----GFTAVVGPNGSGKSNI
A3DDY2_HUNT2          --------------MHLKRLEIQGFKSFA-DRIQLEFNS-----GITAVVGPNGSGKSNI
D5X8N2_THEPJ          --------------MYLKRLEIQGFKSLA-DRTELYFNP-----GITAVVGPNGSGKSNI
D9R048_CLOSW          --------------MYLKSIEIQGFKSFA-NKIVFEFHN-----GITGIVGPNGSGKSNV
C4Z0E6_EUBE2          --------------MYLKSIEVQGFKSFA-NKIVFDFHN-----GITGIVGPNGSGKSNV
C4Z924_AGARV          --------------MYLKSLEVQGFKSFA-NKIVFEFHN-----GITGIVGPNGSGKSNV
E0RV40_BUTPB          --------------MYLKSIEIHGFKSFA-NKIKFDFHN-----GITGIVGPNGSGKSNV
A9KLR0_LACP7          --------------MYLKSIEVHGFKSFA-NKITFQFKN-----GITGIVGPNGSGKSNV
D9S347_THEOJ          --------------MYLKRVELQGFKSFA-DRIEIEFQP-----GINAIVGPNGSGKSNI
B2A2N3_NATTJ          ---------------MLKKLELVGFKSFP-EKTTFELSD-----GITAVVGPNGCGKSNI
A8F8R1_PSELT          --------------MKLVSMALSGFKSFA-RPTKLFFAD-----GITAIIGPNGGGKSNI
A5IN04_THEP1          --------------MRLKKLYLKGFKSFG-RPSLIGFSD-----RVTAIVGPNGSGKSNI
C5CIS4_KOSOT          --------------MRLVSIFIKGFKSFA-YPTKIDISK-----GITAIVGPNGSGKSNI
A7HMD4_FERNB          --------------MILKEIFIKGFKSFA-EPVRLEISN-----RVTAIVGPNGSGKSNV
B7IHN5_THEAB          ------------MSIKLKEIYINGFKSFG-RPVKIPISP-----RITAIVGPNGSGKSNI
SMC_THEEB             --------------MYIKRLELTNFKSFG-GTTVIPLLP-----GFTVISGPNGSGKSNL
Q2JHS4_SYNJB          --------------MYIKRIELTRFKSFG-STTSLPLLP-----GFTVISGPNGSGKSNI
SMC_SYNP6             -------------MVYIKQIELSHFKSFG-GTTSLPLLP-----EFTVVTGPNGSGKSNI
B0C9C4_ACAM1          --------------MYVKQLELSHFKSFG-STTAIPLLP-----GFTVVSGPNGSGKSNL
Q115J3_TRIEI          -------------MVHIKCLELTNFKSFG-GTTTIPLLP-----GFTVVSGPNGSGKSNI
B2J925_NOSP7          -------------MVHIKRVELTNFKSFG-GTTSVPLLP-----GCTVISGPNGSGKSNI
E0UKI1_GLOV7          -------------MVHIKRVELSHFKSFG-GTTSIPFLP-----GFTVISGPNGSGKSNI
B7K4Q6_RIPO1          -------------MVHIKRIELSHFKSFG-GTTSIPFLT-----GFTVVSGPNGSGKSNI
B0JSN6_MICAN          -------------MVYIKKVELSHFKSFG-GTTPIPFLP-----GFTVVSGPNGSGKSNI
SMC_SYNY3             -------------MVYVKRIELSHFKSFG-GTTAIPFLP-----GFTVVSGPNGSGKSNI
Q84EC7_SYNP2          -------------MVHIKQIELSHFKSFG-GTVAVPLRP-----GFTVVSGPNGSGKSNI
D3EQ04_ATETH          -------------MVHIKRIELSHFKSFG-GTTSIPFLP-----GFTVVSGPNGSGKSNI
SMC_GLOVI             --------------MHLKCLEIERFKSFG-PYTRIPLLE-----GFTVVSGPNGSGKSNI
A5GQT1_SYNR3          -------------MVFIDQVSLTHFKSFG-GSVTIPLEP-----GFTVVTGPNGSGKSNI
A9B9B9_PROM4          -----MNSIALVLLVYINQVELTNFKSFG-GSMTIPLEE-----GFTVVTGPNGSGKSNI
A2BNJ6_PROMS          -----------MRLVHINQVEFENFKSFG-GNVKIPLEE-----GFTVVTGPNGSGKSNI
Q46EX0_METBF          --------------MYIKEIEFVNFKSFG-KKVKIPFYN-----DFTTISGPNGSGKSNI
D7EAF5_METEZ          --------------MYIKEIEFLNFKSFG-KKVKIPFFD-----DFTTISGPNGSGKSNI
D1YW78_METPS          --------------MHIKEIELNNFKSFG-RKAKIPFFD-----DFTTISGPNGSGKSNV
A0B8B9_METTP          --------------MHIKEIELRNFKSFG-RRALVQLKK-----DFIVVTGPNGSGKSNI
D4GT30_HALVD          --------------MHIKELVLDGFKSFG-RPTRIPFYE-----DFTVVTGPNGSGKSNI
A7IAD8_METB6          --------------MHITELEIDNFKSFS-KKTKIPFLE-----GFTVISGPNGSGKSNI
A3CWK7_METMJ          --------------MYITQLEIDNFKSFA-RKTKIPFFE-----GFTVVSGPNGSGKSNI
B8GG37_METPE          --------------MFIKELEIDNFKSFG-RKTTIPFFE-----GFTVVSGPNGSGKSNI
E1RII6_METP4          --------------MYITELEIDNFKSFA-KKTKIPFYE-----GFTVISGPNGSGKSNI
Q2FLH3_METHJ          --------------MHITQLEIDNFKSFG-RKTKIPFLP-----GFTVISGPNGSGKSNI
A2SS75_METLZ          --------------MHIVQVDIDNFKSFS-RKTKIPFYE-----GFTVISGPNGSGKSNI
D3RYW2_FERPA          --------------MHIEKIELKNFKSFS-RKTEIPFVK-----GFNVISGPNGSGKSNI
O28714_ARCFU          --------------MHIEKIRLKNFKSFG-KKAEIPFFK-----GFTVITGPNGSGKSNI
D2RFP2_ARCPA          --------------MFIRKIKLRNFKSF--KKAEIEFRD-----NFTVITGPNGSGKSNI
SMC_THEAC             ------------MSSYIERIEAHNFKSFR-RKKVINFTK-----GLNVISGPNGSGKSNI
Q97AI9_THEVO          ------------MSSYIERIEAYNFKSFR-KKKTIYFSR-----GLNVISGPNGSGKSNI
SMC_METVO             -------------MISISEIHLKNFKSF--KNTKLKIPD-----GFTAILGPNGSGKSNT
A6UQ42_METVS          -------------MASLSEIHMKNFKSF--KNAKLKIQN-----GFTAILGPNGSGKSNT
A6UVP1_META3          -------------MTNLSEIHLKNFKSF--KNVKLKIPS-----GFTAILGPNGSGKSNI
SMC_METJA             -------------MVTLEKIELKNFKSF--KKLSLDIPK-----GFTAIVGPNGSGKSNI
C9RFQ3_METVM          -------------MTTLEKIELKNFKSF--KKLSLDIPK-----GFTAIVGPNGSGKSNI
D5VT24_METIM          ---------------MLKRIELKNFKSF--KSLSLEIPK-----GFTAIVGPNGSGKSNI
D3SQ87_THEAH          ---------MKETKGYIEKIVVEGFKSYGMNRLEIPLGE-----GFTAIVGPNGSGKSNI
D3DG53_HYDTT          ------------MGAWIEKIVVEGFKSYGKGRVEIPLGP-----GFVGIVGPNGAGKSNI
SMC_AQUAE             ----------MEKRAYIEKIVVEGFKSYGTKRKEIPLGE-----GFIAVVGPNGAGKSNI
B4U7R1_HYDS0          -----------MENAYIEKIVVTNFKSYGTEKLEIPIGE-----GFIGIVGPNGAGKSNI
C0QSN8_PERMH          -----------MSKAYIDRIHVYGFKSYGLRKLTIPVGN-----GFVGIVGPNGSGKSNI
B2V736_SULSY          ------------METYIDRINVYGFKSYGDRHLTIPLGP-----GFTAIVGPNGAGKSNI
SMC_PYRFU             -------------MPYIEKLELKGFKSYGNKKVVIPFSK-----GFTAIVGANGSGKSNI
C5A612_THEGJ          -------------MPYIEKIEMKGFKSYGNRKVVVPLSK-----GFTAIVGANGSGKSNI
D1CC09_THET1          --------------MKINSLKIQGFKSFS-NHTLLEFDH-----GITAIVGPNGSGKSNI
D3TAQ9_ACIB4          --------MPEGDGMYLKAIELENFKSFG-RKTRLEFKE-----GFTAISGPNGSGKSNI
SMC_HALMS             --------------MKLKRLVIQGFKSFK-DRTTIHFDD-----GITGIVGPNGCGKSNI
Q6L0R1_PICTO          --------------MFIESIEIDNFKSYG-KKTKIYFKP-----GFTVIIGPNGSGKSNI
C1A7M6_GEMAT          --------------MRLTKLEVHGFKAFA-DHLEFVFEK-----GVTAIVGPNGSGKSNV
C9RN51_FIBSS          --------------MQITKLKIFGFKSFA-QRTEINFPTK----GLTAVVGPNGCGKSNI
D1B5Z0_THEAS          --------------MYIGRIGLNGFKSFG-GVHELPLEM-----GMVAIVGPNGSGKSNI
                                              **:                     : * ** **:* 

SMC_FUSNN             LDAVLWVLGEQSY-KNIRAKESQDVIFSGGKE------KKPATKAEVSLIIDNADRY---
E3H7H1_ILYPC          LDAILWVLGEQSY-KNIRAKESRDVIFSGGKN------KKPKSLAEVSLYIDNSDRV---
D1AK68_SEBTE          LDAILWVLGEQSY-KSIRAKDSSDVIFSGGKN------RKAKSVAEVSLIIDNSDRY---
SMC_CLOK1             SDAVRWVLGEQSV-KTLRGGKMEDVIFAGTQF------RKPLGLCQVSLTLDNEDKK---
D8GS00_CLOLD          SDAIKWVLGEQSV-KSLRGGKMEDVIFAGTQY------RKPVGLCQVSLTLNNEDKK---
Q97IA1_CLOAB          SDAVLWVLGEQSV-KNLRGGKMEDVIFAGTQY------RKSVGLAQVSLILDNSDKQ---
A0Q0Y7_CLONN          LDAVKWVLGEQSV-KNLRGGKMQDVIFSGTEY------RKPVGLSQVTLVLDNSDEE---
Q895M7_CLOTE          SDAIRWVLGEQSI-KNLRGGKMEDVIFAGTQF------RKPVGLAKVSLTLDNSKSE---
Q0SSA4_CLOPS          SDSVRWVLGEQSA-KTLRGAKMEDVIFTGTEY------RKPIGYAQVSLTLDNSSGE---
A6LSM4_CLOB8          SDAVRWVLGEQSV-KVLRGGKMEDVIFAGTQF------RKPVGLAQVSLTLDNSDEK---
D9SLC7_CLOC7          SDAIRWVLGEQSV-KNLRGGKMEDVIFAGTAY------RKPVGLAQVALILDNSDHG---
D7APA8_THEM3          SDAIRLVLGEQSI-KSLRGSKLEDVIFAGSEN------RKPLGFCEINLTLDNSDGY---
Q8R9W7_CALS4          SDAIRLVLGEQSI-KSLRGSKLEDVIFAGSET------RKPLGFCEINLTLDNSDGL---
D9TN88_THETC          SDAVRLVLGEQSI-KSLRGNKLEDVIFVGTDK------RKPLSFAEVNLTLDNSDHT---
C9YKI7_CLODR          SDAVRWVLGEQSI-KSLRGDKLEDVIFAGTDT------KKPMNYCEVALTIDNSENQ---
E3PS49_ACESD          LDAIRWVLGEQSM-KSLRGDKLEDVIFSGTEK------RKEMNYCEVSMLIDNQDKM---
B0S1M4_FINM2          SDAILWVLGEQSA-KNLRGNKMQDVIFAGTQK------EKAVNFAQVSITFEN-DLW---
Q3AC59_CARHZ          AEAIRWALGETKT-KILRSERQQDVIFTGSQG------RKPVGMAEVTLILDNSNKH---
E4SF58_CALK2          TDAIRWALGEQSL-KLLRAAKQEDLIFAGTEK------RKSQGFAEVSICFDNSSGV---
SMC_RHOBA             VDAMKWVLGSQSA-KSLRGKDMSDVIFKGS-QT-----RGPAGAAEATIIFDNT------
D2QWB0_PIRSD          VDGIKWVLGEQSA-KSLRGKDMADVIFKGSGSG-----RKAAQAAEATLVFDNS------
D5SU17_PLAL2          VDALKWILGDQSA-KSLRGKEMTDVIFNGS-AG-----RKPNAYAEATLTFDNS------
SMC_KORVE             ADAISWVLGEQSA-KSLRGIHMQDVIFAGT-RD-----RKPTGMAEVSLTLIDPEQYEGK
C1F1T5_ACIC5          LDGVTWVLGEQSA-KTLRGGKMEDVIFAGT-RS-----RKPLGMAEVSITLIDPEAYQGP
Q01Y77_SOLUE          SDAISWVLGEQSA-KSLRGARMEDVIFAGT-RD-----RKPLGMAYVTMTLVDPDLYN--
SMC_MYCPA             VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSS------RAPLGRAEVTVTIDNSDNA---
SMC_MYCTU             VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSS------RAPLGRAEVTVSIDNSDNA---
SMC_MYCLE             VDALAWVMGEQGA-KTLRGSKMEDVIFAGTLS------RAPLGRAEVTLIIDNSDNV---
A4FMG9_SACEN          LDALRWVMGEQGA-KDLRGGKMEDVIFAGTAG------RAPLGRAEVTLTIDNSDGA---
C8XH72_NAKMY          VDAIAWVLGEQGA-KALRGGKMEDVIFAGTAD------RPPLGRAEVTLTIDNSDGA---
D7GEI0_PROFC          VDALAWVMGEQGA-KHLRGGKMDDVIFAGTAG------RPPLGRAEVTLTIDNTDGV---
Q2J6Z3_FRACC          VDAIAWVLGEQGA-KALRGGTMSDVIFAGTPA------RPALGRAEVLLTIDNSDGA---
A8L599_FRASN          VDAIAWVLGEQGA-KALRGGTMSDVIFAGTPS------RPALGRAEVLLTIDNTDGA---
C9Z3S1_STRSW          VDALSWVMGEQGA-KSLRGGKMEDVIFAGTTG------RPPLGRAEVSLTIDNSDGA---
D7CC86_STRBB          VDALSWVMGEQGA-KSLRGGKMEDVIFAGTTG------RPPLGRAEVSLTIDNSDGA---
B1VYX5_STRGG          VDALSWVMGEQGA-KSLRGGKMEDVIFAGTTG------RPPLGRAEVSLTIDNSDGA---
E4NHH3_KITSK          VDALSWVMGEQGA-KSLRGGKMEDVIFAGTSG------RPPLGRAEVSLTIDNTDGA---
C7QGY1_CATAD          VDALAWVMGEQGA-KSLRGGKMEDVIFAGTTG------RAPLGRAEVALTIDNSDGA---
A0LV82_ACIC1          VDALAWVMGEQGA-KSLRGGKMEDVIFAGTAS------RPPLGRAEVVVTIDNSDGA---
A0JXV4_ARTS2          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSG------RPPLGRAHVSLTIDNTDGA---
A1R7H8_PAEAT          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSG------RPPLGRAHVALTIDNADNA---
A6W7T9_KINRD          VDALTWVMGEHSA-KSLRGGKMEDVIFAGTTGPEG---RSALGRAEVSLTIDNTDGA---
D1BJA3_SANKS          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSG------RPPLGRAEVSLTIDNSDGA---
C7NGM6_KYTSD          VDALAWVMGEQGA-KSLRGGKMEDVIFAGTSG------RAPLGRAEVAMTIDNTDGA---
B2GFM7_KOCRD          VDALAWVMGEQGA-KSLRGGKMEDVIFAGTSA------RSALGRAHVSLTIDNADGA---
E1VVN2_GLUAR          VDALSWVMGEQGA-KTLRGGKMEDVIFAGTSG------RAPLGRAHVSLTIDNTDGQ---
A5CQQ2_CLAM3          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTST------RGPLGRAEVTLTIDNADGA---
Q6AE90_LEIXX          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTET------RGPLGRAEVHLTIDNSDGA---
D1AB24_THECD          VDALAWVMGEQGA-KSLRGGKMEDVIFAGTAS------RPPLGRAEVILTIDNSDGA---
D6Y659_THEBD          VDALAWVMGEHSA-KSLRGGKMEDVIFAGTAS------RPPLGRAEVTLTIDNSDGA---
D7BMZ9_ARCHD          VDALAWVMGEQGA-KNLRGGNMADVIFAGTAS------RQALGRAEVSLTIDNSDGQ---
D6ZIF1_MOBCV          VDALAWVMGEQGA-KNLRGSQMSDVIFAGTKT------KAPLGRAEVQLTIDNSDGA---
C7R311_JONDD          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTSA------RPALGRAEVSLTIDNSDGR---
D6ZV06_BIFLJ          VDALTWVMGEQGA-KNLRGTSMEDVIFAGTSS------RPPLGRAQVSLTIDNSDHT---
Q7ZAJ9_COREF          VDALAWVMGEGSA-KTLRGGKMEDVIFAGAGD------RKPLGRAEVTLTIDNSDGA---
Q8NNW5_CORGL          VDALAWVMGEGSA-KTLRGGKMEDVIFAGAGD------RKPLGRAEVTLTIDNSDGA---
Q84F13_CORDP          VDALSWVMGEQGA-KNLRGGKMEDVIFAGAGD------RKPLGRAEVTLTIDNSDGA---
Q4JUZ1_CORJK          VDALAWVMGEQGA-KTLRGGKMEDVIFAGTGD------RKPLGRAEVTLTIDNSDGK---
C4LJD3_CORK4          VDALAWVMGEQGA-KSLRGGSMDDVIFAGTGA------RKPLGRAEVTLTIDNSDGA---
D6Z8M0_SEGRD          ADALSWVMGEQGA-KSLRGAKMDDVIFAGTSK------RPALGRAEVTLVIDNTDGA---
C8WGU5_EGGLE          SDAVLWVLGERNA-KHLRGQAMEDVIFAGSSA------RKSVGIAEVDLVLDNSDGT---
C7MMZ7_CRYCD          SDAVLWVLGERNA-KNLRGQAMEDVIFAGSAV------RKPVSVAEVELILDNTDGT---
C7N560_SLAHD          SDAVLWVLGERNP-KHLRGQAMEDVIFAGSSA------RKSVGVAEVELVLDNSDGT---
E1QVK5_OLSUV          SDAILWVLGEQSA-KMLRGQAMEDVIFSGSSG------RPAVGLAEVTLVLDNADHT---
C8W740_ATOPD          SDAILWVLGEQSA-KMLRGQAMEDVIFSGSSA------RGAVGVAEVTLVLDNSDHT---
SMC_RHOPA             VEALRWAMGETSH-KSLRATDMDAVIFAGSGN------RPARNHAEVVMSIDNSDRT---
A7IGT2_XANP2          VEALRWVMGESSY-KAMRANDMEDVIFSGTTG------RPARNSAEVVLSLDNSDRT---
B8EMM7_METSB          VEAMRWAMGESSS-KNMRASGMDDVIFSGGGN------RPARNMAEVVLYLDNSART---
B8IQU0_METNO          VEALRWVMGENSH-KSLRASGMDDVIFSGSGS------RPGRSHAEVTLSLDNSART---
Q92RE8_RHIME          VEALRWVMGENSY-KNMRASGMDDVIFSGSGN------RPARNTAEVGLYLDNSDRT---
A7HQY9_PARL1          LEAMRWVMGENSF-KNMRGSGMEDVIFAGTSG------RPARNHAEVVLYIDNGDRS---
D8JUP9_HYPDA          LEALRWVMGESSH-KSMRAAAMDDVIFSGSGG------RPERQSAEVTMFLDNSARR---
E3I0B2_RHOVT          LEALRWVMGETSY-KTMRASAMDDVIFAGTDK------RPARNMAEVMVAVDNTKRT---
SMC_RHOS1             LEALRWVMGENRP-TAMRGAGMEDVIFAGAAT------RPARNFAEVALVLDNADRL---
Q2W040_MAGSA          IEALRWVMGETSA-RQMRGGEMDDVIFGGTSG------RPARNVAEVMLGLDNTART---
D3P3X3_AZOS1          VEALRWVMGETSA-KRMRGDDMDDVIFGGTSS------RPARNLGEVTLAVDNRSRT---
B6IR58_RHOCS          VEALRWVMGETSA-KKMRGADMDDVIFGGTAT------RPARNICEVTLSLDNAGRT---
Q2RPA2_RHORT          VEALRWVMGETSA-KQLRGEDMDDVIFGGTAS------RPPRNVAEVTLLLDNREGG---
SMC_CAUVN             LEALRWVMGANSA-KAMRAGGMDDVIFAGSGA------RPARNHADVTLTIDNADRT---
B0T003_CAUSK          LEALRWVMGANSA-KAMRAGGMDDVIFAGSGN------RPARNHADVTLTIDNAERT---
Q0AMJ6_MARMM          LEALRWVMGATSA-KSLRGDGMEDVIFAGTDA------RPSRNFAEVVLSVDNADKL---
E0TC69_PARBH          LEALRWVMGATSA-KALRAGGMEDVIFAGSGTAERT-GRPPRQWAEVALQIGNETRT---
C6XRC2_HIRBI          LESLRWVMGATSA-RAMRGGEMDDLIFSGSSN------RPQRENAEVALILDNSARR---
Q0C0X5_HYPNA          LEALRWAMGANSA-KAMRGGEMDDLIFSGAAS------RPARETAEVTLVLDNSKRT---
Q1GQU3_SPHAL          LEAIRWVMGESSP-KSMRGGGMEDVIFAGTSS------RPARDFAEVALHCDTEGALVA-
D4YX43_SPHJU          LEAIRWVMGESSA-KSMRGGGMEDVIFAGTST------RPQRDFAEVSLLTVQEQGELF-
Q2G9S3_NOVAD          LEAIRWVMGESSP-KSMRGGGMEDVIFAGTAT------RPARAFAEVMLTAETDPS----
D5BSU5_PUNMI          VEGLRWVMGESSA-RQMRGGEMDDVIFAGTDQ------RPARNLAEITLKLDNSKRR---
A5FVJ2_ACICJ          VDALRWAMGEASA-KSLRGGEMEDVIFAGTMA------RAARNLAEVSITLTDTAGL---
C5B6I7_METEA          LEAIRWAMGEHRV-AEFRGSGMEDVIFAGTQR------RSERSICEVGIEHEDPARD---
Q937L3_DEIRD          VEAIRWATHGARA-RDLRAGRGSELIFHGSGG------KAPLGLAEVQLELR-TPAGE--
Q1J060_DEIGD          VEALRWATHQARA-RELRAGRGTELIFHGSGG------KAPLGLAEVQVELL-TAEG---
L0A7J5_DEIPD          VEAMRWATHGARA-RELRAGRASELVFHGSGG------KAPLGFAEVTLELRGLPTAA--
D7BH70_MEISD          VEALRWVV-GAKP-RELRGEEAQALLFHGSDA------RAPMPFAEVVLELS--RGSE--
SMC_THASP             IDAVRWVLGETRA-SALRGESMQDVIFNGSTT------RKPVSRASVELVFDNA------
A1K715_AZOSB          IDAVRWVLGETRA-SALRGESMQDVIFNGSTT------RKPVSRASVELVFDNN------
C7RKG8_ACCPU          MDAVRWVLGESKA-SELRGESMQDVIFNGSGS------RKPVSRAAVELVFDNS------
Q3SJI0_THIDA          IDAVRWVLGESSA-KHLRGETMQDVIFNGSGS------RKPASRASVELAFNND------
SMC_DELAS             MDAVRWVLGESKA-SELRGESMQDVIFNGTTH------RKPASRSSVELVFDNS------
D6CTE6_THIA3          IDAVRWVLGESKA-SELRGESMQDVIFNGSGQ------RKQASRCSVEMVFDNS------
SMC_BORPD             IDAVRWVLGEAKA-SELRGESMQDVIFNGSGN------RKPAARASVEMVFDNS------
SMC_BURP1             IDAVRWVLGESRA-SELRGESMQDVIFNGSTT------RKPGSRASVELIFDNS------
A4SYV7_POLAQ          IDAVRWVLGESRA-SELRGESMQDVIFNGSGL------RKPSGRASVELIFDNT------
D5CRW3_SIDLE          IDALRWVLGESRA-SALRGESMQDVIFNGAGT------RKPVARASVELVFDNS------
D9SGR3_GALCS          IDALRWVLGESRA-SALRGESMQDVIFNGSAR------RKPVARASVELIFDNQ------
Q2YBB9_NITMU          IDAVRWVLGESRA-SALRGESMQDVIFNGSTT------RKPVGRASVELAFDNS------
Q0AE88_NITEC          IDAVRWVLGESRA-SALRGESLQDVIFSGSVT------RKPVGRASVELVFDNG------
D7DI79_METV0          MESVRWVLGESSA-KEMRGDSMDAVIFNGSGN------RKPISRASVELIFDNS------
C1D4R7_LARHH          IDAVRWVLGESSA-KQLRGESMQDVIFNGSST------RKPAGRASVELVFDNS------
Q7NR76_CHRVO          IDAVRWVLGESSA-KQLRGESMQDVIFNGSSS------RKPVSRASVELVFDNG------
A1KSF4_NEIMF          IDAVRWVLGEASA-KQLRGESMQDVIFNGAAT------RRPAPRASVELVFDNS------
A1WY82_HALHL          IDAVRWVMGESSA-KHLRGESMTDVIFSGSSA------RSPVGKASIELVFDNS------
Q0AAV4_ALKEH          IDAVRWVMGESSA-RHLRGQSMADVIFNGSTA------RKPVSHASVELVFDNS------
SMC_XANOR             IDAVRWVMGESSA-SRLRGDSLTDVIFSGSSA------RKPVSQATVELIFDNS------
B8GTL2_THISH          IDAVRWVMGESSA-KHLRGDSMEDVIFNGSSS------RKPVGQASIELVFDNS------
Q3JAH9_NITOC          IDAVRWVMGESSA-KHLRGDSMADVIFNGSTS------RKPVGQCSVELVFDNS------
D3RSW0_ALLVD          IDAVRWVMGESSA-KMLRGESMADVIFNGSTG------RKPVGVASIELIFDNS------
B3PGR0_CELJU          IDAVRWVMGESSA-KNLRGENMTDVIFNGSSG------RKPVGQASIELVFDNS------
A6V7X5_PSEA7          IDAVRWVMGESSA-KNLRGESMTDVIFNGSNT------RKPVSQASIELIFDNA------
Q0VR03_ALCBS          IDAVRWVMGESSA-KHLRGESMADVIFNGSNA------RKPVAQASIELIFDNS------
C7RBE2_KANKD          IDAVRWVMGESSA-KNLRGDAMTDVIFNGSTG------RKPVGQASIELVFDNS------
Q2SD45_HAHCH          IDAVRWVMGESSA-KHLRGESMTDVIFNGSNT------RKPVGQASIELIFDNA------
E4PL89_MARAH          IDAVRWVMGESSA-KYLRGESMTDVIFNGSSA------RKPVGQASIELVFDNS------
E1V8E9_HALED          IDAVRWVMGESSA-KTLRGESMADVIFNGSTG------RKPVGQASIELMFDNR------
D3SAL9_THISK          IDAVRWVMGESSA-KHLRGDSSEDVIFNGSSS------RKPVGQASIELIFDNS------
SMC_METCA             IDAVRWVMGESSA-RHLRGETMADVIFNGSST------RKPASQASVELVFDNS------
SMC_COXBU             VDAVRWVIGETSA-KQLRGQSMSDVIFNGTTS------RKPVGKASIELHFDNS------
Q5WTI1_LEGPL          IDAVRWVMGESSA-KNLRGESMTDIIFNGSSN------RKPVGQASVELVFDNS------
Q12L80_SHEDO          IDAVRWVLGESSA-KNLRGDSMTDVIFNGSSV------RRPVSVAGVELVFDNS------
Q080K7_SHEFN          IDAVRWVLGESSA-KHLRGDSMTDVIFNGSSA------RKPISVAGVELVFENI------
A4Y804_SHEPC          IDAVRWVLGESSA-KHLRGDSMSDVIFNGSSA------RKPVSVAGVELVFENK------
D4ZIY3_SHEVD          IDAVRWVLGESSA-KHLRGDSMADVIFNGSTA------RRPVSVASVELSFENL------
B0TKB4_SHEHH          IDAVRWVLGESSA-KHLRGDSMADVIFNGSTA------RRPVSVASVELLFDNQ------
A3QFJ7_SHELP          IDAVRWVLGESSA-KHLRGDSMADVIFNGSSA------RRPVSVASVELSFDNQ------
A1S5R5_SHEAM          IDAVRWVLGESSA-KHLRGDSMTDVIFNGSSA------RRPVSVAGVELVFDNR------
Q5QUJ9_IDILO          IDAVRWVLGESSA-KNLRGDAMSDVIFNGSSA------RKPVSQASVELVFDNS------
E1SMV2_FERBD          IDAVRWVLGESSA-KNLRGDAMTDVIFNGSSG------RKPVSVASVELVFDNQ------
F2GBA5_ALTMD          IDAVRWVLGESSA-KNLRGDAMTDVIFNGSSS------RKPVGQCSVELVFDNS------
Q15UZ3_PSEA6          IDAVRWVLGESSA-KNLRGDAMIDVIFNGSTA------RKPVSQCTVELVFDNT------
Q3IKC0_PSET1          IDAVRWVLGESSA-KNLRGDAMADVIFNGSTN------RKAISQASVELTFDND------
A4SKA4_AERS4          IDAVRWVLGESSA-RHLRGENMTDVIFNGSIN------RSPHGRASVELVFDNP------
D0KWM8_HALNC          IDAIRWVLGESSA-KQLRGQSLDDVIFAGSGQ------RPAASQAVVELSFDNS------
A0A2W1K6W8_ACIFR      VDAVRWVLGESSA-RQLRGGTLSDVISNGGGS------RPAASVATVELRFDNS------
A0A0J1A050_ACIBA      IDAIRWVMGESNA-RQLRGGSMQDVIFTGTSK------RKPVGVASVELRFDNT------
B3E294_GEOLS          VDAMRWCMGEQSA-KNLRGKAMEDIIFAGSDS------RKPLGMAEVSLVFSTE------
A1AU91_PELPD          VDSIRWCMGEQSA-KNLRGKAMEDVIFAGSET------RKPLGMAEVSLVFSTE------
B9M6F0_GEODF          VDAIRWVMGEQSA-KNLRGKQMEDIIFGGSES------RKPLGMAEVSLVFSTE------
Q39WG2_GEOMG          VDAIRWVMGEQSA-KNLRGKSMEDIIFGGSES------RKPLGMAEVSMAFSTE------
B5EFS9_GEOBB          VDAIRWVMGEQSA-KNLRGKSMEDIIFGGTEF------RKPLGMAEVSLFFSTE------
Q3A212_PELCD          VDAIRWAMGEQSP-KNLRGRAMEDVIFGGSEK------RKPVGMAEVSLVFSNE------
A9FIZ2_SORC5          VDAIRWAIGEQSA-KHLRGKSMSDVIFNGSET------RAQHGMAEVTLTFDNS------
D0LY52_HALO1          VDAIRWSMGEQSA-RHLRGKAMDDVIFAGSES------RGPASMAEVSLTFEDVGFSRET
Q1D2R5_MYXXD          VDAIRWVMGEQSA-KNLRGRGMEDVIFNGSEN------KPPLSMAEVSLTFIVD------
B4UDF6_ANASK          ADSIRWVLGEQSA-RHLRGRSMEDVIFNGSES------KPPLSMAEVMLTFVND------
Q6MNS9_BDEBA          VDALMWVMGDQSA-KDLRASQMTDVIFGGAEG------YAPLGMCEVSLTLEND------
A9A0M3_DESOH          IDALKWVMGEQSA-MQLRGKSMDDVIFAGSNE------KAPVNMAEVSLVLAND------
B8FHS3_DESAL          VDAIQWVTGEQRA-RQLRGKSMEDVIFSGSKS------RPPVNMAEVSITFAND------
E1QL74_DESB2          VDAIRWVLGEQSA-RQLRGQAMEDVIFNGAQS------HKPTGLAEVSIVFENA------
B3EFQ6_CHLL2          VDAIRWVLGEQRT-TLLRSAKMENIIFNGSKN------LKPLSLTEVSITIENTRNV---
A1BDT4_CHLPD          VDAIRWVLGEQKS-SLLRSEKMENIIFNGSKN------LKPLSLTEVSLTIENTRNV---
A4SG64_CHLPM          VDAIRWVLGEQKS-SLLRSAKMENIIFNGSRN------LKPLSFTEVSLTIENTRNI---
SMC_CHLTE             VDAIRWVLGEQKS-MLLRSPKMENIIFNGTKR------LKPLSFTEVSITIENTRNI---
Q3ATI3_CHLCH          VDAMRWVLGEQKS-SLLRSAKMENIIFNGTRT------LKPLSMAEVSLTIENSRNV---
B4S519_PROA2          VDAIRWVLGEQKS-ALLRSTKMENIIFNGTRK------LKPLSLSEVSLTIENTRNV---
B3EM83_CHLPB          VDAIRWVLGEQKT-SLLRSSKMESIIFNGSRK------LKPLSMSEVSITIENTRNI---
B3QRZ4_CHLT3          VDAIRWVLGEQKT-SVLRSDKMENVIFNGTKN------RRPLGMSEISLTIENTKNI---
D0MFL5_RHOM4          VDAVRWVIGEQRA-RVLRSERMEHVIFNGTAR------RRPVGMAEVLLTIENTRGI---
Q2S457_SALRD          VDAIRWVIGEQRP-TVLRSEKMENLIFNGTAD------RRPLGMAEVELTIENTDGV---
C7PLU2_CHIPD          IDSIRWVIGEHKI-SNLRSENQSGLVFNGSKT------RSASGMAEVSLTFENTRNV---
E4TVF1_MARTH          VDAIRWVLGEQKS-RMLRSDKMENVIFNGTKK------RKQSNLAEVSLTFNNTKNL---
B2KBE7_ELUMP          VDSVRWAIGEMSW-KSLRSASMIDIIFNGTAR------RSPLNLAQVNMIFDNESRK---
B1H0P2_ENDTX          SDSIRWCLGEQKA-KSMRSSNMQEVIFGGTQT------RTTTGMAEVSLTFDNSQNG---
E4TEW8_CALNY          LDAIRWILGEQNP-KELRGSDMDDIIFAGSEK------RSQSNVASVTLVISDISEE---
D3PDY1_DEFDS          LDAIRWVFGEQSP-KELRGDSMDDVIFAGSEN------RKPSGYCEVTLVVSDVAEH---
D4H2V6_DENA2          LDAIRWIFGEQSA-KELRGADMDDVIFAGSQH------RKPTGFAEVSLTLSELPES---
D6YSC9_WADCW          SDSFRWVLGEQSA-KSMRGSKMNDVIFAGTAK------RKPLNLSEVTITLGDVGSA---
Q04TU9_LEPBJ          VDAVKWVFGEKSA-KGLRGEKMDDVIFHGSEA------RKPAGYAEVSVVFDNSSRL---
E1R6H6_SEDSS          VDSIKWVLGEQST-KTLRAEKMEDVIFNGTEN------RKALNVAEVTLTLSNDDGV---
Q73ML2_TREDE          VDAVKWVLGEQSS-RTLRADKMEDVIFNGTEK------RNQLNIAEVTLTISNEKGL---
A0A0H3BKB7_TREPS      VDAIKWVLGEQSS-RALRADRMEDVIFNGTES------RRSLNVAEASLTVCDEAGI---
E0RSK7_SPITD          VDAIKWVLGEQST-KTLRTSSMEEVIFNGTED------RKPLNVAEVTLILSNNEGH---
D5EMY0_CORAD          VDAIRWVLGEQSA-KALRGASMQDVIFEGTDK------RKGLPYCEVALTFTDCEAE---
B1ZZB8_OPITP          ADSIRWVLGEQSA-KALRGGKMQDVIFEGADT------RKPAQMCEVSLLLTECEKQ---
SMC_DESHY             ADAIRWVLGEQSA-KNLRGSKMEDVIFSGSSV------RRPVGMAEVSLFFDNSTGI---
A4J682_DESRM          SDAISWCLGEQRA-SSLRGGRMEDVIFAGSAK------RKPVGLAEVTLTLDNTAKM---
Q67PF3_SYMTH          SDAIRWVLGEQSA-RALRGGSMADVIFAGSDG------KRAMGFAEVSLVLDNSDGA---
B0TGW8_HELMI          ADAIRWVLGEQSP-RSLRGSKMEDVIFAGSDR------RKPVGMAEVSLTLDNEKGM---
Q2RJX0_MOOTA          VDAILWVLGEQSA-KSLRGTRMDDVIFAGSAR------RRPVGMAEVTLYLDNSDAS---
SMC_BACSU             TDAIRWVLGEQSA-RSLRGGKMEDIIFAGSDS------RKRLNLAEVTLTLDNDDHF---
C5D8T7_GEOSW          TDAIRWVLGEQSA-KSLRGAKMEDIIFAGSDS------RKPLNVAEVTITLDNEDQF---
D5DQR5_BACMQ          TDAIRWVLGEQSA-KSLRGGKMEDIIFAGSES------RRAVNVADVTLTLENDDQF---
B7IUK7_BACC2          TDAIRWVLGEQSA-KSLRGAKMEDIIFAGSDT------RRAVNVAEVTITLNNEDQR---
Q9KA07_BACHD          SDGIRWVLGEQSA-KSLRGSKMQDIIFAGSDT------RKPLNFAEISLVLDNEDQH---
Q5WFM8_BACSK          ADAVRWVLGEQSA-RSLRGAKMEDIIFAGSDS------RKAVNMAEVSLILDNEDGH---
Q7ZAM6_OCEIH          TDAIRWVLGEQSA-KSLRGSKMEDIIFQGSET------RKALNVAEVTLVLDNQDQR---
D6XTT7_BACIE          SDAIRWVLGEQSA-RNLRGGKMEDVIFSGSDK------RKALNMAEISLVLDNEDQH---
Q81ZN4_ENTFL          TEAVRWVLGEQSA-KNLRGGKMNDIIFAGSEG------RKPLNIAEVTVTLDNSDHY---
A0A0E0UX46_LISMM      TEAIRWVLGEQSA-KSLRGGRMGDVIFAGSDT------RKPINFAEVSLILENEDHF---
B1HQH6_LYSSC          TDAIRWVLGEQSA-KSLRGSKMEDVIFAGSDS------RKPLNFAEVTLILDNTDEQ---
C6D303_PAESJ          SDGIRWVLGEQSA-KSLRGGKMEDIIFAGSDA------RKAVNYGEVSLTLDNGDGA---
C0ZFN9_BREBN          SDSIRWVLGEQSA-KSLRGAKMEDIIFAGSDK------RKPVNFAEVTLTLDNTDRS---
C8WWA4_ALIAD          ADALRWVLGEQSV-RNLRGSKMEDVIFAGSEL------RKATNLCEVSITLDNTDHH---
D5WPA2_KYRT2          AEALRWVLGEQSA-RSLRGARMEDVIFAGSDG------RKPINYCEVSLTLDNEDGR---
C4L5Z7_EXISA          SDAVRWVLGEQSA-KSLRGAKMEDVIFAGSEG------ENHRNVAEVTLVLDNRDEQ---
B1YIN0_EXIS2          SDAVRWVLGEQSA-KSLRGAKMEDVIFAGSIS------EHRKQFAEVTLVLDNESGT---
D3R1B0_MAGIU          TDAIRWVLGEQSV-KTLRGNKMEDIIFAGTQS------RRPLSYAEVQINFDNTDSS---
D2RLB2_ACIFV          SDAIRWVLGEQSV-KYLRGTKMEDVIFAGSSG------RRPMGMAEVDLVFDNTDHS---
D1BLY1_VEIPT          TDAMKWVLGESNV-RNLRGQKAEDIIFSGTEK------RKPMSAAEVTLVFDNSDQQ---
A5UQ60_ROSS1          VDAIRWVLGEQHP-GALRCKRTEDLIFSGGGR------RAPAGFAEVSLTIDNSDRL---
B8G556_CHLAD          ADAVRWVLGEQSM-SALRCKQAGELLFAGGGR------RPPAGLAEVALTIDNSDRL---
A9B100_HERA2          TDAIRWVLGEQSF-SALRCRRTEDLIYSGGGK------RAAQGMAEVALTIDNTDRT---
D1C6T1_SPHTD          AEAVRWALGEQSY-ASLRGRRTEDVIFAGSAA------RAPLGMAEVSLTLDNESGD---
D7CMX2_SYNLT          VDAIRWALGESNV-RHLRGQRNDDVIFSGTDK------RRPLGLAQVDVAIDNCDRV---
Q0AYV7_SYNWW          VDAIRWVLGETSI-RQLRGQKNEDVIFNGSDK------KKALGMAFVELVIDNSDHS---
SMC_LACPL             IEAIRWVLGEQAV-KSLRGTKMTDVIFAGSAN------RKPLNMAKVTITFDNSDHFLPL
Q03RT7_LACBA          SEAVRWVLGEQSA-KSLRGSKMPDVIFAGSAD------RHPLNRAAVSITLDNSDHYLKS
B2GD41_LACF3          IEAIRWVMGEQSA-KTLRGDKMADVIFNGAAD------RKPLNRAQVKITLDNSDHYLDS
A5VKP1_LACRD          IEAIQWVMGEQSA-HHLRGDRMADVIFNGSSD------RKPLNRALVSITLDNSDHYLAS
Q03FW9_PEDPA          IEAIRWVMGETSA-KSLRGGKMPDVIFSGTEK------RKPLSRASVTIIFDNSDHFLDS
A0A249N2C3_LACRH      TEAIRWALGEQSA-KSLRGERMGDVIFAGTDS------RPALNRAAVTMTFDNSDGYLKN
Q38XR7_LACSS          TEAIRWAMGEQSA-KSLRGEKMPDIIFAGTDL------RPQMNRAEVTLNFDNSDHYLNQ
Q1WU99_LACS1          TEALRWVLGEQSV-KNLRGSKMPDIIFAGSDT------RAALNRAEVTLVLDNEDGYLYN
Q04GL1_OENOB          IEAIRWVMGEQSA-KGLRGNTMADVIFGGSKK------RPALGRASVSMTIDNSDHYLHS
Q03VW6_LEUMM          IEAIQWVMGEQSA-KDLRGTKMSDVIFGGTDK------RGALNRAEVSITFDNSDHYVQS
A0A0U5K8Z4_LACDE      TEAIRWVMGEGSA-KSLRGRNMKDVIFAGSQF------RKPLNRAEVTMVFDNRDRELDF
E4SKB3_LACAR          TEAIRWVMGESSA-KSLRGTNMKDVIFAGSQY------RKPLNKAEVTLVFDNKDRELAF
Q74IP9_LACJO          TEAIRWVMGEGSA-KSLRGENMKDVIFAGSQM------RAPMNHAEVELVFDNRDHQLAS
A0A0T8KIP4_STREE      TESLRWALGESSV-KSLRGGKMPDVIFAGTES------RKPLNYASVVVTLDNHDGFIKD
A4VVL7_STRSY          TESLRWALGESSA-KSLRGGKMPDVIFSGTES------RKALNYASVVVTLDNSTGFIAN
C0MCR5_STRS7          TESLRWALGEASA-KSLRGGKMPDVIFAGTEH------RSPLNYAEVAVVLDNSDAFIKN
A2RLZ7_LACLM          VEALRWVLGEQSA-KALRGGKMPDVIFAGTEK------RRALNYAEVIAHFDNSDHYLQG
B9EBB4_MACCJ          TDAIKWVLGEQSA-KSLRGAKMEDIIFSGAQN------RNATNFAQVTLTINNIERSLAV
SMC_MYCHR             NDAIRWVLGEQSA-KQLRGLNMDDVIFAGSKT------VKPQEKAMVKLTFKNED-AIEE
E0TKT8_MYCHH          NDAIKWVLGEQSA-KQLRGLNMDDVIFAGSKT------VKPQEKAMVKLTFKNED-AIEE
Q4A770_MYCH7          NDAIKWVLGEKSV-KQLRGQNMDDVIFAGSKT------VMPVNKAMVKLTFLDET-RED-
C5J708_MYCCR          NDAIRWVLGEKSV-KQLRGSNMDDVIFAGSKT------VKPLDKAMVRLTFEDKS-LEDE
A5IYM7_MYCAP          NDAIKWVLGERSA-KELRGDNMDDVIFAGSKT------AKPMDKAVVTLTFDNKDGQSSI
D5E4P4_MYCCM          NDAIKWVLGEQSS-KELRGDNMHDVIFAGSKT------VKALDKAEVTLTFDNRLGASSF
Q6KHN4_MYCMO          NDAIRWVLGEQSF-KALRGDNMEDVIFAGSKT------AEAQDKAEVTLTFDNSDYSLKQ
Q98PK8_MYCPU          NDAIKWVLGEQSS-KSLRGDNMEDVIFAGSKN------VKEMNKASVTLTFDNSNNASSV
D1J8Q8_MYCHP          NDAIRWVLGETSS-KVLRGDTMEDVIFSGSKT------EKEMDRAEVILTFDNKDRSCDI
Q4A588_MYCS5          NDAIKWVLGEQSS-KELRGNSMSDVIFSGSKT------AKAMDFAYVTLTFDNKDRFSSI
SMC_MYCGE             VDALKWVLGERSM-KHLRSKSGDDMIFFGSKD------KPASKLAEIELTFDNSN-RLLH
SMC_MYCPN             VDALKWVLGERSM-KHLRSKSGDDMIFFGSKD------KPASKLAEVELTFDNSQ-KLLH
Q7NBU0_MYCGA          VDALKWVLGERSM-KNLRGKTSDDVIFFGSQE------KPASKFAEVSLTFDNSQ-GYLH
Q8EVS6_MYCPE          IDAIKWVLGEQSI-KSLRGKKSDDIIFHGSKS------KEACEYAQVTLTFDNTK-KQLH
Q9PR04_UREPA          IDALKWVIGDQSL-KSMRAHK-NDLLFSGGRY------APKAHIARVNLYFNNVN-NVLY
Q6F1N4_MESFL          TDSIRWALGEQST-KSLRGANMDDIVFSGSTD------KPAADFAEVTLVFDNQRDIFST
Q6MTD2_MYCMS          TDAIRWTLGEQST-KTLRGSKMDDIVFSGNNE------KKAADVAEVTLVFNNIHENFSS
E3GP81_9FIRM          TDAIRWVLGEQST-KSLRGKKMEDVIFSGTEK------KKPLNYAEVTLTLDNTSGFTLD
SMC_HALOH             VDAIRWVLGEQSA-KTLRGSRMADVIFAGSKD------YKALNKASVTLYLDNQDKI---
E4RL35_HALHG          VDAVRWVLGEQSA-KTLRGSRMSDIIFSGSEE------LNPKRSASVTLFFDNSDGI---
D9QRN7_ACEAZ          ADAIRWVLGEQSA-KSLRGSKMEDVIFAGSSQ------RKPMGIAEVTLTLDNSNGQ---
A8MHB7_ALKOO          SDSIRWVLGEQSA-KTLRGSKMEDVIFSGAAD------RKPLGMAEVSITLDNSSET---
A6TRT3_ALKMQ          SDSIRWVLGEQSA-KSLRGSKMEDIIFAGTAK------RKALGMAEVSLTLDNSTKM---
A3DDY2_HUNT2          SDAIRWVLGEQSA-KTLRGGKMEDVIFAGTEH------RKPMGFAEVSLTFDNSDGV---
D5X8N2_THEPJ          SDAIRWVLGEQSA-KILRGAKMEDVIFSGSDK------RKPVGMAEVTLTLDNSTGI---
D9R048_CLOSW          ADAVRWVLGEQKV-KQLRSSNMQDVIFSGTEL------RKPQGFAYVAITLDNSDHH---
C4Z0E6_EUBE2          ADAVRWVLGEQSA-KQLRGSKMEDVIFAGTEN------RKPVGFAFVSITLDNSDHA---
C4Z924_AGARV          ADAVRWVLGEQSA-KQLRGASMQDVIFAGTEN------RKPLGYAYVAITLDNSDHS---
E0RV40_BUTPB          ADAVRWVLGEQRI-KQLRGGSMQDVIFSGTEL------RKPLGYAYVAITLDNSDHS---
A9KLR0_LACP7          ADAVRWVLGEQSA-KSLRGANMQDVIFSGTQM------RKSLGFAYVAITLDNSDHK---
D9S347_THEOJ          TDAIRWVLGEQSI-KTLRGSKLEDVIFAGSHG------RKPMGMAEVSIILDNSDHL---
B2A2N3_NATTJ          SDAIRWVLGEHRT-KPLRGEKMEDFIFSGTQN------KKAMNMAEVTLTLDNSQGH---
A8F8R1_PSELT          VDAIRWVFGEQSM-KQLRAEEKYDVIFAGSSK------IPAATSAYVELSFENEDEK---
A5IN04_THEP1          IDAIKWVFGEQSK-KELRASEKFDMIFAGSEN------LPPAGSAYVELVFEENGEE---
C5CIS4_KOSOT          VDAIRWVFGEQSM-KTIRADNREDVIFAGSEK------NPPANSAVVKLTFEDERGL---
A7HMD4_FERNB          VDAIRWVLGEQSM-KEIRAQEREDVVFWGNEK------KPPAQFAYVELVFENGNER---
B7IHN5_THEAB          VEAIQWVFGEHSL-KQLRASEKFDMIFKGNGK------TPSARSAFVELTFDFNGRE---
SMC_THEEB             LDALLFALGLAGS-KGMRAERLPDLVNHSQTR-----RGHSVVETRVTVTFALDA-----
Q2JHS4_SYNJB          LDGILFALGLSSS-RGMRAERLLDLV-HSGSL-----NGNRQVETHVSVTFELGPGEDGQ
SMC_SYNP6             LDALLFALGLSSS-KGMRADRLPDLVNSTYAS-----RSRSTVETLVTVTFALDDW----
B0C9C4_ACAM1          LDALLFALGLAGS-RGMRAERLPDLVNHAQIK-----RGHAISETRVTVTFELSPQELEE
Q115J3_TRIEI          LDALLFCLGLSTS-KGMRAERLPDLVNNKLA-------GRKTVETIVTVTFDLEDLSSQK
B2J925_NOSP7          LDALLFCLGLSSS-KGMRADRLPDLVNNTQTS-----KGRASIEASVTVTFDLSDEISHK
E0UKI1_GLOV7          LDALLFCLGLASS-KGMRAERLPDLVNHNHTP-----NGRKTTETSVSVTFDLSDLPDI-
B7K4Q6_RIPO1          LDALLFCLGLATS-KGMRAERLPDLVNHNHS------NNRKTQEASVSVTFDVSDLEDLQ
B0JSN6_MICAN          LDALLFCLGLATS-KGMRAERLPDLVNHSYN------SQRHSTEASVSVTFDIADIPDAT
SMC_SYNY3             LDALLFCLGLATS-KGMRAERLPDLVNNTFK------GNRGSSEASVSVTFELHDGENLS
Q84EC7_SYNP2          LDGILFCLGLASS-KGMRAERLPDLINHKHS------QGKGAAETVVSVTFDLSDLAQQY
D3EQ04_ATETH          LDALLFCLGLATS-KGLRAERLPDLISHNTN-------NRNNREAYVSVTFDISDYLSSE
SMC_GLOVI             IDALLFALGLSTS-RGMRAEKLSDLIHQGAA----------KGEVAVTVTFALDAAAGG-
A5GQT1_SYNR3          LDGILFCLGLASS-RGMRAERLPDLINNNALK-----QGK-ASEASVSVRFDLRGWQPDT
A9B9B9_PROM4          LDGILFCLGLATS-RGMRADRLPDLVNSGVLR-----AGK-SAETVVSVRFDLQDWQPDS
A2BNJ6_PROMS          LDGILFCLGLANS-RGMRAERLPDLINNSKVK-----EGK-SSETSVSVKFNIQDWSPRE
Q46EX0_METBF          IDGILFALGLTSS-RTLRAEKLTDLIYNGDAS-------KKPDFAQVTIRFDNSDHKLPL
D7EAF5_METEZ          IDGILFALGLSNS-RTMRAEKLTDLIYNPDSS-------NKPQYAQVKIRFDNSDNEMPV
D1YW78_METPS          IDSILFCLGLSNS-RSMRAEKLTDLIYSVNG--------KSPGSADVTIRFDNTDREMPI
A0B8B9_METTP          IDALLFSLCLTSS-RAMRAERLPDLIYRGDDG-------RAPDFAEVTVRLDNSTRTMPV
D4GT30_HALVD          IDGVLFALGLART-RGIRAEKLTDLIYNPGHADGSDEAPDKPKEASVTVVLDNSEGTLDR
A7IAD8_METB6          IDSILFVLALSSS-RNLRAEKLTDLINLNSGK----------NIAEVAIAFS--------
A3CWK7_METMJ          IDSLLFVLALSGA-RGLRAEKLTDLINVNSGK----------NTAEVTATFS--------
B8GG37_METPE          IDAILFVLALSSS-RNLRAEKLTDLINLNSNR----------NTAEVALTFS--------
E1RII6_METP4          IDSILFCLALSSA-RGLRAEKLTDLINLNSGK----------NTAEVSITFS--------
Q2FLH3_METHJ          IDSILFVLALSSS-RHLRAEKLTDLINLNTDR----------NTAEVEITFS--------
A2SS75_METLZ          IDSILFVLSLSTS-RTLRAEKLTDFINTMSGK----------NTAEVTLTFS--------
D3RYW2_FERPA          IDAILFCLGLSSSTKVLRAEKLTDLISLNSNG----------KEAEVSITFRSENEGENG
O28714_ARCFU          IDSILFCLGLSTSTKQLRAERLTDLVHNGRS------------EAEVAILFS-----ENG
D2RFP2_ARCPA          IDSILFCFGISSS-KTLRADKLTDLIKHGQK------------EAEVTIELDG-------
SMC_THEAC             GDMLLFVLGTKSI-HAVRADRLSDLVSKGSGN-----------ECSVSVTFRSDDG----
Q97AI9_THEVO          GDMLLFVLGTKSI-HSVRADKLSDLISKDSGN-----------TCYVIVTFKNDEG----
SMC_METVO             IDGICFVLGKTSA-KSLRAGKFNQLITY--HNGKR------ADYAEVTLFFDNIN-----
A6UQ42_METVS          IDGICFVLGKTSA-KSLRAGKFNQLITY--HGGKR------ETFAEVTLYFNNKD-----
A6UVP1_META3          IDGICFVLGKTSA-KSLRAGRFNELITY--HKNKR------ADYAEVSLFFDNSD-----
SMC_METJA             VDAILFVLGKTSA-KKLRANRFSGLITY--HNGKR------ADFAEVCLYFTNEN-----
C9RFQ3_METVM          VDAILFVLGKTSA-KKLRANKFSGLITY--HNGKR------ADFAEVCIYFLNENDTF--
D5VT24_METIM          VDAILFVLGKSSA-RKLRANKFSSLINY--HKGRK------AEYAEVTLFFESNG-----
D3SQ87_THEAH          GDAISFALGIATA-RMLRAKNLSYLIHT--KDGQR------APYAYVEVHFNNFG-----
D3DG53_HYDTT          GDAISFALSLATA-KTLRAKNLSYLIYT--KDSDS------SHHAYVEVHFKNEG-----
SMC_AQUAE             GDAISFALGLSSA-KALRAKNLSYLIFS--KNGQK------ADHAYVEVHFKNLG-----
B4U7R1_HYDS0          GDAISFGLGLSTS-KTMRAKNLTHLIYS--KQGQR------EDFAQVDIHFSNPQ-----
C0QSN8_PERMH          GDSIVFALGLATA-KSMRALKLSDLIFS--SRGRS------AEYAEVEVVFKNEG-----
B2V736_SULSY          GDSIVFCLGIASA-RAMRALKLTDLIFS--SNDKS------APYAEVEIVFKNLG-----
SMC_PYRFU             GDAILFVLGGLSA-KAMRASRISDLIFAGSKNEPP------AKYAEVAIYFNNEDR----
C5A612_THEGJ          GDAVLFVLGGLSA-KAMRATRISDLIFAGNRAEPP------AKYAEVAMYFNNEDR----
D1CC09_THET1          LEAIRWVLGEQSY-SLLRSKKSEDVIWAGSPG------KPRAGMAEVEISIDNHDKS---
D3TAQ9_ACIB4          TDAILFVLGPKSS-KKIRAQRLTDLIYNGGKN------GRPADYCRVSLIFDNRDRV---
SMC_HALMS             VDALFWVMGEQSA-KHLRGKSMKDLIFAGSSK------YNPGAYAEATLVLGNDDGK---
Q6L0R1_PICTO          GDAILFVLGIRSN-KTVRIERLSDLIHKSEKS--------SRNYCYVELNINDNG-----
C1A7M6_GEMAT          SDAVRWVLGEQRA-RAMRGAKMEDVIFHGSSA------RKAVNMAEVSLHFDNTEGE---
C9RN51_FIBSS          TDAIRWVLGEQKA-AALRMGKMQDVIFSGTEE------RAAMSLAEVSIVIDNSDGT---
D1B5Z0_THEAS          LDALKWTLGEGSP-SRLRINRQSDLLFQGSAS------LPPAKEAEVSVLFRGDG-----
                       : .            .*      .:                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          ------------------------------------------------------------
SMC_KORVE             IV-EPEIEIRDEMPDDWDEAAAREASMEEVDEYTAEVQPGTNTEAEATEQQAAPSEGAAP
C1F1T5_ACIC5          LLDEPEISVENELPKDWDEDALRAESAAEVEEIISESQPG----------QVIEAAGANP
Q01Y77_SOLUE          ------------------------------------------------------------
SMC_MYCPA             ------------------------------------------------------------
SMC_MYCTU             ------------------------------------------------------------
SMC_MYCLE             ------------------------------------------------------------
A4FMG9_SACEN          ------------------------------------------------------------
C8XH72_NAKMY          ------------------------------------------------------------
D7GEI0_PROFC          ------------------------------------------------------------
Q2J6Z3_FRACC          ------------------------------------------------------------
A8L599_FRASN          ------------------------------------------------------------
C9Z3S1_STRSW          ------------------------------------------------------------
D7CC86_STRBB          ------------------------------------------------------------
B1VYX5_STRGG          ------------------------------------------------------------
E4NHH3_KITSK          ------------------------------------------------------------
C7QGY1_CATAD          ------------------------------------------------------------
A0LV82_ACIC1          ------------------------------------------------------------
A0JXV4_ARTS2          ------------------------------------------------------------
A1R7H8_PAEAT          ------------------------------------------------------------
A6W7T9_KINRD          ------------------------------------------------------------
D1BJA3_SANKS          ------------------------------------------------------------
C7NGM6_KYTSD          ------------------------------------------------------------
B2GFM7_KOCRD          ------------------------------------------------------------
E1VVN2_GLUAR          ------------------------------------------------------------
A5CQQ2_CLAM3          ------------------------------------------------------------
Q6AE90_LEIXX          ------------------------------------------------------------
D1AB24_THECD          ------------------------------------------------------------
D6Y659_THEBD          ------------------------------------------------------------
D7BMZ9_ARCHD          ------------------------------------------------------------
D6ZIF1_MOBCV          ------------------------------------------------------------
C7R311_JONDD          ------------------------------------------------------------
D6ZV06_BIFLJ          ------------------------------------------------------------
Q7ZAJ9_COREF          ------------------------------------------------------------
Q8NNW5_CORGL          ------------------------------------------------------------
Q84F13_CORDP          ------------------------------------------------------------
Q4JUZ1_CORJK          ------------------------------------------------------------
C4LJD3_CORK4          ------------------------------------------------------------
D6Z8M0_SEGRD          ------------------------------------------------------------
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             ------------------------------------------------------------
A7IGT2_XANP2          ------------------------------------------------------------
B8EMM7_METSB          ------------------------------------------------------------
B8IQU0_METNO          ------------------------------------------------------------
Q92RE8_RHIME          ------------------------------------------------------------
A7HQY9_PARL1          ------------------------------------------------------------
D8JUP9_HYPDA          ------------------------------------------------------------
E3I0B2_RHOVT          ------------------------------------------------------------
SMC_RHOS1             ------------------------------------------------------------
Q2W040_MAGSA          ------------------------------------------------------------
D3P3X3_AZOS1          ------------------------------------------------------------
B6IR58_RHOCS          ------------------------------------------------------------
Q2RPA2_RHORT          ------------------------------------------------------------
SMC_CAUVN             ------------------------------------------------------------
B0T003_CAUSK          ------------------------------------------------------------
Q0AMJ6_MARMM          ------------------------------------------------------------
E0TC69_PARBH          ------------------------------------------------------------
C6XRC2_HIRBI          ------------------------------------------------------------
Q0C0X5_HYPNA          ------------------------------------------------------------
Q1GQU3_SPHAL          ------------------------------------------------------------
D4YX43_SPHJU          ------------------------------------------------------------
Q2G9S3_NOVAD          ------------------------------------------------------------
D5BSU5_PUNMI          ------------------------------------------------------------
A5FVJ2_ACICJ          ------------------------------------------------------------
C5B6I7_METEA          ------------------------------------------------------------
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          ------------------------------------------------------------
SMC_THASP             ------------------------------------------------------------
A1K715_AZOSB          ------------------------------------------------------------
C7RKG8_ACCPU          ------------------------------------------------------------
Q3SJI0_THIDA          ------------------------------------------------------------
SMC_DELAS             ------------------------------------------------------------
D6CTE6_THIA3          ------------------------------------------------------------
SMC_BORPD             ------------------------------------------------------------
SMC_BURP1             ------------------------------------------------------------
A4SYV7_POLAQ          ------------------------------------------------------------
D5CRW3_SIDLE          ------------------------------------------------------------
D9SGR3_GALCS          ------------------------------------------------------------
Q2YBB9_NITMU          ------------------------------------------------------------
Q0AE88_NITEC          ------------------------------------------------------------
D7DI79_METV0          ------------------------------------------------------------
C1D4R7_LARHH          ------------------------------------------------------------
Q7NR76_CHRVO          ------------------------------------------------------------
A1KSF4_NEIMF          ------------------------------------------------------------
A1WY82_HALHL          ------------------------------------------------------------
Q0AAV4_ALKEH          ------------------------------------------------------------
SMC_XANOR             ------------------------------------------------------------
B8GTL2_THISH          ------------------------------------------------------------
Q3JAH9_NITOC          ------------------------------------------------------------
D3RSW0_ALLVD          ------------------------------------------------------------
B3PGR0_CELJU          ------------------------------------------------------------
A6V7X5_PSEA7          ------------------------------------------------------------
Q0VR03_ALCBS          ------------------------------------------------------------
C7RBE2_KANKD          ------------------------------------------------------------
Q2SD45_HAHCH          ------------------------------------------------------------
E4PL89_MARAH          ------------------------------------------------------------
E1V8E9_HALED          ------------------------------------------------------------
D3SAL9_THISK          ------------------------------------------------------------
SMC_METCA             ------------------------------------------------------------
SMC_COXBU             ------------------------------------------------------------
Q5WTI1_LEGPL          ------------------------------------------------------------
Q12L80_SHEDO          ------------------------------------------------------------
Q080K7_SHEFN          ------------------------------------------------------------
A4Y804_SHEPC          ------------------------------------------------------------
D4ZIY3_SHEVD          ------------------------------------------------------------
B0TKB4_SHEHH          ------------------------------------------------------------
A3QFJ7_SHELP          ------------------------------------------------------------
A1S5R5_SHEAM          ------------------------------------------------------------
Q5QUJ9_IDILO          ------------------------------------------------------------
E1SMV2_FERBD          ------------------------------------------------------------
F2GBA5_ALTMD          ------------------------------------------------------------
Q15UZ3_PSEA6          ------------------------------------------------------------
Q3IKC0_PSET1          ------------------------------------------------------------
A4SKA4_AERS4          ------------------------------------------------------------
D0KWM8_HALNC          ------------------------------------------------------------
A0A2W1K6W8_ACIFR      ------------------------------------------------------------
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          ------------------------------------------------------------
A1AU91_PELPD          ------------------------------------------------------------
B9M6F0_GEODF          ------------------------------------------------------------
Q39WG2_GEOMG          ------------------------------------------------------------
B5EFS9_GEOBB          ------------------------------------------------------------
Q3A212_PELCD          ------------------------------------------------------------
A9FIZ2_SORC5          ------------------------------------------------------------
D0LY52_HALO1          LELALDESTDDVDEFAEGESAEGESAEGESAEGESAEGESAEGEGAEAESATADESDADA
Q1D2R5_MYXXD          ------------------------------------------------------------
B4UDF6_ANASK          ------------------------------------------------------------
Q6MNS9_BDEBA          ------------------------------------------------------------
A9A0M3_DESOH          ------------------------------------------------------------
B8FHS3_DESAL          ------------------------------------------------------------
E1QL74_DESB2          ------------------------------------------------------------
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ------------------------------------------------------------
B1ZZB8_OPITP          ------------------------------------------------------------
SMC_DESHY             ------------------------------------------------------------
A4J682_DESRM          ------------------------------------------------------------
Q67PF3_SYMTH          ------------------------------------------------------------
B0TGW8_HELMI          ------------------------------------------------------------
Q2RJX0_MOOTA          ------------------------------------------------------------
SMC_BACSU             ------------------------------------------------------------
C5D8T7_GEOSW          ------------------------------------------------------------
D5DQR5_BACMQ          ------------------------------------------------------------
B7IUK7_BACC2          ------------------------------------------------------------
Q9KA07_BACHD          ------------------------------------------------------------
Q5WFM8_BACSK          ------------------------------------------------------------
Q7ZAM6_OCEIH          ------------------------------------------------------------
D6XTT7_BACIE          ------------------------------------------------------------
Q81ZN4_ENTFL          ------------------------------------------------------------
A0A0E0UX46_LISMM      ------------------------------------------------------------
B1HQH6_LYSSC          ------------------------------------------------------------
C6D303_PAESJ          ------------------------------------------------------------
C0ZFN9_BREBN          ------------------------------------------------------------
C8WWA4_ALIAD          ------------------------------------------------------------
D5WPA2_KYRT2          ------------------------------------------------------------
C4L5Z7_EXISA          ------------------------------------------------------------
B1YIN0_EXIS2          ------------------------------------------------------------
D3R1B0_MAGIU          ------------------------------------------------------------
D2RLB2_ACIFV          ------------------------------------------------------------
D1BLY1_VEIPT          ------------------------------------------------------------
A5UQ60_ROSS1          ------------------------------------------------------------
B8G556_CHLAD          ------------------------------------------------------------
A9B100_HERA2          ------------------------------------------------------------
D1C6T1_SPHTD          ------------------------------------------------------------
D7CMX2_SYNLT          ------------------------------------------------------------
Q0AYV7_SYNWW          ------------------------------------------------------------
SMC_LACPL             DY----------------------------------------------------------
Q03RT7_LACBA          DY----------------------------------------------------------
B2GD41_LACF3          EF----------------------------------------------------------
A5VKP1_LACRD          EF----------------------------------------------------------
Q03FW9_PEDPA          KF----------------------------------------------------------
A0A249N2C3_LACRH      QP----------------------------------------------------------
Q38XR7_LACSS          EL----------------------------------------------------------
Q1WU99_LACS1          QP----------------------------------------------------------
Q04GL1_OENOB          AF----------------------------------------------------------
Q03VW6_LEUMM          DF----------------------------------------------------------
A0A0U5K8Z4_LACDE      SA----------------------------------------------------------
E4SKB3_LACAR          DA----------------------------------------------------------
Q74IP9_LACJO          DN----------------------------------------------------------
A0A0T8KIP4_STREE      AG----------------------------------------------------------
A4VVL7_STRSY          KQ----------------------------------------------------------
C0MCR5_STRS7          AQ----------------------------------------------------------
A2RLZ7_LACLM          QDE---------------------------------------------------------
B9EBB4_MACCJ          DS----------------------------------------------------------
SMC_MYCHR             -TK---------------------------------------------------------
E0TKT8_MYCHH          -TE---------------------------------------------------------
Q4A770_MYCH7          -SA---------------------------------------------------------
C5J708_MYCCR          -SS---------------------------------------------------------
A5IYM7_MYCAP          -NH---------------------------------------------------------
D5E4P4_MYCCM          -PS---------------------------------------------------------
Q6KHN4_MYCMO          -FD---------------------------------------------------------
Q98PK8_MYCPU          -PH---------------------------------------------------------
D1J8Q8_MYCHP          -PY---------------------------------------------------------
Q4A588_MYCS5          -DR---------------------------------------------------------
SMC_MYCGE             DSR---------------------------------------------------------
SMC_MYCPN             DPR---------------------------------------------------------
Q7NBU0_MYCGA          DKR---------------------------------------------------------
Q8EVS6_MYCPE          FDG---------------------------------------------------------
Q9PR04_UREPA          TQH---------------------------------------------------------
Q6F1N4_MESFL          IKT---------------------------------------------------------
Q6MTD2_MYCMS          IKS---------------------------------------------------------
E3GP81_9FIRM          NL----------------------------------------------------------
SMC_HALOH             ------------------------------------------------------------
E4RL35_HALHG          ------------------------------------------------------------
D9QRN7_ACEAZ          ------------------------------------------------------------
A8MHB7_ALKOO          ------------------------------------------------------------
A6TRT3_ALKMQ          ------------------------------------------------------------
A3DDY2_HUNT2          ------------------------------------------------------------
D5X8N2_THEPJ          ------------------------------------------------------------
D9R048_CLOSW          ------------------------------------------------------------
C4Z0E6_EUBE2          ------------------------------------------------------------
C4Z924_AGARV          ------------------------------------------------------------
E0RV40_BUTPB          ------------------------------------------------------------
A9KLR0_LACP7          ------------------------------------------------------------
D9S347_THEOJ          ------------------------------------------------------------
B2A2N3_NATTJ          ------------------------------------------------------------
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             --QPEAEETE--------------------------------------------------
B0C9C4_ACAM1          LAAAEAAEAE--------------------------------------------------
Q115J3_TRIEI          NGQNELGSVQP-------------------------------------------------
B2J925_NOSP7          DTKAQKEEVE--------------------------------------------------
E0UKI1_GLOV7          --------VV--------------------------------------------------
B7K4Q6_RIPO1          EFSLNSPPVT--------------------------------------------------
B0JSN6_MICAN          D-----------------------------------------------------------
SMC_SYNY3             E-----------------------------------------------------------
Q84EC7_SYNP2          Q-----------------------------------------------------------
D3EQ04_ATETH          E-----------------------------------------------------------
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          AEDGLEAPEE--------------------------------------------------
A9B9B9_PROM4          AEDGLEIPKE--------------------------------------------------
A2BNJ6_PROMS          DLPPLELEEE--------------------------------------------------
Q46EX0_METBF          E-----------------------------------------------------------
D7EAF5_METEZ          E-----------------------------------------------------------
D1YW78_METPS          D-----------------------------------------------------------
A0B8B9_METTP          D-----------------------------------------------------------
D4GT30_HALVD          SQVVNAAGTD--------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          K-----------------------------------------------------------
O28714_ARCFU          KK----------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             ------------------------------------------------------------
A6UQ42_METVS          ------------------------------------------------------------
A6UVP1_META3          ------------------------------------------------------------
SMC_METJA             ------------------------------------------------------------
C9RFQ3_METVM          ------------------------------------------------------------
D5VT24_METIM          ------------------------------------------------------------
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             ------------------------------------------------------------
C5A612_THEGJ          ------------------------------------------------------------
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             ------------------------------------------------------------
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          ------------------------------------------------------------
SMC_KORVE             TTEATAPSTENEAAPSEVAEGQPSDAQAAVINPN--------------------------
C1F1T5_ACIC5          AAEAGAAQAESQAAQATEGVPEAAAAQEGGAVP---------------------------
Q01Y77_SOLUE          ---------ENAAHKLQPVEGGQ-------------------------------------
SMC_MYCPA             ------------------------------------------------------------
SMC_MYCTU             ------------------------------------------------------------
SMC_MYCLE             ------------------------------------------------------------
A4FMG9_SACEN          ------------------------------------------------------------
C8XH72_NAKMY          ------------------------------------------------------------
D7GEI0_PROFC          ------------------------------------------------------------
Q2J6Z3_FRACC          ------------------------------------------------------------
A8L599_FRASN          ------------------------------------------------------------
C9Z3S1_STRSW          ------------------------------------------------------------
D7CC86_STRBB          ------------------------------------------------------------
B1VYX5_STRGG          ------------------------------------------------------------
E4NHH3_KITSK          ------------------------------------------------------------
C7QGY1_CATAD          ------------------------------------------------------------
A0LV82_ACIC1          ------------------------------------------------------------
A0JXV4_ARTS2          ------------------------------------------------------------
A1R7H8_PAEAT          ------------------------------------------------------------
A6W7T9_KINRD          ------------------------------------------------------------
D1BJA3_SANKS          ------------------------------------------------------------
C7NGM6_KYTSD          ------------------------------------------------------------
B2GFM7_KOCRD          ------------------------------------------------------------
E1VVN2_GLUAR          ------------------------------------------------------------
A5CQQ2_CLAM3          ------------------------------------------------------------
Q6AE90_LEIXX          ------------------------------------------------------------
D1AB24_THECD          ------------------------------------------------------------
D6Y659_THEBD          ------------------------------------------------------------
D7BMZ9_ARCHD          ------------------------------------------------------------
D6ZIF1_MOBCV          ------------------------------------------------------------
C7R311_JONDD          ------------------------------------------------------------
D6ZV06_BIFLJ          ------------------------------------------------------------
Q7ZAJ9_COREF          ------------------------------------------------------------
Q8NNW5_CORGL          ------------------------------------------------------------
Q84F13_CORDP          ------------------------------------------------------------
Q4JUZ1_CORJK          ------------------------------------------------------------
C4LJD3_CORK4          ------------------------------------------------------------
D6Z8M0_SEGRD          ------------------------------------------------------------
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             ------------------------------------------------------------
A7IGT2_XANP2          ------------------------------------------------------------
B8EMM7_METSB          ------------------------------------------------------------
B8IQU0_METNO          ------------------------------------------------------------
Q92RE8_RHIME          ------------------------------------------------------------
A7HQY9_PARL1          ------------------------------------------------------------
D8JUP9_HYPDA          ------------------------------------------------------------
E3I0B2_RHOVT          ------------------------------------------------------------
SMC_RHOS1             ------------------------------------------------------------
Q2W040_MAGSA          ------------------------------------------------------------
D3P3X3_AZOS1          ------------------------------------------------------------
B6IR58_RHOCS          ------------------------------------------------------------
Q2RPA2_RHORT          ------------------------------------------------------------
SMC_CAUVN             ------------------------------------------------------------
B0T003_CAUSK          ------------------------------------------------------------
Q0AMJ6_MARMM          ------------------------------------------------------------
E0TC69_PARBH          ------------------------------------------------------------
C6XRC2_HIRBI          ------------------------------------------------------------
Q0C0X5_HYPNA          ------------------------------------------------------------
Q1GQU3_SPHAL          ------------------------------------------------------------
D4YX43_SPHJU          ------------------------------------------------------------
Q2G9S3_NOVAD          ------------------------------------------------------------
D5BSU5_PUNMI          ------------------------------------------------------------
A5FVJ2_ACICJ          ------------------------------------------------------------
C5B6I7_METEA          ------------------------------------------------------------
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          ------------------------------------------------------------
SMC_THASP             ------------EGRAA-------------------------------------------
A1K715_AZOSB          ------------EGKAA-------------------------------------------
C7RKG8_ACCPU          ------------LGRLG-------------------------------------------
Q3SJI0_THIDA          ------------LGRAA-------------------------------------------
SMC_DELAS             ------------DHRAG-------------------------------------------
D6CTE6_THIA3          ------------DHRIA-------------------------------------------
SMC_BORPD             ------------EGRAA-------------------------------------------
SMC_BURP1             ------------DGRAA-------------------------------------------
A4SYV7_POLAQ          ------------EGRAQ-------------------------------------------
D5CRW3_SIDLE          ------------LGKVG-------------------------------------------
D9SGR3_GALCS          ------------SGKAG-------------------------------------------
Q2YBB9_NITMU          ------------LGKAA-------------------------------------------
Q0AE88_NITEC          ------------AGKAA-------------------------------------------
D7DI79_METV0          ------------LGGAT-------------------------------------------
C1D4R7_LARHH          ------------EGRAA-------------------------------------------
Q7NR76_CHRVO          ------------DGQLT-------------------------------------------
A1KSF4_NEIMF          ------------DHSLQ-------------------------------------------
A1WY82_HALHL          ------------DGAIG-------------------------------------------
Q0AAV4_ALKEH          ------------DGRLG-------------------------------------------
SMC_XANOR             ------------DHTIS-------------------------------------------
B8GTL2_THISH          ------------DGTLG-------------------------------------------
Q3JAH9_NITOC          ------------KGNLG-------------------------------------------
D3RSW0_ALLVD          ------------DGGAE-------------------------------------------
B3PGR0_CELJU          ------------DGTLL-------------------------------------------
A6V7X5_PSEA7          ------------ETTLV-------------------------------------------
Q0VR03_ALCBS          ------------DATVT-------------------------------------------
C7RBE2_KANKD          ------------DGTVQ-------------------------------------------
Q2SD45_HAHCH          ------------GGVLQ-------------------------------------------
E4PL89_MARAH          ------------DGSAP-------------------------------------------
E1V8E9_HALED          ------------DGSMG-------------------------------------------
D3SAL9_THISK          ------------DGRLG-------------------------------------------
SMC_METCA             ------------SGRAG-------------------------------------------
SMC_COXBU             ------------EGRIG-------------------------------------------
Q5WTI1_LEGPL          ------------LGRLT-------------------------------------------
Q12L80_SHEDO          ------------LGRLA-------------------------------------------
Q080K7_SHEFN          ------------QGRLT-------------------------------------------
A4Y804_SHEPC          ------------EGRLA-------------------------------------------
D4ZIY3_SHEVD          ------------DGRLM-------------------------------------------
B0TKB4_SHEHH          ------------DGRLA-------------------------------------------
A3QFJ7_SHELP          ------------QGRLG-------------------------------------------
A1S5R5_SHEAM          ------------EGRLG-------------------------------------------
Q5QUJ9_IDILO          ------------SGRIQ-------------------------------------------
E1SMV2_FERBD          ------------AGRLE-------------------------------------------
F2GBA5_ALTMD          ------------AGRIA-------------------------------------------
Q15UZ3_PSEA6          ------------SGRIQ-------------------------------------------
Q3IKC0_PSET1          ------------KGDFP-------------------------------------------
A4SKA4_AERS4          ------------HNRVP-------------------------------------------
D0KWM8_HALNC          ------------ARRLS-------------------------------------------
A0A2W1K6W8_ACIFR      ------------DGAAP-------------------------------------------
A0A0J1A050_ACIBA      ------------YGKLG-------------------------------------------
B3E294_GEOLS          ------------DGRAP-------------------------------------------
A1AU91_PELPD          ------------DGRAP-------------------------------------------
B9M6F0_GEODF          ------------DGRVP-------------------------------------------
Q39WG2_GEOMG          ------------DGRVP-------------------------------------------
B5EFS9_GEOBB          ------------DGRVP-------------------------------------------
Q3A212_PELCD          ------------KGRGP-------------------------------------------
A9FIZ2_SORC5          --------EPTAASQLP-------------------------------------------
D0LY52_HALO1          IPMHSEIVQPSGGEPLPYRASAVADTTIETSDETQAAQDANADADASEAAAEATESAATG
Q1D2R5_MYXXD          -----------DTDQLA-------------------------------------------
B4UDF6_ANASK          -----------RPSELP-------------------------------------------
Q6MNS9_BDEBA          ------------GGPFP-------------------------------------------
A9A0M3_DESOH          ------------NGSAP-------------------------------------------
B8FHS3_DESAL          ------------NGSCP-------------------------------------------
E1QL74_DESB2          ------------GTISA-------------------------------------------
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ------------------------------------------------------------
B1ZZB8_OPITP          ------------------------------------------------------------
SMC_DESHY             ------------------------------------------------------------
A4J682_DESRM          ------------------------------------------------------------
Q67PF3_SYMTH          ------------------------------------------------------------
B0TGW8_HELMI          ------------------------------------------------------------
Q2RJX0_MOOTA          ------------------------------------------------------------
SMC_BACSU             ------------------------------------------------------------
C5D8T7_GEOSW          ------------------------------------------------------------
D5DQR5_BACMQ          ------------------------------------------------------------
B7IUK7_BACC2          ------------------------------------------------------------
Q9KA07_BACHD          ------------------------------------------------------------
Q5WFM8_BACSK          ------------------------------------------------------------
Q7ZAM6_OCEIH          ------------------------------------------------------------
D6XTT7_BACIE          ------------------------------------------------------------
Q81ZN4_ENTFL          ------------------------------------------------------------
A0A0E0UX46_LISMM      ------------------------------------------------------------
B1HQH6_LYSSC          ------------------------------------------------------------
C6D303_PAESJ          ------------------------------------------------------------
C0ZFN9_BREBN          ------------------------------------------------------------
C8WWA4_ALIAD          ------------------------------------------------------------
D5WPA2_KYRT2          ------------------------------------------------------------
C4L5Z7_EXISA          ------------------------------------------------------------
B1YIN0_EXIS2          ------------------------------------------------------------
D3R1B0_MAGIU          ------------------------------------------------------------
D2RLB2_ACIFV          ------------------------------------------------------------
D1BLY1_VEIPT          ------------------------------------------------------------
A5UQ60_ROSS1          ------------------------------------------------------------
B8G556_CHLAD          ------------------------------------------------------------
A9B100_HERA2          ------------------------------------------------------------
D1C6T1_SPHTD          ------------------------------------------------------------
D7CMX2_SYNLT          ------------------------------------------------------------
Q0AYV7_SYNWW          ------------------------------------------------------------
SMC_LACPL             ------------------------------------------------------------
Q03RT7_LACBA          ------------------------------------------------------------
B2GD41_LACF3          ------------------------------------------------------------
A5VKP1_LACRD          ------------------------------------------------------------
Q03FW9_PEDPA          ------------------------------------------------------------
A0A249N2C3_LACRH      ------------------------------------------------------------
Q38XR7_LACSS          ------------------------------------------------------------
Q1WU99_LACS1          ------------------------------------------------------------
Q04GL1_OENOB          ------------------------------------------------------------
Q03VW6_LEUMM          ------------------------------------------------------------
A0A0U5K8Z4_LACDE      ------------------------------------------------------------
E4SKB3_LACAR          ------------------------------------------------------------
Q74IP9_LACJO          ------------------------------------------------------------
A0A0T8KIP4_STREE      ------------------------------------------------------------
A4VVL7_STRSY          ------------------------------------------------------------
C0MCR5_STRS7          ------------------------------------------------------------
A2RLZ7_LACLM          ------------------------------------------------------------
B9EBB4_MACCJ          ------------------------------------------------------------
SMC_MYCHR             ------------------------------------------------------------
E0TKT8_MYCHH          ------------------------------------------------------------
Q4A770_MYCH7          ------------------------------------------------------------
C5J708_MYCCR          ------------------------------------------------------------
A5IYM7_MYCAP          ------------------------------------------------------------
D5E4P4_MYCCM          ------------------------------------------------------------
Q6KHN4_MYCMO          ------------------------------------------------------------
Q98PK8_MYCPU          ------------------------------------------------------------
D1J8Q8_MYCHP          ------------------------------------------------------------
Q4A588_MYCS5          ------------------------------------------------------------
SMC_MYCGE             ------------------------------------------------------------
SMC_MYCPN             ------------------------------------------------------------
Q7NBU0_MYCGA          ------------------------------------------------------------
Q8EVS6_MYCPE          ------------------------------------------------------------
Q9PR04_UREPA          ------------------------------------------------------------
Q6F1N4_MESFL          ------------------------------------------------------------
Q6MTD2_MYCMS          ------------------------------------------------------------
E3GP81_9FIRM          ------------------------------------------------------------
SMC_HALOH             ------------------------------------------------------------
E4RL35_HALHG          ------------------------------------------------------------
D9QRN7_ACEAZ          ------------------------------------------------------------
A8MHB7_ALKOO          ------------------------------------------------------------
A6TRT3_ALKMQ          ------------------------------------------------------------
A3DDY2_HUNT2          ------------------------------------------------------------
D5X8N2_THEPJ          ------------------------------------------------------------
D9R048_CLOSW          ------------------------------------------------------------
C4Z0E6_EUBE2          ------------------------------------------------------------
C4Z924_AGARV          ------------------------------------------------------------
E0RV40_BUTPB          ------------------------------------------------------------
A9KLR0_LACP7          ------------------------------------------------------------
D9S347_THEOJ          ------------------------------------------------------------
B2A2N3_NATTJ          ------------------------------------------------------------
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             ------------------------------------------------------------
B0C9C4_ACAM1          ------------------------------------------------------------
Q115J3_TRIEI          ------------------------------------------------------------
B2J925_NOSP7          ------------------------------------------------------------
E0UKI1_GLOV7          ------------------------------------------------------------
B7K4Q6_RIPO1          ------------------------------------------------------------
B0JSN6_MICAN          ------------------------------------------------------------
SMC_SYNY3             ------------------------------------------------------------
Q84EC7_SYNP2          ------------------------------------------------------------
D3EQ04_ATETH          ------------------------------------------------------------
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          ------------------------------------------------------------
A9B9B9_PROM4          ------------------------------------------------------------
A2BNJ6_PROMS          ------------------------------------------------------------
Q46EX0_METBF          ------------------------------------------------------------
D7EAF5_METEZ          ------------------------------------------------------------
D1YW78_METPS          ------------------------------------------------------------
A0B8B9_METTP          ------------------------------------------------------------
D4GT30_HALVD          ------------------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          ------------------------------------------------------------
O28714_ARCFU          ------------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             ------------------------------------------------------------
A6UQ42_METVS          ------------------------------------------------------------
A6UVP1_META3          ------------------------------------------------------------
SMC_METJA             ------------------------------------------------------------
C9RFQ3_METVM          ------------------------------------------------------------
D5VT24_METIM          ------------------------------------------------------------
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             ------------------------------------------------------------
C5A612_THEGJ          ------------------------------------------------------------
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             ------------------------------------------------------------
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          ------------------------------------------------------------
SMC_KORVE             ------------------------------------------------------------
C1F1T5_ACIC5          ------------------------------------------------------------
Q01Y77_SOLUE          ------------------------------------------------------------
SMC_MYCPA             ------------------------------------------------------------
SMC_MYCTU             ------------------------------------------------------------
SMC_MYCLE             ------------------------------------------------------------
A4FMG9_SACEN          ------------------------------------------------------------
C8XH72_NAKMY          ------------------------------------------------------------
D7GEI0_PROFC          ------------------------------------------------------------
Q2J6Z3_FRACC          ------------------------------------------------------------
A8L599_FRASN          ------------------------------------------------------------
C9Z3S1_STRSW          ------------------------------------------------------------
D7CC86_STRBB          ------------------------------------------------------------
B1VYX5_STRGG          ------------------------------------------------------------
E4NHH3_KITSK          ------------------------------------------------------------
C7QGY1_CATAD          ------------------------------------------------------------
A0LV82_ACIC1          ------------------------------------------------------------
A0JXV4_ARTS2          ------------------------------------------------------------
A1R7H8_PAEAT          ------------------------------------------------------------
A6W7T9_KINRD          ------------------------------------------------------------
D1BJA3_SANKS          ------------------------------------------------------------
C7NGM6_KYTSD          ------------------------------------------------------------
B2GFM7_KOCRD          ------------------------------------------------------------
E1VVN2_GLUAR          ------------------------------------------------------------
A5CQQ2_CLAM3          ------------------------------------------------------------
Q6AE90_LEIXX          ------------------------------------------------------------
D1AB24_THECD          ------------------------------------------------------------
D6Y659_THEBD          ------------------------------------------------------------
D7BMZ9_ARCHD          ------------------------------------------------------------
D6ZIF1_MOBCV          ------------------------------------------------------------
C7R311_JONDD          ------------------------------------------------------------
D6ZV06_BIFLJ          ------------------------------------------------------------
Q7ZAJ9_COREF          ------------------------------------------------------------
Q8NNW5_CORGL          ------------------------------------------------------------
Q84F13_CORDP          ------------------------------------------------------------
Q4JUZ1_CORJK          ------------------------------------------------------------
C4LJD3_CORK4          ------------------------------------------------------------
D6Z8M0_SEGRD          ------------------------------------------------------------
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             ------------------------------------------------------------
A7IGT2_XANP2          ------------------------------------------------------------
B8EMM7_METSB          ------------------------------------------------------------
B8IQU0_METNO          ------------------------------------------------------------
Q92RE8_RHIME          ------------------------------------------------------------
A7HQY9_PARL1          ------------------------------------------------------------
D8JUP9_HYPDA          ------------------------------------------------------------
E3I0B2_RHOVT          ------------------------------------------------------------
SMC_RHOS1             ------------------------------------------------------------
Q2W040_MAGSA          ------------------------------------------------------------
D3P3X3_AZOS1          ------------------------------------------------------------
B6IR58_RHOCS          ------------------------------------------------------------
Q2RPA2_RHORT          ------------------------------------------------------------
SMC_CAUVN             ------------------------------------------------------------
B0T003_CAUSK          ------------------------------------------------------------
Q0AMJ6_MARMM          ------------------------------------------------------------
E0TC69_PARBH          ------------------------------------------------------------
C6XRC2_HIRBI          ------------------------------------------------------------
Q0C0X5_HYPNA          ------------------------------------------------------------
Q1GQU3_SPHAL          ------------------------------------------------------------
D4YX43_SPHJU          ------------------------------------------------------------
Q2G9S3_NOVAD          ------------------------------------------------------------
D5BSU5_PUNMI          ------------------------------------------------------------
A5FVJ2_ACICJ          ------------------------------------------------------------
C5B6I7_METEA          ------------------------------------------------------------
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          ------------------------------------------------------------
SMC_THASP             ------------------------------------------------------------
A1K715_AZOSB          ------------------------------------------------------------
C7RKG8_ACCPU          ------------------------------------------------------------
Q3SJI0_THIDA          ------------------------------------------------------------
SMC_DELAS             ------------------------------------------------------------
D6CTE6_THIA3          ------------------------------------------------------------
SMC_BORPD             ------------------------------------------------------------
SMC_BURP1             ------------------------------------------------------------
A4SYV7_POLAQ          ------------------------------------------------------------
D5CRW3_SIDLE          ------------------------------------------------------------
D9SGR3_GALCS          ------------------------------------------------------------
Q2YBB9_NITMU          ------------------------------------------------------------
Q0AE88_NITEC          ------------------------------------------------------------
D7DI79_METV0          ------------------------------------------------------------
C1D4R7_LARHH          ------------------------------------------------------------
Q7NR76_CHRVO          ------------------------------------------------------------
A1KSF4_NEIMF          ------------------------------------------------------------
A1WY82_HALHL          ------------------------------------------------------------
Q0AAV4_ALKEH          ------------------------------------------------------------
SMC_XANOR             ------------------------------------------------------------
B8GTL2_THISH          ------------------------------------------------------------
Q3JAH9_NITOC          ------------------------------------------------------------
D3RSW0_ALLVD          ------------------------------------------------------------
B3PGR0_CELJU          ------------------------------------------------------------
A6V7X5_PSEA7          ------------------------------------------------------------
Q0VR03_ALCBS          ------------------------------------------------------------
C7RBE2_KANKD          ------------------------------------------------------------
Q2SD45_HAHCH          ------------------------------------------------------------
E4PL89_MARAH          ------------------------------------------------------------
E1V8E9_HALED          ------------------------------------------------------------
D3SAL9_THISK          ------------------------------------------------------------
SMC_METCA             ------------------------------------------------------------
SMC_COXBU             ------------------------------------------------------------
Q5WTI1_LEGPL          ------------------------------------------------------------
Q12L80_SHEDO          ------------------------------------------------------------
Q080K7_SHEFN          ------------------------------------------------------------
A4Y804_SHEPC          ------------------------------------------------------------
D4ZIY3_SHEVD          ------------------------------------------------------------
B0TKB4_SHEHH          ------------------------------------------------------------
A3QFJ7_SHELP          ------------------------------------------------------------
A1S5R5_SHEAM          ------------------------------------------------------------
Q5QUJ9_IDILO          ------------------------------------------------------------
E1SMV2_FERBD          ------------------------------------------------------------
F2GBA5_ALTMD          ------------------------------------------------------------
Q15UZ3_PSEA6          ------------------------------------------------------------
Q3IKC0_PSET1          ------------------------------------------------------------
A4SKA4_AERS4          ------------------------------------------------------------
D0KWM8_HALNC          ------------------------------------------------------------
A0A2W1K6W8_ACIFR      ------------------------------------------------------------
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          ------------------------------------------------------------
A1AU91_PELPD          ------------------------------------------------------------
B9M6F0_GEODF          ------------------------------------------------------------
Q39WG2_GEOMG          ------------------------------------------------------------
B5EFS9_GEOBB          ------------------------------------------------------------
Q3A212_PELCD          ------------------------------------------------------------
A9FIZ2_SORC5          ------------------------------------------------------------
D0LY52_HALO1          ADDAEAGADTAEASADTAEAAPDTATASADDADAGEPGANASVAPTGIPSLDGEEAGMSA
Q1D2R5_MYXXD          ------------------------------------------------------------
B4UDF6_ANASK          ------------------------------------------------------------
Q6MNS9_BDEBA          ------------------------------------------------------------
A9A0M3_DESOH          ------------------------------------------------------------
B8FHS3_DESAL          ------------------------------------------------------------
E1QL74_DESB2          ------------------------------------------------------------
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ------------------------------------------------------------
B1ZZB8_OPITP          ------------------------------------------------------------
SMC_DESHY             ------------------------------------------------------------
A4J682_DESRM          ------------------------------------------------------------
Q67PF3_SYMTH          ------------------------------------------------------------
B0TGW8_HELMI          ------------------------------------------------------------
Q2RJX0_MOOTA          ------------------------------------------------------------
SMC_BACSU             ------------------------------------------------------------
C5D8T7_GEOSW          ------------------------------------------------------------
D5DQR5_BACMQ          ------------------------------------------------------------
B7IUK7_BACC2          ------------------------------------------------------------
Q9KA07_BACHD          ------------------------------------------------------------
Q5WFM8_BACSK          ------------------------------------------------------------
Q7ZAM6_OCEIH          ------------------------------------------------------------
D6XTT7_BACIE          ------------------------------------------------------------
Q81ZN4_ENTFL          ------------------------------------------------------------
A0A0E0UX46_LISMM      ------------------------------------------------------------
B1HQH6_LYSSC          ------------------------------------------------------------
C6D303_PAESJ          ------------------------------------------------------------
C0ZFN9_BREBN          ------------------------------------------------------------
C8WWA4_ALIAD          ------------------------------------------------------------
D5WPA2_KYRT2          ------------------------------------------------------------
C4L5Z7_EXISA          ------------------------------------------------------------
B1YIN0_EXIS2          ------------------------------------------------------------
D3R1B0_MAGIU          ------------------------------------------------------------
D2RLB2_ACIFV          ------------------------------------------------------------
D1BLY1_VEIPT          ------------------------------------------------------------
A5UQ60_ROSS1          ------------------------------------------------------------
B8G556_CHLAD          ------------------------------------------------------------
A9B100_HERA2          ------------------------------------------------------------
D1C6T1_SPHTD          ------------------------------------------------------------
D7CMX2_SYNLT          ------------------------------------------------------------
Q0AYV7_SYNWW          ------------------------------------------------------------
SMC_LACPL             ------------------------------------------------------------
Q03RT7_LACBA          ------------------------------------------------------------
B2GD41_LACF3          ------------------------------------------------------------
A5VKP1_LACRD          ------------------------------------------------------------
Q03FW9_PEDPA          ------------------------------------------------------------
A0A249N2C3_LACRH      ------------------------------------------------------------
Q38XR7_LACSS          ------------------------------------------------------------
Q1WU99_LACS1          ------------------------------------------------------------
Q04GL1_OENOB          ------------------------------------------------------------
Q03VW6_LEUMM          ------------------------------------------------------------
A0A0U5K8Z4_LACDE      ------------------------------------------------------------
E4SKB3_LACAR          ------------------------------------------------------------
Q74IP9_LACJO          ------------------------------------------------------------
A0A0T8KIP4_STREE      ------------------------------------------------------------
A4VVL7_STRSY          ------------------------------------------------------------
C0MCR5_STRS7          ------------------------------------------------------------
A2RLZ7_LACLM          ------------------------------------------------------------
B9EBB4_MACCJ          ------------------------------------------------------------
SMC_MYCHR             ------------------------------------------------------------
E0TKT8_MYCHH          ------------------------------------------------------------
Q4A770_MYCH7          ------------------------------------------------------------
C5J708_MYCCR          ------------------------------------------------------------
A5IYM7_MYCAP          ------------------------------------------------------------
D5E4P4_MYCCM          ------------------------------------------------------------
Q6KHN4_MYCMO          ------------------------------------------------------------
Q98PK8_MYCPU          ------------------------------------------------------------
D1J8Q8_MYCHP          ------------------------------------------------------------
Q4A588_MYCS5          ------------------------------------------------------------
SMC_MYCGE             ------------------------------------------------------------
SMC_MYCPN             ------------------------------------------------------------
Q7NBU0_MYCGA          ------------------------------------------------------------
Q8EVS6_MYCPE          ------------------------------------------------------------
Q9PR04_UREPA          ------------------------------------------------------------
Q6F1N4_MESFL          ------------------------------------------------------------
Q6MTD2_MYCMS          ------------------------------------------------------------
E3GP81_9FIRM          ------------------------------------------------------------
SMC_HALOH             ------------------------------------------------------------
E4RL35_HALHG          ------------------------------------------------------------
D9QRN7_ACEAZ          ------------------------------------------------------------
A8MHB7_ALKOO          ------------------------------------------------------------
A6TRT3_ALKMQ          ------------------------------------------------------------
A3DDY2_HUNT2          ------------------------------------------------------------
D5X8N2_THEPJ          ------------------------------------------------------------
D9R048_CLOSW          ------------------------------------------------------------
C4Z0E6_EUBE2          ------------------------------------------------------------
C4Z924_AGARV          ------------------------------------------------------------
E0RV40_BUTPB          ------------------------------------------------------------
A9KLR0_LACP7          ------------------------------------------------------------
D9S347_THEOJ          ------------------------------------------------------------
B2A2N3_NATTJ          ------------------------------------------------------------
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             -------------------------------------------------------EGE--
B0C9C4_ACAM1          -------------------------------------------------------EAERH
Q115J3_TRIEI          ------------------------------------------------QVPEVEENGYKT
B2J925_NOSP7          ------------------------------------------------EAGDAGDAGEAE
E0UKI1_GLOV7          -------------------------------------------------SSTQQALNNDN
B7K4Q6_RIPO1          -------------------------------------------------QVTVVEDNHSN
B0JSN6_MICAN          ------------------------------------------------------------
SMC_SYNY3             ----------------------------------------------------PGANHNGN
Q84EC7_SYNP2          ----------------------------------------------------TEATEASE
D3EQ04_ATETH          ---------------------------------------------------SLKTIETEE
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          ------------------------------------------------------------
A9B9B9_PROM4          ------------------------------------------------------------
A2BNJ6_PROMS          ------------------------------------------------------------
Q46EX0_METBF          ------------------------------------------------------------
D7EAF5_METEZ          ------------------------------------------------------------
D1YW78_METPS          ------------------------------------------------------------
A0B8B9_METTP          ------------------------------------------------------------
D4GT30_HALVD          ------------------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          ------------------------------------------------------------
O28714_ARCFU          ------------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             ------------------------------------------------------------
A6UQ42_METVS          ------------------------------------------------------------
A6UVP1_META3          ------------------------------------------------------------
SMC_METJA             ------------------------------------------------------------
C9RFQ3_METVM          ------------------------------------------------------------
D5VT24_METIM          ------------------------------------------------------------
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             ------------------------------------------------------------
C5A612_THEGJ          ------------------------------------------------------------
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             ------------------------------------------------------------
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             ---------------LDLDNDTVKITRRIHI-------------------SGENEYLIND
E3H7H1_ILYPC          ---------------LPLEIDDIKVTRRLHK-------------------TGENQYLIND
D1AK68_SEBTE          ---------------LDIDFTDLKITRRIYR-------------------SGENEYLINN
SMC_CLOK1             ---------------LSLEYSNITVSRRLYR-------------------SGESEYYINN
D8GS00_CLOLD          ---------------LPIDYSDVTVSRRLYR-------------------SGESEYYINN
Q97IA1_CLOAB          ---------------LNLDYSEVTVSRRLYR-------------------SGDSEYYINN
A0Q0Y7_CLONN          ---------------LPIDYSEVTIMRRLFR-------------------SGESEYYING
Q895M7_CLOTE          ---------------LPLDYSEIMVSRIIYR-------------------SGESEYLINN
Q0SSA4_CLOPS          ---------------LPLDYLEVKVTRKLFR-------------------SGESEYLINN
A6LSM4_CLOB8          ---------------LATEYNEVVVSRRIFR-------------------SGESEYLINN
D9SLC7_CLOC7          ---------------LPLDYSQVTISRRLFR-------------------SGDSEYYINN
D7APA8_THEM3          ---------------LPFDYTEVVITRKIFR-------------------SGESEFFINK
Q8R9W7_CALS4          ---------------LPFDYNEVVITRKIFR-------------------SGESEFFINK
D9TN88_THETC          ---------------LPLDFTEVVITRKIFR-------------------SGESEFYINK
C9YKI7_CLODR          ---------------LELDFTEVTIRRRAYR-------------------NGESEFFLNN
E3PS49_ACESD          ---------------IDIDYSEISIKRKAFK-------------------SGESQFFLNN
B0S1M4_FINM2          ---------------KDIDYQEITVTRRVFR-------------------TGESEYYINK
Q3AC59_CARHZ          ---------------FPLPYAEIAITRRFFR-------------------SGESEFYINK
E4SF58_CALK2          ---------------LPIDYQEVVITRRLFR-------------------SGESEFFINK
SMC_RHOBA             ------------GGQMPVDAPEVHVTRRVYR-------------------SGEGEYLINQ
D2QWB0_PIRSD          ------------EGRLPIDAPEVHITRRVFR-------------------SGEGEYLINR
D5SU17_PLAL2          ------------SGLLPIETPEVTVGRRIWR-------------------NGEAEYLINR
SMC_KORVE             --AVVLKIRRRKFNTNRFKKGEICVTRRLFR-------------------SGDSEYLLNG
C1F1T5_ACIC5          --AVVLKIRRRKFQRVPQQ-GEIVVTRRLFR-------------------TGESEYLLNG
Q01Y77_SOLUE          ----------------PPKAAEVTITRRLYR-------------------SGESEYLIDG
SMC_MYCPA             ---------------LPIEYSEVSITRRMFR-------------------DGASEYEING
SMC_MYCTU             ---------------LPIEYTEVSITRRMFR-------------------DGASEYEING
SMC_MYCLE             ---------------LPIEYSEVSITRRMFR-------------------DGASEYEING
A4FMG9_SACEN          ---------------LPIEYTEVSITRRMFR-------------------DGASEYEING
C8XH72_NAKMY          ---------------LPIDYAEVSITRRMFR-------------------DGVGEYEING
D7GEI0_PROFC          ---------------LPIDYTEVTISRTLFR-------------------AGGSEYAING
Q2J6Z3_FRACC          ---------------LPIEYTEVTIGRLMFR-------------------SGESEYTING
A8L599_FRASN          ---------------LPIEYSEVTVGRLMFR-------------------SGESEYTING
C9Z3S1_STRSW          ---------------LPIEYSEVTITRIMFR-------------------NGGSEYQING
D7CC86_STRBB          ---------------LPIEYAEVTITRIMFR-------------------NGGSEYQING
B1VYX5_STRGG          ---------------LPIEYAEVTITRIMFR-------------------NGGSEYQING
E4NHH3_KITSK          ---------------LPIDYSEVTITRTMFR-------------------NGGSEYALNG
C7QGY1_CATAD          ---------------LPIDYSEVTISRIMFR-------------------NGGSEYAING
A0LV82_ACIC1          ---------------LPIEYSEVTLSRIMFR-------------------NGGSEYAING
A0JXV4_ARTS2          ---------------LPIEYSEVTISRTLFR-------------------TGGSEYAING
A1R7H8_PAEAT          ---------------LPIEYSEVTISRTLFR-------------------TGGSEYAING
A6W7T9_KINRD          ---------------LPIEFAEVTITRTMFR-------------------TGGSEYAING
D1BJA3_SANKS          ---------------LPIEYAEVTISRTLFR-------------------NGGSEYAING
C7NGM6_KYTSD          ---------------LPIDYSEVTISRTMFR-------------------SGGSEYAING
B2GFM7_KOCRD          ---------------LPIEYSEVTISRTLFR-------------------SGGSEYAING
E1VVN2_GLUAR          ---------------LPIDYAEVTISRTLFR-------------------AGGSEYAING
A5CQQ2_CLAM3          ---------------LPIDYTEVAIRRTLFR-------------------NGGSEYAING
Q6AE90_LEIXX          ---------------LPIEYTEVTISRTLFR-------------------NGGSEYAING
D1AB24_THECD          ---------------LPIDYSEVTISRLMFR-------------------SGQSEYAING
D6Y659_THEBD          ---------------LPIDYTEVTISRLMFR-------------------SGQSEYAING
D7BMZ9_ARCHD          ---------------LPIDYSEVTITRTLFR-------------------AGGSEYAING
D6ZIF1_MOBCV          ---------------LPIEYSEVTISRTMFR-------------------AGGSEYAING
C7R311_JONDD          ---------------LPIEFSEVTITRTLFR-------------------QGGSEYAING
D6ZV06_BIFLJ          ---------------LDIDYTEVTISRTIFR-------------------NGGSEYAING
Q7ZAJ9_COREF          ---------------LPIDYTEVSVTRRMFR-------------------DGASEYEING
Q8NNW5_CORGL          ---------------LPIEYTEVSVTRRMFR-------------------DGASEYEING
Q84F13_CORDP          ---------------LPIEYTEVSVTRRMFR-------------------DGGGEYEING
Q4JUZ1_CORJK          ---------------LPIEYSEVSITRRMFR-------------------DGASEYEING
C4LJD3_CORK4          ---------------LPIDYSEVSITRRVFR-------------------DGGGEYEING
D6Z8M0_SEGRD          ---------------LPIDYTEVAITRRMYR-------------------DGGGEYLING
C8WGU5_EGGLE          ---------------LPVDFDEVAVTRRMYR-------------------SGESEYLING
C7MMZ7_CRYCD          ---------------LPVEYSEVSIARRMYR-------------------SGESEYLING
C7N560_SLAHD          ---------------LPVDYAEVSLTRRMYR-------------------SGESEYLING
E1QVK5_OLSUV          ---------------IPLDFSELAVTRRMYR-------------------SGESEYLING
C8W740_ATOPD          ---------------IPIDFSEIGITRRMYR-------------------SGESEYLING
SMC_RHOPA             ------------APAALNDADTLDISRRIER-------------------EAGSVYRING
A7IGT2_XANP2          ------------APAAFNEWDQLEIVRRIER-------------------GAGSSYRING
B8EMM7_METSB          ------------APAAFNDSDAIEVSRRIER-------------------ESGSTYRVNG
B8IQU0_METNO          ------------APAAFNGADVLEVMRRIDR-------------------GAGSTYRING
Q92RE8_RHIME          ------------APAAFNDSDEIQVTRRIER-------------------EQGSVYRING
A7HQY9_PARL1          ------------APPAYNDSEVIEVSRKIER-------------------DQGSTYRING
D8JUP9_HYPDA          ------------APAEFNDNDTIEITRRIER-------------------EAGSAYRING
E3I0B2_RHOVT          ------------APAAFNDADVLEISRRIQR-------------------EAGSVYKVNG
SMC_RHOS1             ------------APAGFNDADTIEIVRRITR-------------------DAGSAYKANT
Q2W040_MAGSA          ------------APPQFD-RDEIEVMRRIER-------------------GNGSNYRING
D3P3X3_AZOS1          ------------APAGFNDHDELEITRRIER-------------------GSGSDYRING
B6IR58_RHOCS          ------------APAQFNDWPELEVTRKLER-------------------ASGSDYRING
Q2RPA2_RHORT          ------------APALFNAAQELEVTRRIAR-------------------GDGSLYRVNG
SMC_CAUVN             ------------APAQFNDDPILEVVRRIDR-------------------GEGSTYRING
B0T003_CAUSK          ------------APAQFNDDPVLEVVRRIDR-------------------GEGSTYRING
Q0AMJ6_MARMM          ------------APARFNDADTLDVTRRITR-------------------GAGSAYKING
E0TC69_PARBH          ------------APDAYNDQPLIEVSRRITKKAE----------------GTQSTYRING
C6XRC2_HIRBI          ------------APAELNDSDELEVKRRLRR-------------------GAGSTYKING
Q0C0X5_HYPNA          ------------APPEFNGADLLEIERKLKR-------------------GAGSSYRING
Q1GQU3_SPHAL          ------------GLSDGGDGDDLEIIRRIER-------------------GAGSAYRANG
D4YX43_SPHJU          ------------NAVEVAADGELEVTRRIER-------------------GAGSAYRANG
Q2G9S3_NOVAD          ----------------GPFGGELEVVRRIER-------------------GAGSAYRVNG
D5BSU5_PUNMI          ------------APAEFNNDDELEITRKIER-------------------GKGSSYYVNA
A5FVJ2_ACICJ          ------------APVPFQNEPELQVSRKIER-------------------GSGSSYRING
C5B6I7_METEA          -------------------GGRLMVRRRIER-------------------GEGSSYWFAE
Q937L3_DEIRD          ---------------------RLNVTRRIYR-------------------DGSGEQDLGG
Q1J060_DEIGD          ---------------------RVNVTRRVYR-------------------DGTGEQDLNG
L0A7J5_DEIPD          ---------------------RLNLARRVYR-------------------DGSAEQDLDG
D7BH70_MEISD          ---------------------RLTVSRRLDR-------------------DGEAEVRLGH
SMC_THASP             --------------GQWSRYAEISVKRVLDR-------------------SGESTYYINN
A1K715_AZOSB          --------------GQWSRYAEISVKRVLDR-------------------SGESTYFINN
C7RKG8_ACCPU          --------------GQWSQYAELSVKRLLTR-------------------SGQSEYYINN
Q3SJI0_THIDA          --------------GQWSQYAEIAVKRVLDR-------------------SGDSTYYINN
SMC_DELAS             --------------GQWGQFGEIAVKRVLTR-------------------EGNSSYFINN
D6CTE6_THIA3          --------------GQWGQFTEIAIKRVLTR-------------------DGTSSYFINN
SMC_BORPD             --------------GQWSTYSEIAVRRVLTR-------------------DGTSSYYVNN
SMC_BURP1             --------------GQWGQYGEIAVKRVLTR-------------------DGTSSYYINN
A4SYV7_POLAQ          --------------GQWGAFTELGIKRVLTR-------------------DGNSSYYVNN
D5CRW3_SIDLE          --------------GQWATYAEISIKRVLQR-------------------DGDSSYYINN
D9SGR3_GALCS          --------------GQWASYAEISIKRVLLR-------------------NGDSSYYINS
Q2YBB9_NITMU          --------------GQWSSYAEICIKRVLRR-------------------DGESTYYINN
Q0AE88_NITEC          --------------GQWKAYNEIAIRRVLQR-------------------DGESSYYINN
D7DI79_METV0          --------------GEWSQYAEISVKRVIER-------------------DKGSTYYINN
C1D4R7_LARHH          --------------GAWGQYGEIAIKRVLTR-------------------QGDSSYWING
Q7NR76_CHRVO          --------------GPWGQYAEVAIKRVLTR-------------------QGESSYYINS
A1KSF4_NEIMF          --------------GAWGQYAEVSIKRQLTR-------------------QGESTYFINN
A1WY82_HALHL          --------------GQYAAYNEISVKRQVNR-------------------EGQSQYSLNG
Q0AAV4_ALKEH          --------------GQYAQYGEIAVRRQVNR-------------------EGQSQYFLNG
SMC_XANOR             --------------GEFASFNEISVKRLVSR-------------------DGNSAYYLNG
B8GTL2_THISH          --------------GQYAEYSEISVKRQVTR-------------------DGQSHYYLNG
Q3JAH9_NITOC          --------------GQYAAYNEIAIKRQVSR-------------------DGQSCYFLNG
D3RSW0_ALLVD          --------------GEYAAFDQISVKRQVAR-------------------DGQSSYFLNG
B3PGR0_CELJU          --------------GEYASFTEISIKRKVTR-------------------DGENSYYLNG
A6V7X5_PSEA7          --------------GEYARYAEISIRRRVSR-------------------DGQNTYFLNG
Q0VR03_ALCBS          --------------GEYGKFNEISVKRQVTR-------------------DGQSNYFLNN
C7RBE2_KANKD          --------------GEFANYNEISVKRMVNR-------------------EAQSSYFLNG
Q2SD45_HAHCH          --------------GEFSRYNEISVKRKVTR-------------------DAQSLYFLNG
E4PL89_MARAH          --------------GEFVKFNEISVRRRVSR-------------------EGQSEYFLNG
E1V8E9_HALED          --------------GPYAQYAEISVKRQVTR-------------------EGQSSYFFNG
D3SAL9_THISK          --------------GEYSAYGEIAVRRALTR-------------------DGQSKYFLNG
SMC_METCA             --------------GEYARYQQIAIRRQVAR-------------------DGQSSYFLNG
SMC_COXBU             --------------GEYAKYGEIAIRREVER-------------------DGQSNYFING
Q5WTI1_LEGPL          --------------GPFASYGEIAVKRVVTR-------------------DGESFYYLNG
Q12L80_SHEDO          --------------GQYASYQEISVKRQVSR-------------------DGDSFYFLNG
Q080K7_SHEFN          --------------GQYASYQEISVKRQVNR-------------------DSESSYFLNG
A4Y804_SHEPC          --------------GQYASYEEISVKRQVSR-------------------DGESWYFLNG
D4ZIY3_SHEVD          --------------GEYSSYQEIAIKRQVSR-------------------DGDSSYFLNG
B0TKB4_SHEHH          --------------GQYSSYQEIAVKRQVSR-------------------DGDSSYFLNN
A3QFJ7_SHELP          --------------GQYASYQAIAVKRQVSR-------------------DGESSYFLNG
A1S5R5_SHEAM          --------------GQYASYEEIAVKRQVSR-------------------DGESLYFLNG
Q5QUJ9_IDILO          --------------GEYAAFNEISVKRLVTR-------------------DGQSNYFLNG
E1SMV2_FERBD          --------------GQYASYAEIAVKRQVTR-------------------DGQSNYFLNG
F2GBA5_ALTMD          --------------GEFANYNELSVKRLVTR-------------------DATSTYFLNG
Q15UZ3_PSEA6          --------------GEFASYNEISVKRLVTK-------------------DGQSSYFLNN
Q3IKC0_PSET1          --------------NTFADRNQIAIKRLVTR-------------------DGQSLYFLNG
A4SKA4_AERS4          --------------GEFGRFTEISVRREVLR-------------------DGSNHYQING
D0KWM8_HALNC          --------------GPFGAYDQIVICRSLGR-------------------DGQSRYSINQ
A0A2W1K6W8_ACIFR      --------------GAFAGAAEISVRRSLDR-------------------KGDGHYRING
A0A0J1A050_ACIBA      --------------GAYNAYNELAVRRQVTR-------------------EGKSEYFLNG
B3E294_GEOLS          --------------AKYLEFSEIQLTRRLYR-------------------DGESEYLINK
A1AU91_PELPD          --------------AKYLEYSEIQLTRRLYR-------------------DGDSDYLINR
B9M6F0_GEODF          --------------AKYLTYSEIQVTRRLYR-------------------DGESEYLLNK
Q39WG2_GEOMG          --------------AKYLNYSEIQVTRRLYR-------------------DGESDYFLNK
B5EFS9_GEOBB          --------------AKYLNFSEIQVTRRLYR-------------------DGDSDYLLNK
Q3A212_PELCD          --------------VAVRDYAEFMVTRRLYR-------------------NGDSEYLLNK
A9FIZ2_SORC5          --------------LEYRDYAEIAVTRRLFR-------------------DGTSEYLINK
D0LY52_HALO1          SEEVQEFLEDKPPAFDFASYSEVTITRRLFR-------------------DGTSQYLINR
Q1D2R5_MYXXD          --------------PQYQGFSEVTVTRRLFR-------------------NGDSEYLINK
B4UDF6_ANASK          --------------PQYQGFGEITVGRRLFR-------------------TGESEYLVNG
Q6MNS9_BDEBA          --------------AKYIKHSEIMVTRRLHR-------------------NGEGEYFINK
A9A0M3_DESOH          --------------EELRHLTEIMITRRLYR-------------------SGEREYLLNK
B8FHS3_DESAL          --------------EEYRDFSEIMVTRRLFR-------------------SGERGYFINK
E1QL74_DESB2          --------------PQYADLAEIMVTRRLYR-------------------NGESDYQINR
B3EFQ6_CHLL2          ------------LPTEY---TEVTVTRRLYR-------------------NGESDYLLNQ
A1BDT4_CHLPD          ------------LPTEY---TEVTVTRRLYR-------------------NGDSDYLLNQ
A4SG64_CHLPM          ------------LPTQY---TEVTVTRRIYR-------------------NGESDFLLNQ
SMC_CHLTE             ------------LPTEY---TEVTVTRRLYR-------------------NGDSDYLLNM
Q3ATI3_CHLCH          ------------LPLEY---TEVTITRRLYR-------------------NGESEFFLNQ
B4S519_PROA2          ------------LPIEY---SEVTITRRIYR-------------------SGESEYLLNQ
B3EM83_CHLPB          ------------LPTEY---TEVTVTRRVYR-------------------NGESDYLLNQ
B3QRZ4_CHLT3          ------------LPTEY---SEVTLTRRLYR-------------------SGESEYFLNK
D0MFL5_RHOM4          ------------LPLHY---SEVTIGRRLYR-------------------SGESEYLLNG
Q2S457_SALRD          ------------LPTEY---AEVTIGRRLFR-------------------DGTSEYLMNG
C7PLU2_CHIPD          ------------LPTEF---TTVTITRKFYK-------------------NGDSEYRLND
E4TVF1_MARTH          ------------LPTEY---SNVTITRRYYR-------------------TGESEYLLNG
B2KBE7_ELUMP          ------------LPLDF---NEITVSRKIFR-------------------SGESEYFLNK
B1H0P2_ENDTX          ------------LPVDY---SEVIITRRLFR-------------------SGESEYFINK
E4TEW8_CALNY          ------------LAGKWGSFSEIEISRKYYR-------------------DGEREYFINN
D3PDY1_DEFDS          ------------IAEKWGTLSEISITRKYYR-------------------TGEREYLING
D4H2V6_DENA2          ------------LTAKWGSFSEITVSRKHYR-------------------TGDREYRING
D6YSC9_WADCW          ------------LKTEY---DEVAVTRRIHR-------------------SGESDYLINK
Q04TU9_LEPBJ          ------------IKMDY---PSVKMTRRLYL-------------------DGNNEYCIND
E1R6H6_SEDSS          ------------LPIEI---PEIEVKRRLHR-------------------SGESEYFINS
Q73ML2_TREDE          ------------LNLDL---SEIAIKRRLYR-------------------SGESEYFINN
A0A0H3BKB7_TREPS      ------------LSLDV---PEILIKRRLYR-------------------SGESEYFLNG
E0RSK7_SPITD          ------------LPLDF---DEIAIRRRVYR-------------------SGESEYAINN
D5EMY0_CORAD          ------------LGTAF---NEVEISRRVTR-------------------EGGSDYYING
B1ZZB8_OPITP          ------------LGSEY---HEIEITRRVYR-------------------DGQSEYFFNG
SMC_DESHY             ---------------FPLEYQEVIITRRVYR-------------------DGEGQYFINR
A4J682_DESRM          ---------------FSLPYEEVSVTRRLYR-------------------SGESEYLINK
Q67PF3_SYMTH          ---------------LPLDFTEVMITRRVDR-------------------SGEGEYFINQ
B0TGW8_HELMI          ---------------LPVDYREVTVTRRVFR-------------------SGESDYLLNR
Q2RJX0_MOOTA          ---------------LPLDFQEVAITRRFFR-------------------SGEGEYYINK
SMC_BACSU             ---------------LPIDFHEVSVTRRVYR-------------------SGESEFLINN
C5D8T7_GEOSW          ---------------LPLDYQEVSITRRVYR-------------------SGESEFFINK
D5DQR5_BACMQ          ---------------LPLDYHEVSITRRVYR-------------------SGDSEFFINN
B7IUK7_BACC2          ---------------LPIEYNEVCVTRRVSR-------------------SGDSDFYINK
Q9KA07_BACHD          ---------------IPIDYSEVSVTRRVYR-------------------SGESEYLLNR
Q5WFM8_BACSK          ---------------LAIDYSEVSVTRRLYR-------------------SGESEYLINR
Q7ZAM6_OCEIH          ---------------VPLDYEEVSVTRRVYR-------------------SGESEFYINK
D6XTT7_BACIE          ---------------VPIDYSEVVVTRRLYR-------------------SGESEYLLNK
Q81ZN4_ENTFL          ---------------LALDYSEISVTRRLKR-------------------TGESDFFINK
A0A0E0UX46_LISMM      ---------------LPLDYSEVAVTRRIYR-------------------NGDSEFLINK
B1HQH6_LYSSC          ---------------LAFSYTEVSVTRRVYR-------------------SGDSEYLLNN
C6D303_PAESJ          ---------------LPLEYNEVTVTRRVHR-------------------SGDSEYMINK
C0ZFN9_BREBN          ---------------LDVEYSEVSVTRRVYR-------------------SGDSEYYINN
C8WWA4_ALIAD          ---------------LPVTFEEVTITRRAFR-------------------SGESEYWINR
D5WPA2_KYRT2          ---------------LPLDYREITVTRRLYR-------------------SGESEYRLNR
C4L5Z7_EXISA          ---------------LRLPYEEVSVTRRVTR-------------------SGDSDYFMNK
B1YIN0_EXIS2          ---------------VALPYQEINVTRRVTR-------------------NGDSDYFLNK
D3R1B0_MAGIU          ---------------IDLPYNEVSVTRRLYR-------------------SGESEYRINK
D2RLB2_ACIFV          ---------------LPVDFDEVSLQRRVFR-------------------SGDSEYIING
D1BLY1_VEIPT          ---------------LDIDMAEVAITRRIYR-------------------TGESEFLINK
A5UQ60_ROSS1          ---------------LSAPYGEVTITRRATR-------------------SGDQEYFINR
B8G556_CHLAD          ---------------LPLDFDEVTITRRVTR-------------------TGENEYFINR
A9B100_HERA2          ---------------LPLDFNEVTITRRSFR-------------------SGENEYFLNK
D1C6T1_SPHTD          ---------------LPLPFSEITITRRAYR-------------------SGENQYFING
D7CMX2_SYNLT          ---------------LPLDFAEVSVTRKVHR-------------------SGESEFYINR
Q0AYV7_SYNWW          ---------------LPLDFSEITLGRKVHR-------------------SGESEFYLNK
SMC_LACPL             --------------------AEVSITRKLFR-------------------NGDSDYLINN
Q03RT7_LACBA          --------------------TELTISRLLYR-------------------SGDSEYQLNG
B2GD41_LACF3          --------------------TELTVTRRLYR-------------------NGDSEYLVND
A5VKP1_LACRD          --------------------TELTITRKIYR-------------------NGDSEYLIND
Q03FW9_PEDPA          --------------------DEVMISRRLFR-------------------NGESQYELNR
A0A249N2C3_LACRH      --------------------AEVSVTRRLYR-------------------DGTSEFLLNN
Q38XR7_LACSS          --------------------DNVTLTRRLFR-------------------NGDSEFYLNQ
Q1WU99_LACS1          --------------------NEIRITRRIFR-------------------SGDSEFFINE
Q04GL1_OENOB          --------------------DEVQISRRLYR-------------------NGDAEYLING
Q03VW6_LEUMM          --------------------NEIRITRKLYR-------------------SGESSYLING
A0A0U5K8Z4_LACDE      --------------------DQVSITRRILK-------------------SGDNEYLINQ
E4SKB3_LACAR          --------------------DQVSITRRILR-------------------SGDSEFLINN
Q74IP9_LACJO          --------------------DEVVVTRKILR-------------------NGESDYLLNH
A0A0T8KIP4_STREE      --------------------QEIRVERHIYR-------------------SGDSEYKIDG
A4VVL7_STRSY          --------------------KEIKVERHIYR-------------------SGDSEYLIDG
C0MCR5_STRS7          --------------------KEIRVERHIYR-------------------NGDSDYLIDG
A2RLZ7_LACLM          -------------------IEEVVITRRLYR-------------------NGDSEFLMNG
B9EBB4_MACCJ          --------------------DKVLITRKLFR-------------------SGESEYFLNH
SMC_MYCHR             -------------------QIFTISRLLKRG-------------------QGTNEYFYND
E0TKT8_MYCHH          -------------------QIFTISRLLKRG-------------------QGTNEYFYND
Q4A770_MYCH7          -------------------QIFTISRVIKRG-------------------QGTNEYFYND
C5J708_MYCCR          -------------------RVFTVARVLKRG-------------------QGSNEYLYND
A5IYM7_MYCAP          -------------------ETITISRVLERG-------------------SGINQYYLNG
D5E4P4_MYCCM          -------------------EIITISRVLERG-------------------KGANQYYING
Q6KHN4_MYCMO          -------------------KTITISRVVERG-------------------KGNNLYFVNG
Q98PK8_MYCPU          -------------------KVFTITRELERG-------------------KGSNIYYIND
D1J8Q8_MYCHP          -------------------DVFTISRVLTRG-------------------NGSNEYYING
Q4A588_MYCS5          -------------------DYITITRKITRA-------------------KNVNEYYLNG
SMC_MYCGE             -------------------KEISVMRRVYRG-------------------SGQSEYFINS
SMC_MYCPN             -------------------PEISVMRRIYRG-------------------SGQSEYYING
Q7NBU0_MYCGA          -------------------KEITVTRRVYRG-------------------SGVSEYLINN
Q8EVS6_MYCPE          -------------------DEVSVSRKLHRG-------------------NGNNEYYING
Q9PR04_UREPA          -------------------KEIKISRVLNIK-------------------TNENTYYIND
Q6F1N4_MESFL          -------------------DVVEITRRFNKK-------------------TRDSDFFING
Q6MTD2_MYCMS          -------------------DVVEITRKFDKN-------------------TRESEFYINS
E3GP81_9FIRM          --------------------DEIVITRRLFR-------------------SGESEYRMNQ
SMC_HALOH             ---------------LPLDVSTVKISRKVNM-------------------DGQSDYYLNG
E4RL35_HALHG          ---------------LPVEGDELTLGREVDI-------------------DGKSDYLING
D9QRN7_ACEAZ          ---------------LPIDYNEVTLGRRVTR-------------------SGKSEYLINN
A8MHB7_ALKOO          ---------------LPIDYSEVRITRRVYR-------------------SGDSEYFLNK
A6TRT3_ALKMQ          ---------------FPLDYNEITITRRVYR-------------------SGESEYFLNK
A3DDY2_HUNT2          ---------------LPIDFSEVTVTRRVYR-------------------SGESEYMINK
D5X8N2_THEPJ          ---------------FPVEYSEVTVTRRVFR-------------------SGESEFFINK
D9R048_CLOSW          ---------------LAIDYDQVTVSRRVYR-------------------SGESEYMING
C4Z0E6_EUBE2          ---------------LPVDYDEVTVSRRVYR-------------------SGESEYLING
C4Z924_AGARV          ---------------LAIDFNEVTVARRVYR-------------------SGESEYLING
E0RV40_BUTPB          ---------------LAIDYDEVTVSRRLYR-------------------SGESEYMING
A9KLR0_LACP7          ---------------LPIEYEEVTVSRRVYR-------------------SGESEYMING
D9S347_THEOJ          ---------------LPLEYSEICITRRVFR-------------------SGESEFYLNK
B2A2N3_NATTJ          ---------------LGLDYDEVTIKRKYYR-------------------SGDSEYFLNK
A8F8R1_PSELT          ----------------------LVVSRLLTS-------------------DGKNQYMLNG
A5IN04_THEP1          ----------------------ITVARELKR-------------------TGENTYYLNG
C5CIS4_KOSOT          ----------------------ITIGREITR-------------------DGLSQYSIND
A7HMD4_FERNB          ----------------------VSIARELSR-------------------DGTGKYLLNG
B7IHN5_THEAB          ----------------------YKIARKLDA-------------------SGENTYYLNG
SMC_THEEB             -------------------ETEWRVTRRLRVTK---------------QGSYTSTYAVND
Q2JHS4_SYNJB          -------------------PREWKVSRRLRVRPGKAEELARDSGTESFSLPYTSTFYIND
SMC_SYNP6             ------------GTGLQPGMAEWTVSRKLRVTP---------------SGTYTSTYAMNG
B0C9C4_ACAM1          TDTSTVSVIPKPDTETNLAPNEWQVTRKLRVTK---------------QGTYTSSYAING
Q115J3_TRIEI          RETKDPFEITNSFDSL----LEWSISRRLRVTK---------------QGTYTSTYYMNG
B2J925_NOSP7          EEPKSKIVRLSEAEVQKPKSAEWSVTRRLRVTH---------------QGSYTSNYYING
E0UKI1_GLOV7          GHS---------DSPKPL--TEWTVTRRLRVTS---------------GGNYSSTYYIND
B7K4Q6_RIPO1          GHHLPDAEETPIDNKKLVRNSEWTVTRRLRVTK---------------GGSYSSNYYING
B0JSN6_MICAN          --------------------RDWTVSRRLKVAK---------------GGSYTSTYYING
SMC_SYNY3             GNG-------------AKISKEWTVTRRLKVTK---------------GGNYSSNYYING
Q84EC7_SYNP2          LKE----------FLAQFQSHDWTVTRKLRVTK---------------SGSYASTYYIND
D3EQ04_ATETH          ENN-------------LINKTEWKVTRRLRVTK---------------GGSYSSNYYINE
SMC_GLOVI             --------------------GELTVCRRLKVNG----------------PNSTSSYQLNG
A5GQT1_SYNR3          ------------GPWIKAGQTEWTVTRRLRVAP---------------GGTYSTSYSADG
A9B9B9_PROM4          ------------GPWIKPDQKQWTVTRRLRVMP---------------GGSYSSIYSADG
A2BNJ6_PROMS          ------------EIALNKGQKEWLVSRKLRLMP---------------GGSYASTYTSDG
Q46EX0_METBF          -------------------LDEIEVSRKVRRTK----------------NGYYSYFYFNG
D7EAF5_METEZ          -------------------ADEVEITRKIKETG----------------SGYYSYFYFNG
D1YW78_METPS          -------------------QDEVTITRRIKSSD----------------SGYYSYYYFNE
A0B8B9_METTP          -------------------SDEVVITRRIKVNG----------------ERYHAQHYLNG
D4GT30_HALVD          ---------------KVGGVEEITIKRRVKETP----------------DNYYSYYYLNE
A7IAD8_METB6          --------------------DGTKIRRRIKRTG----------------NGYYSYNYLND
A3CWK7_METMJ          --------------------DGTTIRRRIKRTP----------------TGYYSYNYLNN
B8GG37_METPE          --------------------DGTTIRRKIKRTA----------------AGYYSYNYMNN
E1RII6_METP4          --------------------DGTKVRRKIKRTP----------------HGYYSYNYLDD
Q2FLH3_METHJ          --------------------DGTNIRRRIKRTE----------------NTYYNYLYLNG
A2SS75_METLZ          --------------------DETKIRRRIKRTA----------------NGYYSYYYLNE
D3RYW2_FERPA          ----------------------VEVKRRIKVTE----------------SGYYSYYYINS
O28714_ARCFU          ----------------------YEIARKVKITE----------------KGYYSYYYLNG
D2RFP2_ARCPA          ----------------------YIVRRRVKKTD----------------KGYYSYYYING
SMC_THEAC             --------------------RSLVIERRLVIED-----------------EPKSYYYVNG
Q97AI9_THEVO          --------------------KSLEISRRLVIED-----------------EPKSYYYVNG
SMC_METVO             -------------REIPIDSDKVGICRKVKLNG-------------------DNNYYVVW
A6UQ42_METVS          -------------RRMPVDSDKVGISRKVKING-------------------DNNYYLLW
A6UVP1_META3          -------------RKIPIDSDKIGISRKVKLKG-------------------DNNYYLIW
SMC_METJA             -------------NAFNVNADKVGILRRIKSSG-------------------ETDYYLVW
C9RFQ3_METVM          -------------KTFNINADRVGILRRIKKSG-------------------ESNYYLIW
D5VT24_METIM          --------------------EEFGISRKVKKSG-------------------ETAYYFIK
D3SQ87_THEAH          --------------AFPTEDSHVVISRKVYPDG-------------------RSVFRING
D3DG53_HYDTT          --------------TFPLEDSIIVISRKVDKDG-------------------RSIFRING
SMC_AQUAE             --------------AFPVEDEEVVISRKVSKDG-------------------RSIFKING
B4U7R1_HYDS0          --------------IFGYDE--FVVTRIIYKDG-------------------KSVYKLNG
C0QSN8_PERMH          --------------AFPLNDEEVSIYRKVEHNG-------------------KSTYRING
B2V736_SULSY          --------------AFPINSEEVRISRKVELSG-------------------KSTYKING
SMC_PYRFU             --------------GFPIDEDEVVIRRRVYPDG-------------------RSSYWLNG
C5A612_THEGJ          --------------GFPIDEDEVVIKRRVYPDG-------------------RSTYWLNG
D1CC09_THET1          ---------------IPLPYEEISITRRAYR-------------------SGENEYLING
D3TAQ9_ACIB4          ---------------LPLDEDEVKLTRYIKRANN--------------ELGYNSYFYIND
SMC_HALMS             ---------HIHIGNKVSSPSEIQLTRKLYR-------------------NGETEYRINN
Q6L0R1_PICTO          --------------------NLYSIKREIKKENG----------------EYKSNYYINN
C1A7M6_GEMAT          ---------------LPVPFKEVVITRRLLR-------------------SGESEYLLNR
C9RN51_FIBSS          ---------------LASDYSEVIVTRRVHR-------------------DGSGEYLINN
D1B5Z0_THEAS          --------------------MSTSISRRVQQ-------------------DGTTAVFVDG
                                                                                  

SMC_FUSNN             ----------------------------TKSRLKEIGTLFLDTGIGKTAYSVIGQGKVER
E3H7H1_ILYPC          ----------------------------TKARLKDISELFLDTGVGKSAYSVIGQGKVER
D1AK68_SEBTE          ----------------------------RKIRLKDINNLFMDTGIGKQAYSIIGQGRVEK
SMC_CLOK1             ----------------------------VQCRLRDIHELFMDTGIGREGYSIIGQGRIDA
D8GS00_CLOLD          ----------------------------TQCRLKDVNELFMDTGIGREGYSIIGQGKIDA
Q97IA1_CLOAB          ----------------------------TKCRLKDIQELFMDTGIGKEGYSIIGQGKIEA
A0Q0Y7_CLONN          ----------------------------TKCRLKDIQELFMDTGIGKEGYSIIGQGKIEA
Q895M7_CLOTE          ----------------------------NKCRLKDIQELFMDTGIGKEGYSIIGQGKIDA
Q0SSA4_CLOPS          ----------------------------SPCRLKDVVNLFMDTGIGKEGYSLIGQGKIDS
A6LSM4_CLOB8          ----------------------------SKCRLKDVINLFMDTGIGKEGYSLIGQGKIEA
D9SLC7_CLOC7          ----------------------------TKCRLKDIHELFMDTGIGKEGYSIISQGKIEA
D7APA8_THEM3          ----------------------------TPCRLRDIYELFLDTGVGKEGYSIIGQGRIDE
Q8R9W7_CALS4          ----------------------------TPCRLKDVHELFLDTGIGKEGYSVIGQGKIDE
D9TN88_THETC          ----------------------------TQCRLKDVYELFMDTGIGRDGYSIIGQGKIDE
C9YKI7_CLODR          ----------------------------KSCRLKDIKEVFLDTGIGKDGYSIIEQGKVDE
E3PS49_ACESD          ----------------------------KQCRLKDIKELLLDTGIGREGYSIISQGKIDE
B0S1M4_FINM2          ----------------------------NQVRLKDVKELFLNTGIGKEGYSVIGQGKIDE
Q3AC59_CARHZ          ----------------------------SPCRLKDIHELLVDTGLGKHGYAIIGQGQVDE
E4SF58_CALK2          ----------------------------IPCRLKDVYELFLDSGLGKDGYSIISQGRVDE
SMC_RHOBA             ----------------------------QAVRLKDVKALIRGTGIGIDAYSLIEQGKVDR
D2QWB0_PIRSD          ----------------------------QPARLKDIRDMVRGTGVGVDAYSMIEQGKVDR
D5SU17_PLAL2          ----------------------------QNARLKDVRDLFMGTGAGASAYSIIEQGRVDQ
SMC_KORVE             ----------------------------KLSRLRDVHDIFMGTGLGPESYAIIEQGRIGQ
C1F1T5_ACIC5          ----------------------------KLCRLRDIQDIFMGTGLGPESYAIIGQERIGQ
Q01Y77_SOLUE          ----------------------------RTARLRDIQDLFMGTGLGPESYAIIEQGRIGQ
SMC_MYCPA             ----------------------------SSCRLMDVQELLSDSGIGREMHVIVGQGKLDE
SMC_MYCTU             ----------------------------SSCRLMDVQELLSDSGIGREMHVIVGQGKLEE
SMC_MYCLE             ----------------------------SSCRLMDVQELLSDSGIGREMHVIVGQGKLDQ
A4FMG9_SACEN          ----------------------------NSCRLMDVQELLSDSGIGREMHVIVGQGQLAN
C8XH72_NAKMY          ----------------------------SSCRLLDIQELLSDSGIGREMHVIVGQGQLDA
D7GEI0_PROFC          ----------------------------HTARLLDVQELLSDTGMGREMHVIVGQGQLDQ
Q2J6Z3_FRACC          ----------------------------TGCRLLDIQELMSDSGIGRELHVIVGQGQLDA
A8L599_FRASN          ----------------------------TTCRLLDIQELMSDSGIGRELHVIVGQGQLDA
C9Z3S1_STRSW          ----------------------------DTCRLLDIQDLLSDSGIGREMHVIVGQGRLDS
D7CC86_STRBB          ----------------------------DTCRLLDIQELLSDSGIGREMHVIVGQGQLDS
B1VYX5_STRGG          ----------------------------DTCRLLDIQELLSDSGIGREMHVIVGQGQLDS
E4NHH3_KITSK          ----------------------------TVCRLLDIQELLSDSGIGREMHVIVGQGQLDS
C7QGY1_CATAD          ----------------------------DPCRLLDIQELLSDSGIGREMHVILGQGRLDA
A0LV82_ACIC1          ----------------------------RPCRLLDIQELLSDSGIGREMHVIVGQGQLEE
A0JXV4_ARTS2          ----------------------------AGCRLLDIQELLSDSGLGREMHVIVGQGQLDK
A1R7H8_PAEAT          ----------------------------APCRLLDIQELLSDSGLGREMHVIVGQGQLDR
A6W7T9_KINRD          ----------------------------QNCRLLDVQELLSDSGIGREMHVIVGQGQIDA
D1BJA3_SANKS          ----------------------------SSCRLLDIQDLLSDSGLGREMHVIVGQGQLDA
C7NGM6_KYTSD          ----------------------------TPCRLLDVQELLSDSGIGREMHVIVGQGQLDA
B2GFM7_KOCRD          ----------------------------RSCRLLDIQELLSDSGLGREMHVIVGQGQLDR
E1VVN2_GLUAR          ----------------------------SSCRLLDIQELLSDSGLGREMHVIVGQGQLDR
A5CQQ2_CLAM3          ----------------------------TSCRLLDVQELLSDSGLGREMHVIVGQGRLDN
Q6AE90_LEIXX          ----------------------------QSCRLLDVQELLSDSGLGREMHVIVGQGQLDA
D1AB24_THECD          ----------------------------DPCRLLDVQELLSDSGIGREMHVIVGQGMVDT
D6Y659_THEBD          ----------------------------DPCRLLDIQELLSDTGIGREMHVIVGQGQLDQ
D7BMZ9_ARCHD          ----------------------------NTCRLLDIQELLSDTGMGRQMHVIIGQGRLDH
D6ZIF1_MOBCV          ----------------------------TSVRLLDIQELLSDTGMGREMHVIVGQGQLDR
C7R311_JONDD          ----------------------------APVRLLDIQELLSDTGLGREMHVIVGQGQLDT
D6ZV06_BIFLJ          ----------------------------SQCRLLDIQELLSDTGLGQQMHVIVGQGRLDA
Q7ZAJ9_COREF          ----------------------------ARARLMDIQELLSDSGIGREMHIMVGQGKLAE
Q8NNW5_CORGL          ----------------------------AKARLMDIQELLSDTGIGREMHIMVGQGKLAE
Q84F13_CORDP          ----------------------------HKARLMDIQELLSDSGIGREMHVIVGQGRLSQ
Q4JUZ1_CORJK          ----------------------------AKARLMDIQELLSDSGIGREMHVIVGQGRLSQ
C4LJD3_CORK4          ----------------------------ARARLMDIQELLSDSGIGREMHVIVGQGRLST
D6Z8M0_SEGRD          ----------------------------DSCRLMDVQELLSDSGIGSQMHVIVGQNRLAT
C8WGU5_EGGLE          ----------------------------VVARRMDVLDILHDSGLGTGTHSIISQGSLDS
C7MMZ7_CRYCD          ----------------------------TIARRMDVLDILHDSGLGTGTHSIISQGHLAS
C7N560_SLAHD          ----------------------------APARRMDFMDILHDTGLGTGTHSIIGQGNLDA
E1QVK5_OLSUV          ----------------------------APARLRDITDILHDSGLGKDTHSIISQGKLDS
C8W740_ATOPD          ----------------------------APSRLMDIQDILHDSGLGKDTHSIISQGKLDS
SMC_RHOPA             ----------------------------REVRARDVQLLFADAATGARSPALVHQGKIGE
A7IGT2_XANP2          ----------------------------KDVRARDVQLIFADASTGARSPALVRQGQIGE
B8EMM7_METSB          ----------------------------REARARDVQLLFADASSGSRSPAMVRQGQIGE
B8IQU0_METNO          ----------------------------REVRARDVQLLFADAATGARSPAMVRQGQVAE
Q92RE8_RHIME          ----------------------------KEARAKDVQLLFADASTGARSPSMVGQGRIGE
A7HQY9_PARL1          ----------------------------REVRARDVQLLFADASTGAHSPALVRQGQIAQ
D8JUP9_HYPDA          ----------------------------REVRARDVKVLFEDAATGARSPALVRQGQIGE
E3I0B2_RHOVT          ----------------------------KEVRAKDVQILFADAATGARSQAMVQQGTIGQ
SMC_RHOS1             ----------------------------KDVRARDIQMLFADASTGAHSPALVRQGQISE
Q2W040_MAGSA          ----------------------------LDTRARDVQLLFADAATGARSSGLVSQGKVGQ
D3P3X3_AZOS1          ----------------------------KLVRARDVQLLFADNASGAASPALVSQGKVAQ
B6IR58_RHOCS          ----------------------------KGVRARDVHILFADNASGANSPALVSQGRVGA
Q2RPA2_RHORT          ----------------------------KDVRARDVQLLFADSATGARSTAMVSQGRVSA
SMC_CAUVN             ----------------------------REVRARDVQLLFADASTGANSPALVRQGQISE
B0T003_CAUSK          ----------------------------REVRARDVQLLFADASTGANSPALVRQGQISE
Q0AMJ6_MARMM          ----------------------------EEVRAKDVQLLFMDAGTGANSPALVRQGQISE
E0TC69_PARBH          ----------------------------KEVRAKDVQLLFADGATGANSPALVRQGQVSD
C6XRC2_HIRBI          ----------------------------RTVRAKDVQLLFADASTGANSPALVRQGQISE
Q0C0X5_HYPNA          ----------------------------RTVRGKDIQLLFADASTGANSPALVRQGQISE
Q1GQU3_SPHAL          ----------------------------RDVRAKDVALIFADAATGAHSPALVSQGKIAN
D4YX43_SPHJU          ----------------------------RDVRAKDVSLIFADAATGPHSPALVSQGRIAA
Q2G9S3_NOVAD          ----------------------------KDVRAKDVALVFADAATGAHSPALVSQGRIAA
D5BSU5_PUNMI          ----------------------------KPARARDVQLLFADTATGARSSGIVSQGRIGA
A5FVJ2_ACICJ          ----------------------------REVRARDVATLFADLASGARNSAMISQGRVSA
C5B6I7_METEA          ----------------------------RKVRLSDVVLHYKDLGSGPTSAALVSQSQITR
Q937L3_DEIRD          ----------------------------RGVRARDIQAACAAPGWGAGGLAVIGQGEVSG
Q1J060_DEIGD          ----------------------------RPARARDVQSALRGTGLGPGGLAVIGQGEVNG
L0A7J5_DEIPD          ----------------------------RPARARDIHGALRGSGLGPGGLAVIGQGEVSG
D7BH70_MEISD          ----------------------------KVSTLRAVERALAGAGLGRGGYAVIGQGEIGS
SMC_THASP             ----------------------------VHVRRKDVIDLFLGTGLGPRAYAIIEQGMISR
A1K715_AZOSB          ----------------------------VHVRRKDVIDLFLGTGLGPRAYAIIEQGMISR
C7RKG8_ACCPU          ----------------------------LHVRRKDVTDLFLGTGLGPRAYAIIGQGTISR
Q3SJI0_THIDA          ----------------------------MRVRRRDVADLFLGTGVGARAYAIIEQGMIAR
SMC_DELAS             ----------------------------QAVRRRDVQDVFLGTGLGPRAYAIIGQGTISR
D6CTE6_THIA3          ----------------------------QAVRRRDVQDIFLGTGLGPRSYAIIGQGTITR
SMC_BORPD             ----------------------------QQVRRRDIHDIFLGTGLGARGYAIIGQGMINR
SMC_BURP1             ----------------------------LPARRRDIQDIFLGTGLGPRAYAIIGQGMIAR
A4SYV7_POLAQ          ----------------------------QVVRRKDIQDIFLGTGMGPRGYAIIGQGTINR
D5CRW3_SIDLE          ----------------------------QSVRRKDITDIFLGTGVGARAYAIIEQGMISR
D9SGR3_GALCS          ----------------------------QKVRRRDITDIFLGTGLGARAYAIIEQGMISR
Q2YBB9_NITMU          ----------------------------IHVRRRDIADIFLGTGLGGRGYAIIEQGMISR
Q0AE88_NITEC          ----------------------------IRVRRRDITDMFLGTGVSGRGYAIIEQGMISR
D7DI79_METV0          ----------------------------TVVRRRDVADLFLGTGLGGRAYAIIGQNTINR
C1D4R7_LARHH          ----------------------------QQVRRRDIADLFLGTGVGTKGYAVIEQGMISR
Q7NR76_CHRVO          ----------------------------QQVRRRDITDLFLGTGVGARGYAVIEQGMISR
A1KSF4_NEIMF          ----------------------------QTVRRRDITDLFLGTGVGARGYAVIEQGMISR
A1WY82_HALHL          ----------------------------TRCRRRDISDVFMGTGLRPRGYTIIEQGMISR
Q0AAV4_ALKEH          ----------------------------TRCRRKDITDVFLGTGLGPRGYTIIEQGMISR
SMC_XANOR             ----------------------------TKCRRRDITDLFLGTGLGPRSYSIIEQGMISQ
B8GTL2_THISH          ----------------------------SKCRRKDITDIFLGTGLGPRSYAIIEQGMISR
Q3JAH9_NITOC          ----------------------------ARCRRRDITDIFLGTGLGPRSYAIIEQGMISR
D3RSW0_ALLVD          ----------------------------TRCRRRDIQDLFLGTGLGPRSYAIIEQGMISR
B3PGR0_CELJU          ----------------------------TKCRRRDITDIFLGTGLGPRSYAIIEQGMISK
A6V7X5_PSEA7          ----------------------------TKCRRRDITDIFLGTGLGPRSYSIIEQGMISK
Q0VR03_ALCBS          ----------------------------TKCRRKDIADIFLGTGLGPRSYAIIEQGMISR
C7RBE2_KANKD          ----------------------------TRCRRKDITDIFLGTGLGPRSYAIIEQGMISR
Q2SD45_HAHCH          ----------------------------NKCRRKDITDLFLGTGLGPRSYAIIEQGMISR
E4PL89_MARAH          ----------------------------SKCRRRDITDLFLGTGLGPRSYAIIEQGMISR
E1V8E9_HALED          ----------------------------QKCRRRDIADLFLGTGLGPRSYAIIGQGMISR
D3SAL9_THISK          ----------------------------QRARKRDVVDLFLGTGLGPRSYAIIEQGMIAR
SMC_METCA             ----------------------------TRCRRKDITDLFLGTGLGARSYAIIEQGTISR
SMC_COXBU             ----------------------------AHVRRRDVVDVFLGTGLGPRSYAIVEQGMISN
Q5WTI1_LEGPL          ----------------------------ARCRRKDITDIFLGTGAGARSYSIIGQGTVSR
Q12L80_SHEDO          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
Q080K7_SHEFN          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
A4Y804_SHEPC          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
D4ZIY3_SHEVD          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
B0TKB4_SHEHH          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
A3QFJ7_SHELP          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGTISR
A1S5R5_SHEAM          ----------------------------QKCRRKDITDLFMGTGLGPRSYAIIEQGMISR
Q5QUJ9_IDILO          ----------------------------SRCRRRDITDLFLGTGLGPRSYAIIEQGMISR
E1SMV2_FERBD          ----------------------------NKCRRRDITDLFMGTGLGPRSYAIIEQGMISR
F2GBA5_ALTMD          ----------------------------TKCRRRDVTDLFLGTGLGPRSYAIIEQGMISR
Q15UZ3_PSEA6          ----------------------------SKCRRRDVTDLFLGTGLGPRSYAIIEQGTISR
Q3IKC0_PSET1          ----------------------------SKCRKRDITDIFLGTGLGPRSYAIIEQGMISR
A4SKA4_AERS4          ----------------------------QKCRRKDVTDLFLGTGLGPRSYAIIEQGTVSR
D0KWM8_HALNC          ----------------------------TRVRRRDVVDLFLGTGVGARSYSVIEQGQINR
A0A2W1K6W8_ACIFR      ----------------------------ARCRRRDVADLFLGTGLGGNAYAIVEQGTIGR
A0A0J1A050_ACIBA      ----------------------------TRCRRRDITDIFLGTGLGPRSYAVIEQGMINR
B3E294_GEOLS          ----------------------------TPCRLLDISELFMDTGVGTKAYSIIEQGKIGQ
A1AU91_PELPD          ----------------------------TPCRLLDITELFMDTGVGTKAYSIIEQGKIGM
B9M6F0_GEODF          ----------------------------SQCRLLDIAELFMDTGVGARAYSIIEQGKIGM
Q39WG2_GEOMG          ----------------------------TPCRLMDITELFMDTGVGARAYSIIEQGKIGM
B5EFS9_GEOBB          ----------------------------TPCRLLDIAELFMDTGIGAKAYSIIEQGKIGM
Q3A212_PELCD          ----------------------------APCRLLDISELFMDTGIGARAYSIIEQGKVGQ
A9FIZ2_SORC5          ----------------------------TQVRLKDVTDLFLGTGVGTKAYSIVEQGKIGL
D0LY52_HALO1          ----------------------------VPCRLRDVTDFFLGTGVGTKAYSIIEQGRVGM
Q1D2R5_MYXXD          ----------------------------TLCRLLDITELFLGTGVGTKAYSIIEQGRVGL
B4UDF6_ANASK          ----------------------------VQARLLDVNDIFFGSGVGRTAYSIIEQGRIGQ
Q6MNS9_BDEBA          ----------------------------EPARLKDLQEIFMDTGAGSKGFSIIAQGMIGK
A9A0M3_DESOH          ----------------------------QPCRLKDIYNIFLGSGMGARSYSIIQQGNIGA
B8FHS3_DESAL          ----------------------------QPCRLKDIQNLLMGSGIGAGTYAVIQQGNLGA
E1QL74_DESB2          ----------------------------RPCRLKDIQQLLMDTGLGNRAYAIIEQGKVAS
B3EFQ6_CHLL2          ----------------------------VPCRLKDILDLFTDTGMGSDAYSVIELKMIEE
A1BDT4_CHLPD          ----------------------------VPCRLKDILDLFTDTGMGSDAYSVIELKMIEE
A4SG64_CHLPM          ----------------------------VPCRLKDILDLFTDTGMGSDAYSVIELKMIEE
SMC_CHLTE             ----------------------------VPCRLKDILDLFADTGMGSDAYSVIELKMIEE
Q3ATI3_CHLCH          ----------------------------VACRLKDILDLFTDTGMSSDAYSVIELKMIEE
B4S519_PROA2          ----------------------------VPCRLKDILDLFADTGMGSDAYSVIELKMIEE
B3EM83_CHLPB          ----------------------------VPCRLKDILELFADTGMGSDAYSVIELKMIEE
B3QRZ4_CHLT3          ----------------------------VPCRLRDIWDLFVDTGMGSDAYSVIELKMIEQ
D0MFL5_RHOM4          ----------------------------TPCRLRDIQELFMDTGMGAGAYSVIELKMIED
Q2S457_SALRD          ----------------------------TTCRLKDITDLFMDTGMAADAYSVIELKMVDE
C7PLU2_CHIPD          ----------------------------VACRLKDIHNLFMDTGVSTDSYAIIELGMVDD
E4TVF1_MARTH          ----------------------------VSCRLKDITNLFMDTGISSNSYAIIELKMVDD
B2KBE7_ELUMP          ----------------------------VQCRLRDIRDLFLDTGIGGEGYAIIDQGGVES
B1H0P2_ENDTX          ----------------------------TQCRLKDIRGMFLDTGIGYDGYSIIEQGKVDF
E4TEW8_CALNY          ----------------------------KRCKLKDIREIFFDTGLGARSISIIEQGKVEK
D3PDY1_DEFDS          ----------------------------KKCRLKDIRELFYDTGIGARSISIIEQGKVEK
D4H2V6_DENA2          ----------------------------KKCRLKDIREIFYDSGIGARSISIIEQGKVEK
D6YSC9_WADCW          ----------------------------RPVRLRDVYDLFMDSGIGKNAFSIFEQGKIEQ
Q04TU9_LEPBJ          ----------------------------SRVQRKDIEKLLMDTGIGKSSYSIMEQGKVDR
E1R6H6_SEDSS          ----------------------------APVKLREVRELFFDTGIGKSSYSIMEQGKIDQ
Q73ML2_TREDE          ----------------------------QPAKLREIRELFWDTGVGKAAYSVMEQGKIDQ
A0A0H3BKB7_TREPS      ----------------------------NAVRLKEIRELFWDTGIGKVAYSVMEQGKIDQ
E0RSK7_SPITD          ----------------------------APVRLRDVKELFFDTGIGKSAYSIMEQGKIDQ
D5EMY0_CORAD          ----------------------------KVSRLKDIQRLFANTGVGRVSYSFMLQGQIDQ
B1ZZB8_OPITP          ----------------------------QACRLKDIQKLFMDTGIGRTSYSIMAQGQIDL
SMC_DESHY             ----------------------------SSCRLKDIHELFMDTGAGKEGFSIIGQGRVEE
A4J682_DESRM          ----------------------------VPCRLKDIHALFMDTGLGRGAYSLIGQGKVDE
Q67PF3_SYMTH          ----------------------------VPCRLKDVQELFMDTGIGKENYSIIGQGRIDE
B0TGW8_HELMI          ----------------------------SPCRLRDLQELFSDTGLGREGISIIGQGRVDE
Q2RJX0_MOOTA          ----------------------------VPCRLKDIQELLLDTGSGRGGLAIVSQGRLEE
SMC_BACSU             ----------------------------QPCRLKDIIDLFMDSGLGKEAFSIISQGKVEE
C5D8T7_GEOSW          ----------------------------QPCRLKDIVDLLMDSGLGKEAFSIIGQGRVEE
D5DQR5_BACMQ          ----------------------------QPCRLKDIVDLFMDSGLGREAFSIISQGKVEE
B7IUK7_BACC2          ----------------------------QSCRLKDIIDLFMDSGMGREAFSIISQGKVEE
Q9KA07_BACHD          ----------------------------QPCRLKDIVDLFMDSGLGREAYSIIGQGKVEE
Q5WFM8_BACSK          ----------------------------HSCRLKDIVDLFLDSGLGREAYSIIGQGKIEE
Q7ZAM6_OCEIH          ----------------------------QPCRLKDIIDLFMDSGLGREAFSIISQGKVEE
D6XTT7_BACIE          ----------------------------QTCRLKDITDLFMDSGLGKEAFSIIGQGRVEE
Q81ZN4_ENTFL          ----------------------------QACRLKDIQDLFMDSGLGKESFSIISQGKVEA
A0A0E0UX46_LISMM      ----------------------------ENCRLKDIVDLFMDSGLGRESFSIISQGKIDE
B1HQH6_LYSSC          ----------------------------QQCRLKDITDLFMDSGLGKEAFSIISQGRVDE
C6D303_PAESJ          ----------------------------QSCRLKDITELFMDTGIGKEAYSIIGQGRIEE
C0ZFN9_BREBN          ----------------------------RSCRLKDIMEMFMDTGLGKEAYSIIGQGKIEE
C8WWA4_ALIAD          ----------------------------QPCRLKDIHELFMDTGLGREAYSIIGQGKIEE
D5WPA2_KYRT2          ----------------------------QTCRLKDVIDLFLDTGLGKEAYSMIGQGRIDE
C4L5Z7_EXISA          ----------------------------KPCRLKDVIDLFMDTGLSRDAFAIIGQGRVEQ
B1YIN0_EXIS2          ----------------------------KPCRLKDVLDLFMDTGLSRDAFAIIGQGRVEQ
D3R1B0_MAGIU          ----------------------------NLCRLRDVIELFMDTGIGRDGYSIIGQGRVDE
D2RLB2_ACIFV          ----------------------------KNCRLKDVVALFADTGLGRGSLSIIGQNKIDE
D1BLY1_VEIPT          ----------------------------RSCRLKDIHLLLADTGLGRDSMAIIGQNRIDA
A5UQ60_ROSS1          ----------------------------QRVRLRDVQEIAAPINGA---YAIINQGLVDA
B8G556_CHLAD          ----------------------------ARVRLRDLLAAVEPLGGS---YTIINQGLVDA
A9B100_HERA2          ----------------------------NKVRLRDIQEATSPLASS---YTLINQGLVDA
D1C6T1_SPHTD          ----------------------------ARVRLKDVLQVTASLGQA---YTVIGQGLVDA
D7CMX2_SYNLT          ----------------------------VPARLKDVQDLFAGTGLGKKGYSIIGQGELEQ
Q0AYV7_SYNWW          ----------------------------SRVRLKDISDLLSGSGVGKKGYAIISQGELEE
SMC_LACPL             ----------------------------QSCRLKDITNLMIDTGLGKDSFSVISQGRVEA
Q03RT7_LACBA          ----------------------------QSCRLKDITELLMDSGMGQDSFSIISQGRVEA
B2GD41_LACF3          ----------------------------RPVRLKDIVDLFIDSGIGRESFSIISQGRVAA
A5VKP1_LACRD          ----------------------------QNVRLKDITDLFIDSGLGRESFSIISQGRIEE
Q03FW9_PEDPA          ----------------------------QECRLKDILNLFIDTGLGRESFSVISQGRVES
A0A249N2C3_LACRH      ----------------------------QDVRLKDIVDLFMDSGLGRESFSFISQGRVEA
Q38XR7_LACSS          ----------------------------KSCRLKDIVNLFMDSGLGRESFSIISQGRVEA
Q1WU99_LACS1          ----------------------------KKVRLKDVVDLFIDTGLGRESFSIISQGRVES
Q04GL1_OENOB          ----------------------------VKSRLKDITDLFVDTGLGRESFSIINQGKVEA
Q03VW6_LEUMM          ----------------------------VESRLRDIHELFMDTGLGRESFSIISQGRVES
A0A0U5K8Z4_LACDE      ----------------------------QPVRLRDVRALFLDSGISQNSLAIISQGRVDQ
E4SKB3_LACAR          ----------------------------QQVRMRDVRALFLDSGISPNSLAIISQGRVDQ
Q74IP9_LACJO          ----------------------------HPVRLKDVRTLFIESGMSSDSLGIISQGKVDE
A0A0T8KIP4_STREE      ----------------------------KKVRLRDIHDLFLDTGLGRDSFSIISQGKVEE
A4VVL7_STRSY          ----------------------------QKVRLRDIHDLFMDTGLGRDSFSIISQGRVEA
C0MCR5_STRS7          ----------------------------KKVRLRDIHELFMDTGLGRDSFSIISQGRVEE
A2RLZ7_LACLM          ----------------------------RKCRLRDIHDLFTDTGLGRDSLSIISQGRIES
B9EBB4_MACCJ          ----------------------------QKVRLKDITELFLDSGLGRDAFSIISQGKVDQ
SMC_MYCHR             ----------------------------QPVRYKDIKNLAVESGISKSSLAIISQGTISE
E0TKT8_MYCHH          ----------------------------QPVRYKDIKNLAVESGISKSSLAIISQGTISE
Q4A770_MYCH7          ----------------------------QLVRYKDIRNLAIQAGISKSSLAIISQGTISE
C5J708_MYCCR          ----------------------------QPVRYKDIRNLAVNAGISKSSLAIISQGTISE
A5IYM7_MYCAP          ----------------------------EVCRQKDIKEIAMESGIGKSSLAIISQGTVSD
D5E4P4_MYCCM          ----------------------------ELCRHKDIKAIAMETGIGKSSLAIISQGTVAD
Q6KHN4_MYCMO          ----------------------------EIARHKDIKDIAVESGMSKSSLAIISQGTISE
Q98PK8_MYCPU          ----------------------------EIVRYKDIKDIALESGISKSSLAIISQGTVSD
D1J8Q8_MYCHP          ----------------------------ELARQRDIKEIAMQSGISKSSLAIIGQGTISN
Q4A588_MYCS5          ----------------------------EPTLHKTIKQLAMETGIGKSSLAIISQGKVSE
SMC_MYCGE             ----------------------------NPATLKEISGIFADIGLEKGSLGIISQGSVSW
SMC_MYCPN             ----------------------------ELVTLKEISGIFADIGLEKGSLGIISQGSVSW
Q7NBU0_MYCGA          ----------------------------EPSSLKEINDIFLDSGLTKGSLCIISQNTVSS
Q8EVS6_MYCPE          ----------------------------QLTRLKDIHDIFSDTGLSKGSLGIISQGTVNW
Q9PR04_UREPA          ----------------------------EVALLKDITDMFLDSGLSKGSLGIISQGAVSW
Q6F1N4_MESFL          ----------------------------EKCKLRDIQDVALETGLTKSSIAIISQGTIST
Q6MTD2_MYCMS          ----------------------------TKCKLKDVQSIALEAGLTRSSIAIISQGTVAN
E3GP81_9FIRM          ----------------------------KSCKLKDIHELFMDTGLGKNGYSLISQGGIEN
SMC_HALOH             ----------------------------KICRLKDIENLLMDTGLGKDTYSIVGQGKIDS
E4RL35_HALHG          ----------------------------ASCRLKDIEALLMDSGLGSDGYSIVGQGRIDS
D9QRN7_ACEAZ          ----------------------------SVCRLKDIEELIMGTGLGTEAYSIIGQGKVDE
A8MHB7_ALKOO          ----------------------------SSCRLKDVRELLMDTGIGKDGYSIIGQGKIDE
A6TRT3_ALKMQ          ----------------------------SSCRLKDIREMLMDTGIGKDGYSIIGQGRIDE
A3DDY2_HUNT2          ----------------------------TPCRLKDIYELFLDTGIGKDGYSIIGQGRVDE
D5X8N2_THEPJ          ----------------------------TPCRLKDIHELFMDTGIGKEGYSIIGQGKIDE
D9R048_CLOSW          ----------------------------SACRLKDIYELFYDTGIGKEGYSIIGQGQIDK
C4Z0E6_EUBE2          ----------------------------NSCRLKDVTEMFYDTGIGKEGYSIIGQGQIDK
C4Z924_AGARV          ----------------------------NPCRLKEVSELFYDTGIGKEGYSIIGQGQIDR
E0RV40_BUTPB          ----------------------------SSCRLKDVNELFMDTGIGKEGYSIIGQGQIDQ
A9KLR0_LACP7          ----------------------------TNCRLRDVQELFMDTGIGKEGYSIIGQGQIDK
D9S347_THEOJ          ----------------------------VPCRLRDIQELFMDTGIGKDGYSIISQGQVDE
B2A2N3_NATTJ          ----------------------------TPCRLKDIQETFMDTGLGKDTYSIISQGEIDK
A8F8R1_PSELT          ----------------------------EVVRLKDIHEKFMGTGIGKEFYSIAGQGQIER
A5IN04_THEP1          ----------------------------SSVRLKDIRDRFAGTGLGVDFYSIVGQGQIDR
C5CIS4_KOSOT          ----------------------------KPSRLRDIKEIFQGTGVGMDIYSIVGQGQVDK
A7HMD4_FERNB          ----------------------------DIARLKDIRDFLMQHGYGKNPYSIIGQGQIDR
B7IHN5_THEAB          ----------------------------ESARLKDITALLGSNAL----VSIIGQGKIDK
SMC_THEEB             ----------------------------QPCTLNELHDQLQAFCIYPQGYNVVLQGDVTS
Q2JHS4_SYNJB          ----------------------------VPCTLSELHEQLEAMHIYPNGYNVVLQGDVTS
SMC_SYNP6             ----------------------------EACTLQQLHEQLSRLRIYPEGYNVVLQGDVTN
B0C9C4_ACAM1          ----------------------------ESCTLTQLHEQLNRRRIYPEGYNVVLQGDVTS
Q115J3_TRIEI          ----------------------------QPCTLSQLHEQLNQLRVYAEGYNVVLQGDVTG
B2J925_NOSP7          ----------------------------EACTLTELHQQLSNLRVYPEGYNVVLQGDVTS
E0UKI1_GLOV7          ----------------------------HPCSVNELHEQLNRFRIYPEGYNVVLQGDVTR
B7K4Q6_RIPO1          ----------------------------EACNVNELHEQLNRLRIYPEGYNVVLQGDVTR
B0JSN6_MICAN          ----------------------------ETCTVSELHDQLNRLRIYPEGYNVVLQGDVTR
SMC_SYNY3             ----------------------------ETATVTELHEQLNELRIYPEGYNIVLQGDVTR
Q84EC7_SYNP2          ----------------------------QPCTATELHEQLNRLRIYPEGYNVVLQGDVTR
D3EQ04_ATETH          ----------------------------RPCTVNELHEELNRFRIYPEGYNVVLQGDVTS
SMC_GLOVI             ----------------------------SPCTLTDLHEELARHHIYPEGYNVVLQGDVTG
A5GQT1_SYNR3          ----------------------------VPCNLQQLQTQLRRLRLDPDGSNVVMQGDVTR
A9B9B9_PROM4          ----------------------------EICNLQQLQTQLRRLRIDPEGSNVVMQGDVTR
A2BNJ6_PROMS          ----------------------------KQCTLQQIQRILRDISVDPEGSNVVMQGDVTR
Q46EX0_METBF          ----------------------------KSVSLGEVHSQLEKAGITPEGYNVVMQGDVTQ
D7EAF5_METEZ          ----------------------------KSVSLKDIHNYLAKAKVTPEGYNVVMQGDVTQ
D1YW78_METPS          ----------------------------KPVSLSEIHEHLLKAKISPDGYNVVMQGDVTR
A0B8B9_METTP          ----------------------------RACTQAELQEHLARAGITPEGYNVVMQGDVTR
D4GT30_HALVD          ----------------------------RSVNLSDIKDLLAQAGITPEGYNVVMQGDVTE
A7IAD8_METB6          ----------------------------RLCKQSDIVDHLSKFGIIPHGYNVVMQGDVTR
A3CWK7_METMJ          ----------------------------RLCKQGDVIEFLAKIGIKPEGYNVVMQGDITR
B8GG37_METPE          ----------------------------RLCKQSEVSAYLADHGIIPHGYNVVMQGDITR
E1RII6_METP4          ----------------------------RGCKQGDIVDLLSRHGIKSEGYNVVMQGDITR
Q2FLH3_METHJ          ----------------------------RSCRQGELLDFLAGHGIVPHGYNVVMQGDINR
A2SS75_METLZ          ----------------------------KTCSQTEILEYLAKRGIKPHGYNVVMQGDISR
D3RYW2_FERPA          ----------------------------KPCSLADVKKFLEKAGVYEDTPNVIMQGDVTR
O28714_ARCFU          ----------------------------KSVSLSEIHSFLSQFGIYSDAYNVVMQGDVTR
D2RFP2_ARCPA          ----------------------------KSVSYSDIERLIEKLGLNTE-YNIVMQGDVTR
SMC_THEAC             ----------------------------VRSRLSEIDETLASMGINFGTYSFVLQGDIND
Q97AI9_THEVO          ----------------------------TKARQSDVEDALSAFGINFGTYSFVLQGDIND
SMC_METVO             YEVEKQNTKINTESSQKKTSKASKVEKRRRMKKNEVLDLLSKISLIADGPNIILQGDLLR
A6UQ42_METVS          DEEK--------EVKEGVVIKRIKEEQRKKVKKSDILGIIGKISLNADGFNIILQGDLIK
A6UVP1_META3          YEEN---------------KDNKRVEKRKKIKKSTVIDIFNKMSLCGEGLNIILQGDLIR
SMC_METJA             KEND--------------------KEKRKKMTKHEIIDLFRRLGLLGD--NVISQGDLLK
C9RFQ3_METVM          KDND--------------------KEKRRKMSKQEIIDLFRKLGLLGN--NVISQGDLLR
D5VT24_METIM          NGEK------------------------RRLTKKEIIDFFRRLKLLGD--NIISQGDLLN
D3SQ87_THEAH          ----------------------------QWVREKDLKEFLAAAGIYENAYNVVLQGDVVR
D3DG53_HYDTT          ----------------------------SVIRERDLKDLLAKAGLYENAYNIVLQGDVIR
SMC_AQUAE             ----------------------------QVVRERDLKDFLAKAGIYETAYNVVYQGDIVK
B4U7R1_HYDS0          ----------------------------KIIREKDLHLILARGGIYKEGYNIVLQGDIVK
C0QSN8_PERMH          ----------------------------RPAKQYEVEELLSYAGIPKQGYNIVTQGDIFR
B2V736_SULSY          ----------------------------KTVKQQEVEDLLTQAGIPIQGYNIVTQGDIYK
SMC_PYRFU             ----------------------------RRATRSEILDILTAAMISPDGYNIVLQGDITK
C5A612_THEGJ          ----------------------------KRATRSEILDLLSAAMISPEGYNLVLQGDITK
D1CC09_THET1          ----------------------------RKARLRDVQEIG---AIIGESFTFINQGSVDE
D3TAQ9_ACIB4          ----------------------------EQARLQDFNSILIHAKIEADGYNFVQQGDVTR
SMC_HALMS             ----------------------------YPARLKDIQEVFMDTGAGAKSYSIIAQGEINR
Q6L0R1_PICTO          ----------------------------NKSKYNDVSNLIDSFHIYLDSYSFVLQGDINN
C1A7M6_GEMAT          ----------------------------APCRLRDIQDLVRGTGLGADSGVVIESKMIDA
C9RN51_FIBSS          ----------------------------QECRLRDVHALLFDSGLGSSTYSQMNADMIKA
D1B5Z0_THEAS          ----------------------------VRRTLAELEEAKRRIHMEGDRFAFIGQGEVSE
                                                         .                     :  

SMC_FUSNN             IIN-SSPKEIKSIIEEAAGIKKLQANRIEAQKNLANIEINLDKVEFILNETRENKNKIEK
E3H7H1_ILYPC          IIS-SSSKEIKEIIEEAAGIKKVKIRKTESEKKLEKVQGEIEKIDLIIGEMEENKNRVEK
D1AK68_SEBTE          IIS-STPKELKELIEEAAGVKRAKTEKEESVKKLNDIQSEVEKIEYVENDLASRVSILKE
SMC_CLOK1             LLS-GKQEDRRLLLEEAAGIVKFRWRRSEAEKKLENTEVNLIRIEDILHTYEERLKPLEL
D8GS00_CLOLD          LLS-GKPEDRRSVLEEAAGIVKFKWRKEEAEKKLSNTDANLVRIEDILETHTERLESLKE
Q97IA1_CLOAB          VLS-GKPEERRALLEEAAGIVKFKTRKVDAEKKLENTNQNLVRINDILRTYEERLEPLRI
A0Q0Y7_CLONN          LLS-GKPEERRSLLEEAAGIVKFKTRKQEAEKRLENTENNLQRIEDIFSTYEERIEPLKL
Q895M7_CLOTE          ILS-GKPEERRSLLEEAAGIVKFKKRKEEAERKLEKTEENIIRIQDITSTYMERLGPLEK
Q0SSA4_CLOPS          ILS-GKPEDRRAILEEAAGIVKFKSRKGEAEKKLKNTEENLVRINDIIFTYEERLGPLEE
A6LSM4_CLOB8          ILS-GKPEDRRNLLEEAAGIVKFKNRKEEAEKKLSNTDENLVRINDILSTYEERIEPLRI
D9SLC7_CLOC7          LLS-GSSDERRELLEEAAGIVKYKSRKNESEKKLNLTEQNIVRLNDILSTYEERLGPLEI
D7APA8_THEM3          ILS-AKPEDRRQIFEEAIGISKYRYKKEEAEKKLAAANDNLIRLNDIVAELEKQLTTLET
Q8R9W7_CALS4          ILS-AKPEERRLILEEAIGISKYRYKKEEAERKLVSAEENLIRLNDIVVELEKQLETLKA
D9TN88_THETC          ILV-SRPEDRRQIFEEASGISKYKYKKEEALKKLIATNENINRINDILCEIQNQLEPLYE
C9YKI7_CLODR          ILS-NNPLSRRKVFDEACGISKYRYKKQEAERNLSNTKENLERIDDVYIEIENQLKPLFN
E3PS49_ACESD          IVN-GNSNQRRKILEEAAGITKFRYKKEESEKKLDVANENLERINDVYKEVEKQILPLEI
B0S1M4_FINM2          ILS-SKSEDRRELFEEASGISKQKYIKEQSVKKLEQTNENLLRIEDILVSQIDRLKYLEK
Q3AC59_CARHZ          ILF-SSPEEKRSYLEEAAGINRFRMRELEAKKKLLETQNGITRLNDLTNELTNQLQAKEQ
E4SF58_CALK2          IIN-ARPVERYRIFEEACGITKYKYRKEETERKLKATEENIQRLQDVMFELRTQLEEIKP
SMC_RHOBA             MLQ-ANAKDRRAIFEEAAGISRFKAKKVEAERRLERVQTNLTRLGDIVDEVATRLKTLKS
D2QWB0_PIRSD          LLQ-ASAKDRRAIFEEAAGISRFKAKKIEAQRRLERVDQNLLRLSDIVEEVDARLKTVRN
D5SU17_PLAL2          ILQ-GNPSSRRAVFEEAAGISRFRTREQEALRKLERVDQNLLRLTDIVDEVEGRLNSTRS
SMC_KORVE             ILS-SKPTDRRAIIEEAAGITKYKTKKRLAEARLEDAKSNLARVNDIFDEVTRQMNSLKR
C1F1T5_ACIC5          LLS-SKPHDRRAIIEEAAGITRFKTKKRLAELRLEQAKQNLARVNDIFEEVTRQMASLKR
Q01Y77_SOLUE          ILS-SKPQDRRNVIEEAAGITRFKTKKRLAEAKLEGAKQNLARVYDILEEVTRQVNSLKR
SMC_MYCPA             ILQ-SRPEDRRAFIEEAAGVLKHRKRKEKALRKLDAMSANLARLTDLTTELRRQLKPLGR
SMC_MYCTU             ILQ-SRPEDRRAFIEEAAGVLKHRKRKEKALRKLDTMAANLARLTDLTTELRRQLKPLGR
SMC_MYCLE             ILQ-SRPEDRRTFIEEAAGILKYRRRKEKALRKLDAMSANLARLTDLTTELRRQLKPLSR
A4FMG9_SACEN          ILQ-AKPDEHRRLIEEAAGVLKHRKRKEKALRKLDAMQANLTRLTDLTSELRRQLKPLGK
C8XH72_NAKMY          VLQ-ARPEDRRAFVEEAAGVLKHRKRREKTIRKLDAMQANLNRLTDLTAEIRRQLGPLGR
D7GEI0_PROFC          ILQ-ATPEIRRGFIEEAAGVLKHRRRKEKAARKLESTRQNLERLSDLISEIRRQLKPLGR
Q2J6Z3_FRACC          VLH-ARPEDRRAFIEEAAGVLKHRKRKEKALRKLEAMSANLTRLTDLSAELRRQLGPLGR
A8L599_FRASN          VLH-ARPEDRRAFIEEAAGVLKHRKRKEKALRKLEAMAANLTRLTDLSAELRRQLGPLGR
C9Z3S1_STRSW          VLH-ADPMGRRAFIEEAAGVLKHRKRKEKALRKLDAMQANLARVQDLTDELRRQLKPLGR
D7CC86_STRBB          VLH-ADPTGRRAFIEEAAGVLKHRKRKEKALRKLDAMQANLARVQDLTDELRRQLKPLGR
B1VYX5_STRGG          VLH-ADPMGRRAFIEEAAGVLKHRKRKEKALRKLDAMGANLARVQDLTDELRRQLKPLGR
E4NHH3_KITSK          VLH-ADPMGRRAFIEEAAGVLKHRKRKEKALRKLDAMQTNLNRVQDLVAELRRQLGPLGR
C7QGY1_CATAD          VLQ-AGPEDRRSFIEEAAGVLKHRKRKEKALRKLDAMQANLTRLTDLTGELRRQLKPLGR
A0LV82_ACIC1          VLH-ATPEERRGFIEEAAGVLKHRKRKEKALRKLEAMQANLTRLADLTTELRRQLGPLGR
A0JXV4_ARTS2          VLH-ATPEDRRGFIEEAAGILKHRRRKEKTVRKLEAMQANLQRLSDLTSEIRRQLTPLGK
A1R7H8_PAEAT          VLH-ATPEDRRGFIEEAAGILKHRRRKEKTVRKLEAMQANLARLGDLTAEIRRQLTPLGK
A6W7T9_KINRD          VLH-ASPEERRAFIEEAAGVLKHRRRKEKALRKLDAMEANLTRVADLVTEIRRQLKPLGR
D1BJA3_SANKS          VLR-ATPEERRGFIEEAAGVLKHRKRKEKALRKLDAMQGNLLRLTDLTAEIRRQLGPLGR
C7NGM6_KYTSD          VLR-ATPEERRGFIEEAAGVLKHRRRKEKALRKLDAMEGDLARVRDLTAEIRRQLGPLGR
B2GFM7_KOCRD          ILQ-ATPEDRRGFIEEASGILKHRRRKEKTLRKLESVQTNLDRLEDLTGEIERQLTPLGR
E1VVN2_GLUAR          ILH-ATAEDRRGFIEEAAGVLKHRRRKEKTLRKLQAMQGNLDRLEDLSSEVRRQLAPLGR
A5CQQ2_CLAM3          VLR-ATPEERRGFIEEAAGILKHRRRKERTLRKLEGMQANLTRLNDLAGEIRRQLKPLGR
Q6AE90_LEIXX          VLR-ATPEERRGFIEEAAGILKHRRRKEKTLRKLDAMQTNLTRLSDLAGEVRRQLKPLGH
D1AB24_THECD          VLH-AGPDGRRAVIEEAAGVLKHRKRKEKALRKLEAMQANLNRVQDLTAELRRRLKPLGR
D6Y659_THEBD          VLH-AGPEERRAFIEEAAGVLKHRKRKEKALRKLDAMQANLNRLQDLITELRRQLKPLGR
D7BMZ9_ARCHD          VLT-ATPEERRTFIEEAAGVLKHRRRKEKALSKLESMQANLTRIDDLAAELRRQLGPLAR
D6ZIF1_MOBCV          ILS-ASELERRAFIEEAAGVLKHRQRKDRALKKLENLAVNLSRVQDLTNEVAKRLGPLGK
C7R311_JONDD          VLR-ATPTERRGFIEEAAGVLKHRRRKEKALRKLDSMQGNLLRLADLLAELSRQLGPLAR
D6ZV06_BIFLJ          ILK-ADPSGHRAFIEEAAGILKHRKRKERALRKLANTETNLSRLDDLLGEIHRQLGPLGR
Q7ZAJ9_COREF          ILE-SRPEERRAYIEEAAGVLKHRRRKEKAQRKLQGMQVNLDRLMDLTEELRRQLKPLAR
Q8NNW5_CORGL          ILE-SRPEERRAYIEEAAGVLKHRRRKEKAQRKLQGMQVNLDRLQDLTHELAKQLKPLAR
Q84F13_CORDP          ILE-SRPEDRRAFIEEAAGVLKHRRRKEKAQRKLVGMQANLDRLSDLTAELGKQLKPLAR
Q4JUZ1_CORJK          ILE-SRPEERRAFIEEAAGVLKHRRRKEKAQRKLVNMQANLDRLHDLTDELRKQLGPLAR
C4LJD3_CORK4          ILE-SKPEDRRAYIEEAAGVLKHRRRKEKAQRKLVSMQANVDRLRDLTTELERQLKPLAR
D6Z8M0_SEGRD          MLG-ARPHQWRELIEEAAGVHKHRKRKDRALRKLETTSADMTRVGDLVGELRRQLKPLGR
C8WGU5_EGGLE          ILQ-SKPEDRRALIEEAAGVLKHKQRKAKSERKLAAMDAHLARVKDVAAEVERQLGPLER
C7MMZ7_CRYCD          ILQ-SRPEDRRALIEEAAGVLKHKQRKARSERKLERMDASLTRVRDIVAEVERTLRPLER
C7N560_SLAHD          ILS-SKPIDRRALIEEAAGVLKHKQRKERSARKLASMDNHLLRVKDVAAEVERQLKPLAR
E1QVK5_OLSUV          ILA-SRPEERRELVEEAAGISKHRRRKERSQRKLRAMQENLTRAKDIEREIGRQLKPLER
C8W740_ATOPD          ILS-SRPEQRRELIEEAADISKHRRRKERAERKISSMDENLTRAKVVSREITRQLKPLER
SMC_RHOPA             IIQ-AKPEQRRRVLEDAAGVAGLHARRHEAELRLKAAETNLTRVEDVIGQLSTQVDGLKK
A7IGT2_XANP2          IVG-AKPNARRRILEEAAGVAGLHARRHEAETRLKAAEQNLLRLEDVITQLGGQVESLRR
B8EMM7_METSB          MIS-AKPQERRRILEEAAGVAGLHSRRHEAELRLKAAADNLQRLDDILQQIEGQTKGLER
B8IQU0_METNO          MIA-AKPQARRRILEDAAGIAGLHARRHEAELRLAAAEENLARVEDVLGAITAGVESLRR
Q92RE8_RHIME          LIA-AKPQARRQLLEEAAGISGLHSRRHEAELRLKAAETNLERLDDVTSQLESQIESLKR
A7HQY9_PARL1          LIS-SKPINRRRILEEAAGITGLYTRRHEAELRLKAAETNLTRLDDVVAQVESQLASLKR
D8JUP9_HYPDA          LVN-AKPEHRRRILEDAAGIAGLHTRRHEAELRLRAAEANIERLSDVVGQLQSQSDSLKR
E3I0B2_RHOVT          LIN-AKPQDRRRILEDAAGIAGLYTRRHEAELRLKAAEANLERLKDVLGQLGNQLSSLRR
SMC_RHOS1             LIN-AKPKARRRILEEAAGISGLYQRRHEAELRLAATEQNLARVEDVLDQLAQQLSTLAR
Q2W040_MAGSA          LIN-AKPADRRSLLEEAAGISGLYSRRHEAELRLKNAELNLSRLDDVLATLDEQLKSLQK
D3P3X3_AZOS1          IIA-AKPQDRRALLEEAAGITGLHSRRHEAELRLKGAETNLTRLDDVIGAMDTQLQSLRK
B6IR58_RHOCS          LIN-ARPTDRRQLLEDAAGISGLHARKHEAELRLRAAETNLTRLDDVLTTMDGQLQGLRR
Q2RPA2_RHORT          LIA-AKPAQRRALLEEAAGIGGLYSRRHEAELRLRAAEGNLERLEDVVTALDGQLGGLRR
SMC_CAUVN             LIG-AKPQNRRRILEEAAGVSGLHTRRHEAELRLRAAETNLSRLEDVARELETALNRLRR
B0T003_CAUSK          LIG-AKPQNRRRILEEAAGVSGLHTRRHEAELRLRAAETNLTRLEDVARELEVALNRLRR
Q0AMJ6_MARMM          LIA-SKPQNRRRVLEEAAGVSGLRARRHEAELRLKGAETNLDRLQEVIDEITARHGSLQR
E0TC69_PARBH          LIN-AKPENRRKFLEEAAGVAGLYTRRHEAELRLKGASQNLERLDDVLGELEQQRGQLAR
C6XRC2_HIRBI          LIA-SKPQNRRRILEEAAGIAGLNQRRHEAELKLRGAADSLSRLDEIIGEVDKQLNTLKR
Q0C0X5_HYPNA          LIG-SKPQNRRRILEEAAGIAGLNTRRHEAELKLDAAEANLQRLAEVSAEVERQLTSLKR
Q1GQU3_SPHAL          VIA-AKPTDRRAMLEEAAGIAGLHVRRKDAEQKLRATETNLTRLSEIVADMEVRAATLRR
D4YX43_SPHJU          VIA-ARPQERRAMLEEAAGISGLHVRRKDAEQKLRAAEANLMRLDEILSDMDARANSLRR
Q2G9S3_NOVAD          VIA-AKPAERRMMLEEAAGIAGLHVRRRDAEQKLRATEANLGRLVDLLSGLESQIATLRR
D5BSU5_PUNMI          IVG-AKPVDRRALLEEAANIRGLHARRHEAELRLRAAETNLERLDDVIAGLIEQRDSLKK
A5FVJ2_ACICJ          LVN-ARPDERRALLEEAAGITGLHARRHEAELKLRAAEQNLLRADDLRAQQEARLAELRK
C5B6I7_METEA          LVDKATPADRRPLLEAAAGIAGLKPRRDAAAKSLRESLQNLHDNERDLERMRAEVERLTA
Q937L3_DEIRD          VVQ-AEGRTLLGYLQEAAGLSRAVSTRQDTEARLKEADTHLEGLRLLLNERETALARLAR
Q1J060_DEIGD          VVQ-AEGRTLLGYLQEAAGLSRAVAARQETEARLREADGHLEQLRLVQAERAGQVERLAR
L0A7J5_DEIPD          VVQ-AEPRTLLGYLEEAADLSRLSAARDETHARLREADGSLDTLRLLEDELAQRVDVLAA
D7BH70_MEISD          ILQ-AGPEVLLGYLEEAAGLKAVALAANNTRERLAAAAQEMQALEAEHARMQGALREKSA
SMC_THASP             IIE-ARPEEIRGFLEEAAGVTKYRERRKETEGRLRDARDNLARLDDIRMELGERIVHLEA
A1K715_AZOSB          IIE-ARPEEIRGFLEEAAGVTKYRERRKETEGRLTDARDNLARLDDIRMELGERIGHLEA
C7RKG8_ACCPU          IIE-ARPDELRVFLEEAAGVTRYKERRKETENRLADTRENLARVEDIRLELGLQMERLEG
Q3SJI0_THIDA          LIE-AKPEELRGYLEEAAGVSKYKERRKETEARLKDARDNLNRVEDIRRELGQQVEKLAA
SMC_DELAS             IIE-SRPEELRLFLEEAAGVSKYKERRRETENRLSATTENLTRVEDILRELNNNLDRLEK
D6CTE6_THIA3          ILE-SRPEDLRMMLEEAAGVSKYKERRRETENRLQDTRENLTRVQDILRELGSNLGRLEQ
SMC_BORPD             LIE-ARPEELRVFLEEAAGVSRYKERRRETENRLSDTRENLTRVEDILRELGSQLEKLEA
SMC_BURP1             IIE-AKPEELRVFLEEAAGVSKYKERRRETENRLHDTRENLTRVEDIVRELGANLEKLEA
A4SYV7_POLAQ          ILE-SKPEELRVFLEEAAGVSKYKERRKETASRLEDTAENLTRVEDILRELDQQLTRLEK
D5CRW3_SIDLE          IIE-AKPEELRVFLEEAAGVSKYRDRRRETELRLGDTRDNLLRVSDILQELDKQLVHLGG
D9SGR3_GALCS          IIE-AKPEELRIFLEEAAGVSKYRERRRETAQRLNDTRDNLLRVDDILQEMDKQLLHLAQ
Q2YBB9_NITMU          IIE-AKPEELRVFLEEAAGISKYRERRRETESRLADTRENLLRVNDICQELEKQLVRLGQ
Q0AE88_NITEC          IIE-ARPLELRAFLEEAAGITRYHEKRHETGLRLTDARGNLQRVDDVLQELDKQQQHLET
D7DI79_METV0          IVE-AKPEELRIFLEEAAGISKYKERRRETELRLRDTRENLIRVEDILRELDKQIARLQS
C1D4R7_LARHH          IIE-AKPEELRHYLEEAAGVSKYKERRRETESRLNDTRDNLSRLNDIREELTRQVDRLAG
Q7NR76_CHRVO          IIE-ARPEELRAYLEEAAGVSKYKERRRETENRLTDTRANLERIADLQQELERQVERLSE
A1KSF4_NEIMF          IIE-ARPEELRAYIEEAAGVSKYKERRKETEGRLKDTREHLQRLGDLQNELARQVEKLEK
A1WY82_HALHL          VIE-SRPEELRVYLEEAAGISVYKERRRETERRIRDTRENLERLEDVRDEVHKQLEKLRR
Q0AAV4_ALKEH          VIE-ARPEELRVYLEEAAGISIYKERRRETERRIRDTRENLERLEDVREEVRRQLEKLRR
SMC_XANOR             IIE-ARPEDLRVYLEEAAGISKYKERRKETETRIRHTRENLDRLGDLREEITKQLAHLQR
B8GTL2_THISH          LIE-AKPEELRVYLEEAAGISKYKERRRETETRIRHTRENIDRLNDLRDEIEKQINHLQR
Q3JAH9_NITOC          LIE-AKPEELRVFLEEAAGISKYKERRRETENRMGHTVDNLNRINDLREEIERQLNTLKR
D3RSW0_ALLVD          IIE-ARPEDLRLFLEEAAGISKYKERRRETENRMRHTRENLDRLNDVREEVGKQLLHLER
B3PGR0_CELJU          LIE-AKPEELRVYIEEAAGISKYKERRRDTESRMRRTQENLERLTDIREELERQLSRLQR
A6V7X5_PSEA7          LIE-ARPEDLRNFIEEAAGISKYKERRRETESRIRRTQENLARLTDLREELGRQLERLHR
Q0VR03_ALCBS          LIE-AKPEELRVYIEEAAGISKYKARRRETENRIRRTRENLERLTDIRDELARQIERLSR
C7RBE2_KANKD          LIE-SKPHELRIFLEEAAGISKYKERRKETENRIRHTRDNLDRLTDLRDELGKQLSHLKR
Q2SD45_HAHCH          LIE-SKPEELRVFIEEAAGISKYKERRKETESRMKRTRENLERLSDIREELDRQLQHLHR
E4PL89_MARAH          LIE-AKPEELRIYIEEAAGISKYKERRRETENRIRRTQENLERLTDLREELGRQLQHLER
E1V8E9_HALED          LIE-SRPEELRATLEEAAGISKYKERRRETENRMRRTQENLERLEDIREELDKQLDKLKR
D3SAL9_THISK          LID-ARPEELRVYLEEAAGISKYKERRRETENRVRHTRENLERLDDVRDEVAKQAERLNR
SMC_METCA             LIE-AKPEEMREIIEEAAGISKYKERRHETEQRMRHTRENLERLADLREELGRQLGHLQR
SMC_COXBU             LIE-AKPEELRVYIEEAAGISKYKERRRETESRMRHTQENLDRVNDIAEELAKQLRHLKR
Q5WTI1_LEGPL          LIE-AKPEELRGYLEEAAGVSKYKERRRETLQRIEQTRDNLTRVADIREELGKHLQRLER
Q12L80_SHEDO          LIE-SRPQDLRVFIEEAAGISRYKERRKETENRIRHTRDNLERLNDIRLELGSQLDKLAE
Q080K7_SHEFN          LIE-SKPQELRVFIEEAAGISRYKERRRETENRIRHTRENLERLNDIRVELGAQLDKLSQ
A4Y804_SHEPC          LIE-SKPQDLRTFIEEAAGISRYKERRRETENRIRHTRENLERLGDIRSELGKQLDKLAQ
D4ZIY3_SHEVD          LIE-SKPQELRVFIEEAAGISRYKERRRETENRIRHTRENLDRLGDIRNELGRQLEKLAE
B0TKB4_SHEHH          LIE-SKPQDLRVFIEEAAGISRYKERRRETENRIRHTRENLARLGDIRSELAKQLDKLAE
A3QFJ7_SHELP          LIE-SKPQELRVFIEEAAGISRYKERRRETENRIRHTRENLERLGDIRQELGRQIDKLAE
A1S5R5_SHEAM          LIE-SRPQELRVFIEEAAGISRYKERRRDTENRIRHTRENLERLGDIRLELGKQLDKLAV
Q5QUJ9_IDILO          LIE-SRPQELRVFIEEAAGISKYKERRKETENRMLHTRENLERLSDVREELGQQLEKLER
E1SMV2_FERBD          LIE-SKPHELRVFIEEAAGISRYKERRRETENRIRHTRENLERLTDVRSELGSQIERLRR
F2GBA5_ALTMD          LIE-SKPQELRVFIEEAAGISKYKERRRETENRIRHTQDNLERLNDVRDELGKQLEKLQR
Q15UZ3_PSEA6          LIE-SKPQELRVFIEEAAGISKYKERRRETENRIRHTKENLERLEDVRGELGAQLQKLEK
Q3IKC0_PSET1          LIE-SKPQELRVFLEEAAGVSKYKERRRETQTRIKSTRENLERLLDVRKELQSQLTKLAV
A4SKA4_AERS4          LVE-SRPADLKLFMEEAAGVSRYKERRRETEQRIRHTQENLERLGDIRGELGSRLEHLKA
D0KWM8_HALNC          VVD-AKPEDLRAYLEETAGISLYRERRRETESRIQQTQDNLSRLSDIADELGRQKTQLER
A0A2W1K6W8_ACIFR      IVD-ARPDDLRAILEEAGGISRYKERRRETTQRIAETREHLQRLYDIHGEMDGQWQRLQR
A0A0J1A050_ACIBA      LVD-AKPEEMRIFIEEAAGVSRYQARRRETLQHLEHTEQNLSRLEDIALELKSQLKTLKR
B3E294_GEOLS          ILH-SRPEERRLLIEEAAGVTKYKTRKQLALKKIEATRQNLLRLADVLGEIKRQLNSLQR
A1AU91_PELPD          ILH-SRPEERRFLIEEAAGVTKFKSRKQQALKKIEGTRQNLARLADVLGEIRRQLASLQR
B9M6F0_GEODF          ILH-SKPEERRVLIEEAAGVTKFKARKQVALKKIELTRNNLLRITDIITEIRRQLGGLQR
Q39WG2_GEOMG          ILH-SKPEERRFLIEEAAGVTKFKAKKQVALKKIDLTRQNLLRIGDILAEIRRQLNSLQR
B5EFS9_GEOBB          ILH-AKPEERRFLIEEAAGVTKFKARKVVAMKKMEATRQNLLRLGDIISEIKRQMNGLQR
Q3A212_PELCD          ILN-AKPEERRFLIEEAAGVSKFKARKKTALRKIDATRQNLLRLRDIIGEVRRQLGALKR
A9FIZ2_SORC5          IVS-ARPEDRRMLIEEAAGITKYKARKKQAEQKMDQTRQNLLRVGDIVSEIQRNLASLKR
D0LY52_HALO1          IVS-SRPQERRAIIEEAAGITKFKTKKRAAERKLDQTRQNLVRVSDIVTELGKRMGSLRR
Q1D2R5_MYXXD          IVS-SKPEDRRHLLEEAAGVTKYKARRKAAERKMEATDANLLRVTDITNELEKRLDALSR
B4UDF6_ANASK          IVS-ARPEDRRAIIEEAAGITKYKKRREAAERKMEATQQNLLRVADIVQELGKQLESLNR
Q6MNS9_BDEBA          IIT-AKPEDRRMLIEEAAGITKFKARKKESQRKLVATDQNLVRLQDIIGELKRQIDSLQR
A9A0M3_DESOH          ITD-ASPEERRMFIEEAAGVTRYKTRKEEALRKLRATDNDLLRIKDIMVEVQRNMNSLDR
B8FHS3_DESAL          ITE-AGPDERRIFIEEAAGITRYKARKKEAQSKIKSTRTNLLRVMDIITEVERNMSSLSR
E1QL74_DESB2          FID-SRPEERRLWVEEAAGITRYKNQKKQSLKKMEGARENLDRLQDIIIEVDSQMARLQR
B3EFQ6_CHLL2          IIS-NKSEERLKLFEEAAGITRYKQRRKQTFKQLESASRDLARVDDVIAEVEKKVRSLKL
A1BDT4_CHLPD          IIS-NKSEERLKLFEEAAGITRYKQRRKQTFRQLESASRDLSRVDDVIAEVEKKVRNLKL
A4SG64_CHLPM          IIS-NKSEERMKLFEEAAGITRYKQRRKQTFRQLESASRDLARVDDLLSEVEKKVRSLKL
SMC_CHLTE             IIS-NKSEERLKLFEEAAGITRYKQRRKQTFRQLESASRDLARVDDVLAEVEKKVRNLRL
Q3ATI3_CHLCH          IIS-NKSEERLKLFEEAAGITRYKQRRKQTFKLLESTSRDLLRVDDVLAEVEKKVRSLKT
B4S519_PROA2          IIS-NKSDERLRLLEEAAGITRYKQRRKQTFRQLEITARDLERVDDVLSEVSKKVRNLKT
B3EM83_CHLPB          IIN-NKSDERLKLFEEAAGITRYKHRRKQTFKQLEATKRDLERVDDVLAEVTKKVRSLKS
B3QRZ4_CHLT3          ILS-DNAEERRRLFEEAAGITKYKQRRKQTYKKLETTSQDLARVEDIVNEVEKKVNALER
D0MFL5_RHOM4          ILS-DNAQDRRHLFEEAAGITRYKLRRTQTLRKLDATRGDLTRLRDLIEEVRRQVDTLKR
Q2S457_SALRD          LVS-GSTEDRRRMFEEAAGITRYKMRRRQALRKLDGTQSDLERIRDLTDEVSTQVERLER
C7PLU2_CHIPD          IIK-DKENSRRRMLEQAAGISIYKTRKKEAKSKLEATEGDLNRIEDLLFEINNNLKTLEA
E4TVF1_MARTH          ILT-DKDNSRRGLFEEAAGISKFKIRKKETIKKLSDTDADLERVEDLLFEIEKNLKSLEK
B2KBE7_ELUMP          VLS-ASAEQRREMFEEVAGVSKYKAKREEAIRRLDRVDLDIARLSDTVVLLDEQIKKLDT
B1H0P2_ENDTX          LTT-AKPEDRRELFEEAAGIAKYKVKREETLRRLEKIDTDMSRLSDALVIHKQQIADLNS
E4TEW8_CALNY          IIS-ASPEEIRVFFDEAAGITRFKEKKKDAEKRLEQAKENLNRVKDIISEVKEKYDALYL
D3PDY1_DEFDS          IIQ-ASPEEMRLFFDEIAGITKFKERKKEALSKLSSTKENLQRLADIIGEVEKNRNILEN
D4H2V6_DENA2          IIQ-STPEDLRAFFEETAGVMRFKERKKEAERRLYQTKDNLSRVTDIIAEIRAQMETLSV
D6YSC9_WADCW          VIQ-LSPLERRYIFEEAAGILRFLQRKKEALRRLEQTESNIERVRDIHQEVEKQIIVLER
Q04TU9_LEPBJ          ILH-SKPEERRLIFEEAAGISRFKVERQEALKRLEDTKQNLLRIQDIMNSMKKEMEVKEK
E1R6H6_SEDSS          ILS-NKPEERRYIFEEAAGITKYKLKGAEAERKLQRTEENMRQVEGILREVKRSYDTLKV
Q73ML2_TREDE          ILS-SKPEERRYLFEEAAGITKFKVKRQDAERKLEKTQENMKQIEAALAEVRRSYDTLKI
A0A0H3BKB7_TREPS      ILS-NKPEERRYLFEEAAGVTRFKVRGAEAARKLEKTAENLRHLEVILQEVEKSYESSKL
E0RSK7_SPITD          ILS-SRPEDRRQIFEEAAGITRYRQREVEANQKLLRTEENMVHVESVLREVEKRYHALKA
D5EMY0_CORAD          ILS-TNPAERRTIFEEAAGITLYKAQRKEALNKLSLVDANLARVTDVIEEVGRQIGSLKR
B1ZZB8_OPITP          ILS-SKPEERRSVFEEAAGITKYKSQRREAMNKLALTDQNLARVADVIGEVGRQIGSLRR
SMC_DESHY             ILN-LRSEERRTLIEEASGITKYRMRKREALKRLDETEHNLERIRDILAEIEGQLGPLEE
A4J682_DESRM          ILS-SRPEERRSIIEEAAGIVKYRHRKEEALRKLTSAQQDLNRVSDIINELSGRIDPLAE
Q67PF3_SYMTH          ILS-SKPEDRRALFEEAAGISRYKARKREAQRRLEETEQNLLRITDIIGELTSNMDALAQ
B0TGW8_HELMI          VLS-SRPEERRALIEEAAGIVRYRNRKREAVKKLEETEQHLIRLGDIIGELQQQLAAISS
Q2RJX0_MOOTA          ILA-ARPEERRSVLEETAGIARYRLRKKEARQRLEAVEQDLTRLQDLIGELKDQLGPAAV
SMC_BACSU             ILS-SKAEDRRSIFEEAAGVLKYKTRKKKAENKLFETQDNLNRVEDILHELEGQVEPLKI
C5D8T7_GEOSW          ILS-SKPEERRTIFEEAAGVLKYKIRKKKAENKLAETQENLHRVSDILHELEQQLEPLKM
D5DQR5_BACMQ          VLS-SKSDERRKIFEEAAGVLKYKTRKRKAELRLLETQENLNRVVDILHEIEGQLEPLQI
B7IUK7_BACC2          ILS-SKSEERRGVFEEAAGVLKYKLRKKKAEGKLAETQENLNRVQDIIHELSSQVEPLER
Q9KA07_BACHD          ILS-SKAEDRRVIFEEAAGVLKYKTRKQQAEKRLDDTQENLNRVEDILHELEGQVEPLKI
Q5WFM8_BACSK          ILS-SKAEERRTIFEEAAGVLKYKTRKNKAVKRLEQTEENLVRVADILNELEEQVEPLRE
Q7ZAM6_OCEIH          ILS-SKAEERRTIFEEAAGVLKYKQRKKKAEYKLAETQENLNRVEDIIYEIEQQIDPLKE
D6XTT7_BACIE          ILS-SKSEERRMIFEEAAGVLKYKFRKQASEKKLADTEDNLSRVRDIIHELEQQTGPLEE
Q81ZN4_ENTFL          IFN-SKPEDRRGIFEEAAGVLKYKQRKKKAEQKLFETEDNLSRVQDIIYELEDQLVPLAA
A0A0E0UX46_LISMM      ILN-SKPEERRSIFEEAAGVLKYKHRKKQAENKLFETEENLNRVQDILYELEGQLEPLEM
B1HQH6_LYSSC          ILN-SRPDDRRSIFEEAAGVLKYKIRKKKAEHKLVETDENLYRVLDILHELDSRLGPLEM
C6D303_PAESJ          ILS-TRSEDRRGIFEEASGIVKYKSRKREAQRKLEDTENNLLRIHDLVTELEDQVEPLRI
C0ZFN9_BREBN          ILS-TKSEDRRGIFEEAAGIVKYKTRKREAEKKLDDTEQNLVRIHDIVSEITEQIGPLQE
C8WWA4_ALIAD          MLS-TRPEDRRGPFEDAAGIVKFKHRRKEAERKLEETAANLVRVDDILAELEAQLGPLAE
D5WPA2_KYRT2          VLS-NRPEDRRGIFEDAAGIVKFKARKREALKKLEDTKANMMRVEDVIHELTEQATPLAA
C4L5Z7_EXISA          VIS-GKPEERRAVIEEAAGVLKYRQRKKQAERKLQDTELNLSRVDDILFELADRVEPLRE
B1YIN0_EXIS2          VIS-GKPEERRSVIEEAAGVLKYRNRKKQAERKLTDTETNLSRVDDILYELGGRIEPLRE
D3R1B0_MAGIU          LLS-NRSEDRRRVFEEAAGITKLRAQKEETSKRLAKTEENLARVTDIVTELDRQLDPLRK
D2RLB2_ACIFV          ILN-SRPEDRRSIFEEAAGIAKYRLRKKEALRKLDDTAANLLRIQDIQSEIENQLVPLEA
D1BLY1_VEIPT          ILN-SKPEERRLIFEDVAGISRFKINKEDALRRIASTDRNMERVRDVMATIEEQLGPLSE
A5UQ60_ROSS1          ALN-LRPLERRRLFEDAAAISVYEQRRTDAERRLRETNANVARCSDILAELEPRLRSLKR
B8G556_CHLAD          ALT-LRPADRRRLFEDAAEIGGFELRKTEALRRLRESEMNLQRVADLLAELEPRLRTLRR
A9B100_HERA2          ALT-LRPEERRSLFEDAASISLSVSKRAEAERRLKQTEDNLGRILDTLAEIEPRLKVLRR
D1C6T1_SPHTD          VLS-QRPEERRGLFEHAAGITGLRLKQAEAQRHLAETEANSTRLEDLLAEIEPRLRSLER
D7CMX2_SYNLT          ILN-LKPFDRRLLLEEASGLIKYRHRMEEAETKLAVIKEDMARVEKMLSDLEGRLEVLAE
Q0AYV7_SYNWW          VLN-GQALDRRLMLEEAAGVIKYRQQRDEVKKRILNSSNDLLRLGDILEELDLRRQELFR
SMC_LACPL             VFN-AKPEERRSIIEDVAGVLKYKKDKFTTENKLAETTDYLDRVNDIIAELNQQKGPLEE
Q03RT7_LACBA          IFN-SKPEDRRNIIEEVAGVYKYRKHKEKAQRELDDTMAYLHRVEDIIAELEGRVEPLEE
B2GD41_LACF3          IFN-GKPTDRREVIETVAGVAKYKQNKRAAEKRLVTTTDNLNRVNDIIAEINGRLAPLAE
A5VKP1_LACRD          IFN-GKPIDRRGIIETVAGVAKYKKNKETAEKRLTTTMENLNRVNDIISELEKQIEPLEE
Q03FW9_PEDPA          IFN-SKPEDRRAIIEEAAGVLEYKQDKKRAENELEKTSGYLERVNDLIIELEKQVQPLEE
A0A249N2C3_LACRH      IFN-SKPEERRGIIEEAAGVYKYKQQKTKAERELANNDDNLARINDIIVELKHQVEPLRE
Q38XR7_LACSS          IFN-SKPEDRRNIIEEAAGVLKYKQQKKKAQSELDQTDENLSRIADIVYELKGQVEPLKE
Q1WU99_LACS1          IFN-SKPQDRRILIEEVAGVLKYKKEKKKAESELVETTEHLKRVADILSELSRQRDPLAQ
Q04GL1_OENOB          IFN-AKAEDRRAIIEDVAGVFKYKQNKNKSQNQLLQTQENLDRLLDIIKEISDRLQPLEK
Q03VW6_LEUMM          IFN-AKPEDRRGIIEEVAGVYKYKQNKEKAQKELTQTSDNLSRVADIIHEIESRIDPLAE
A0A0U5K8Z4_LACDE      ILN-SQARERRGIFEEAAGVLHFKQQKQQAQRQLETTNDNLIRINDLVNELEKRLEPLHE
E4SKB3_LACAR          ILN-SRPEQRRLIFEEAAGVLHFKQQKEEAQTQLKKTQDNLIRINDLVKELEGRLEPLHE
Q74IP9_LACJO          ILN-SKPQQRRGIFEEAAGVLHFKQQKEIALKQLDKTNANLIRINDLVKELEGRIEPLHE
A0A0T8KIP4_STREE      IFN-SKPEERRAIFEEAAGVLKYKTRRKETESKLQQTQDNLDRLEDIIYELDNQIKPLEK
A4VVL7_STRSY          IFN-SKPEERRAIFEEAAGVLKYKTRKKETESKLAQAQDNLDRLDDIIYELDNQVKPLEK
C0MCR5_STRS7          IFN-SKPEERRAIFEEAAGVLKYKTRKKETQTKLNQTQDNLDRLDDIIYELEHQAGPLER
A2RLZ7_LACLM          VFN-SKPEERRAIFEEAAGVLKYKNRRNETESKLNSTQDNLDRLEDIIFELNSQLVPLQS
B9EBB4_MACCJ          VLN-AKPSERRQLIEEAAGVLKYKKRKVETEQKLEDTMNNLSRVHDIIFDLKDRVEPLKI
SMC_MYCHR             IAE-ATPEQRKAVIEEAAGTSKYKLDKEEAQKKLIRTNDAIDKLQGAIKELERQVNSLDK
E0TKT8_MYCHH          IAE-ATPEQRKAVIEEAAGTSKYKLDKEEAQKKLIRTNDAIDKLQGAIKELERQVNSLDK
Q4A770_MYCH7          IAE-SSPEQRKQVIEEVAGTAKYKIDKTEALTKLDQTLIAIEKIEIRTKELEKQVKQLEK
C5J708_MYCCR          IAE-ATPEQRKAVIEEVAGTAKYKLDKQEALTKLEQTKTAIEKIEIKVRELERQSKNLEK
A5IYM7_MYCAP          IAE-ASAEERKGIFEEAAGVSKYKFRKKEALSKLAKTQEGLDQIALVIAEIERKLNPLRK
D5E4P4_MYCCM          IAE-STDEQRRAIFEEAAGVSKYKFRKLDAIKKLERTTDSLEKIGLVVSELEKQITPLRK
Q6KHN4_MYCMO          IAQ-ASPEERRKIFEEAAGTSKYKLRKEEALRKLEKTKEALDKVKTVVLELNKQLIPLEK
Q98PK8_MYCPU          IAE-ASPEDRRGIFEEAAGVSKYKSRKKEALRKLEKTNESLEKIQTVILELEKQLKPLKN
D1J8Q8_MYCHP          IAE-STPEKRREIFEDAAGTSMYKSKKIEAQRKLEKTQEALEQISILIQEQERQLKPLQR
Q4A588_MYCS5          IAQ-SSEENRRGIFEEAAGISKIKYQKEESERRLLKTIAELEKTQISISHYEKDLNYLEE
SMC_MYCGE             FVE-AKPEERRKIFEDASGIGRYTKRKEEVVNQLNRTLINLKQVSVVLNELKKDLKKLTL
SMC_MYCPN             FVE-AKPEERRKIFEDASGIGRYTKRKEEVTNQLARTVQNLKQVSIVLNELKKDLKKLTI
Q7NBU0_MYCGA          FIE-AKPEDRRQIFEDAAGIGRYAKKKQDAIRQIARTNDNLKEITTIVNELNRDLKKLNQ
Q8EVS6_MYCPE          FAD-SKPEERRTIFEEAAGISKYIRKKEESLRQLERTQNNLNRVNDLTKELYKDIKKLEV
Q9PR04_UREPA          FAE-AKPNERRKMFEEASGIGRYSKRKQEALNSLSRANENLARLNDIVANLKKELAKLQK
Q6F1N4_MESFL          FAE-AKPDARREIFDEAAGLAKYKKRKLEALKQLAKTTENLTRISDIKLTLEKRLPREKE
Q6MTD2_MYCMS          FTE-SKPETKREIFDDAAGVSKYKKRKKETLSKLEKATENLTRLEDIAKEISRRLPNLER
E3GP81_9FIRM          IIG-ASPQELRGIVEEAVGIVNYKTKKQEAEKKLENTQNNLERLKDILEEIEKQLKPLKA
SMC_HALOH             IIN-SRPEKLRELFEEAAGISKYKSRKMDAEKRLEKTNHDLQRIEDLIWELEKQVGPLEK
E4RL35_HALHG          IIH-SKADKLREFFEEAAGIMKHKSRKEDAEKRLENTNNDLNRIHDLVSELEKRREPLKK
D9QRN7_ACEAZ          ILS-SKATERRLIFEEAAGITKHKQRKKEASRKLEKTEQDLNRVNDIIGELEKRVGPLEK
A8MHB7_ALKOO          ILS-NKSEDRRQIFEEAAGIVKYKTRKDEAEKKLTSTKENLLRVLDILNELEGQLSPLKK
A6TRT3_ALKMQ          ILS-SKSEDKRQVFEEAVGIVKYKTRKEESEKKLQNTTENLDRVKDILSELEKQLNPLKK
A3DDY2_HUNT2          ILS-SKSEDRRAIFEEASGIMKYKVRKQEAEKKLEMTRQNLLRINDIIAELENQLEPLRE
D5X8N2_THEPJ          ILS-SKSEDRRLIIEEAAGIVKYKNRKLQAARKLEDTEQNMVRINDIIAELENQVGPLEE
D9R048_CLOSW          ILS-GKPEERRELFDEAAGIVKFKRRKLIAQKKLEAEKQNLIRVNDILTELEKQVGPLAR
C4Z0E6_EUBE2          ILS-GKPDERRELFDEAAGIVKFKRRKATAIKKLENERANLVRVNDILSELEKQVGPLQV
C4Z924_AGARV          ILS-GKPEERRELFDEAAGIVKFKKRKLTAQKKLDNERENLVRVNDILTELERQVGPLQR
E0RV40_BUTPB          ILS-SKPEDRRNLFDEAAGIVKFKSRKETAIKKLEEEKINLTRLSDILSELEKQIGPLEK
A9KLR0_LACP7          ILS-GKPEERRELFDEAAGIVKFKKRKALAERDLEAERLNLSRVSDIISEIERQIGPLAK
D9S347_THEOJ          FLI-SRPEERRMIFEETAGIMKHRARKREAEKKLEETMANLTRVDDILTEIESQLEPLFS
B2A2N3_NATTJ          ILS-ASPYERRYLFEEASGILKHKTRKQEALKRLNDTEHNLSRVSDVIEELNQQLPPLKQ
A8F8R1_PSELT          IVN-ASPEELRLLLEEAAGTAFYRERKKESLARLEIVNNNLARVQDILYELDRQRKSLYL
A5IN04_THEP1          IVN-ASPEELRLLLEEAAGVSIYREKKKETEMNLERTKVNLDRVKDVLFERERQMKSLYL
C5CIS4_KOSOT          VVT-ASPYELRALIEEAAGTAIYKEKKKQSLAKLSETEANLNRIEDILFELGKQRKSLYL
A7HMD4_FERNB          IVS-STPENLRTMIEEIAGIGIYREKKKEALSKLETTQINLNRISDILFEMDKNRKSLYL
B7IHN5_THEAB          IAM-ATPQELKKIFEDAAGTSVYIERKKEALSKLAGTEANIERLKDIIYEIERNKKSLYI
SMC_THEEB             MIS-MNAKARREIIDELAGVADFDRKIAQAREKLDTVKEREERFRIVERELIQQRDRLQR
Q2JHS4_SYNJB          IIS-MHPKERRQIIDELAGVATFDRKIAQANSKLEAVREQIERFRLIEQEWQAQGERLLK
SMC_SYNP6             IIS-MSPRDRRQIIDELAGVAQFDRKIEQAKGKLEAVKEREDRCRIVEQELIEQRDRLAK
B0C9C4_ACAM1          IIS-MNARQRREIIDELAGVANFDRRINQAKDKLDAVKEQEERSRIVEQELNDQCERLAR
Q115J3_TRIEI          IIS-MKSRERREIIDELAGVAQFDRKISLAKEKLDLVKEQEEKSRIVERELEKQCGRLSQ
B2J925_NOSP7          IIS-MNARERREIIDELAGVAAFDRKIIQAKSTLDEVKEKEDSCRIIETELTAQRDRLSQ
E0UKI1_GLOV7          IIT-MNSRERREIIDELAGVAEFDRKIEKAKETLESVREREERCRIIEQELMRSLERLAT
B7K4Q6_RIPO1          IIS-MNSKERRQIIDELAGVAEFDRKIEKTKETLEEVREREERCQIIQTELQRSLERLAA
B0JSN6_MICAN          IIS-MNAKERREIIDELAGVAEFDRKIEKTKENIDSVKEREERCQIIATELQKSLEKLAL
SMC_SYNY3             IIT-MNSKERREIIDELAGVAEFDRKIVKTKETLTEVQDREERCQIIATELERTLERLAA
Q84EC7_SYNP2          IIT-MNGRERREIIDELAGVAEFDRKITQTRETLNAVKEREEKCHIIRQELERNLEKLAD
D3EQ04_ATETH          IIS-MNSKERRVIIDELAGVAEFDRKINKTKETLEEVRDREERCKIIQVELENSLERLAG
SMC_GLOVI             IIA-MPARERREIIDELAGVAEFDRKIEAARRELGEVEVRSDRIQAVVSELLEQMERLQK
A5GQT1_SYNR3          IVS-MSARDRRGIIDELAGVALFDSRIEQSRRKLDDVQEREERCRIVEGELEASRTRLER
A9B9B9_PROM4          IVS-MSNKDRRGLIDELAGVALFDHRIDQARTKLDDVFERQERCRIVEQELFTSKVRLEK
A2BNJ6_PROMS          IVS-MNNKERRNLIDELAGVALFDTRIEQTNAKLNDVFERQERCEILENELQSSKNKLEK
Q46EX0_METBF          IIS-MTSVERRKIIDEIAGVAEFDERKQKALGELEVVKQQIERVDIILEEVRTQLGKLAG
D7EAF5_METEZ          IIT-MTPVERRKIIDEIAGVSEFDNKKERAMNELETVREHIERVDIIIEEVNNQLDKLKD
D1YW78_METPS          IIE-VSNFERRKMIDEIAGTAEFDEKTDKALSELDIVRDRIDRVAIIISEVEARLAQLKD
A0B8B9_METTP          IIE-MGPTERRRIIDEIAGVSEFEEKKQRAMAELDVVRERIARVDVILEEVGQQLRRLQA
D4GT30_HALVD          IIN-MTPYQRRGIIDEIAGVAEFDEKKDAAFEELEAVEERVDEADLRIEEKEARLDQLAD
A7IAD8_METB6          IME-MSDFERRKIIDEIAGVSEFDTKKQQALSELDVVRERIEREELLLIELTKRAHELKK
A3CWK7_METMJ          IME-MTDGERRKIIDEIAGVAEFDHKRGQAFSELEVVRERLEREELLLNELVARLDALQH
B8GG37_METPE          IME-MSDGERRRILDEIAGVAEFDQKRDQALAELEVVRERIEREELLLQEASLRLVELEK
E1RII6_METP4          ITE-MSDVERRKIIDEIAGVAEFDKKRDQALSELEIVRERIEREELLLAELERRLKDLEK
Q2FLH3_METHJ          IIE-MSDNERRKIIDEIAGVAEFDSKKDMALSELSQVRERMTEESVHIEELSVRLAQLEK
A2SS75_METLZ          IMD-MSDLERRRIIDEIAGVAEFDDKKEQALVELEQVRASIDREEILLASYAKQLEELAD
D3RYW2_FERPA          IVE-MSPYQRRKVIDDIAGISEFDEKKEKALQELEVVRENIEKISAVLAEVEQHLKTLEK
O28714_ARCFU          IIE-MSPFQRRKIIDDVAGISEFDEKKEKALEELERVRESIEKLEAVIAEVNDRLQTLER
D2RFP2_ARCPA          VAE-MTPIQRRKIIEDIAGISEFEEKKEKALEELEEVKRNIEKVEITIKEVDDRLSQLKV
SMC_THEAC             FIS-YSGQERRKLIERISGVDQFDSEIERVKADIEAVSRNMEINQTIIDEKRQNLERLRT
Q97AI9_THEVO          FVG-MSGVERRKLIERIAGTEQFDVELEKARNDIEEVGKNLDILSSMIDIKGQEVEKLRI
SMC_METVO             IID-TSPNERRKILDEVSGVAEFDEKSEKAKKELSQAREYIEKIDIRINEVRANLEKLKK
A6UQ42_METVS          IID-TTPNERRKIIDEISGVAEFDEKGEKATKELEKAREFIEKIDIRINEVKNNLEKLKR
A6UVP1_META3          LIE-MSPRERRKTIDEISGIAEYDEKKEKALRELENAREYIDKIDIRVNEVRANLEKLKK
SMC_METJA             IIN-ISPIERRKIIDEISGIAEFDEKKKKAEEELKKARELIEMIDIRISEVENNLKKLKK
C9RFQ3_METVM          IIN-VSPIERRKIIDEISGIAEFDEKKKKAEEELKKARELIEMIDIRISEVENNLKKLQK
D5VT24_METIM          IIN-MSPIERRKIIDELSGVSEFDEKKKKAEEELKKARELIEIIDARISEVKSNLDRLKK
D3SQ87_THEAH          FVK-MTPVERRKLIEEISGVGEYEEKKQKALADLGDVELRIRELRLLMDELEVHMEKLKE
D3DG53_HYDTT          FLR-MTPVERRKLIEEVAGIGEYEEKKQKALADLGEVELKLREFRLLIDEMEVQMERLSE
SMC_AQUAE             FLK-MTPVERRKIIEEISGIGEYERKKEKALEELAEVELKIKEIDLILEEISNQLKRLKE
B4U7R1_HYDS0          FVK-ITPLERRKIIEDVAGISEYEQKRQFALEELGEADIKIRELKPLVEELEANLEKFEK
C0QSN8_PERMH          FVK-MTPSERRDLLSEIAGITEYEEKKEKALKDLTETEEKIQSAKLVLKEVKIQLKRLEE
B2V736_SULSY          FVN-MTPGERRELLSEIAGITIYEEKKQKALADLKEAQEKVDNVKAVLKEIEHTLKKLQQ
SMC_PYRFU             FIK-MSPLERRLLIDDISGIAEYDSKKEKALEELKQAEENLARVDLLIKEVKKQLDKLEK
C5A612_THEGJ          FIK-MSPTERRLIIDEISGIAEYDAKKEKALDELKKAEENLARVDLLIKEVKKQLDKLEK
D1CC09_THET1          VLL-ISPEHRTVLLEQAADITHHFKRRDETLKRLAEVEDNLRRVEDLLNDSRPRLKSLIK
D3TAQ9_ACIB4          IVE-MTPVERRTILDDIAGITKFDNEIKKAEDKKKITEENMGRIEARLDEIKRNMEKLEK
SMC_HALMS             LVQ-AKPEERRTMIEEVAGITKFKVRKKESLKKIEQTEQNLNRLQDLQSEIEKNLKALQK
Q6L0R1_PICTO          IIT-MSGSEKRKLFEALAGIESFKEKIENARSDIQGVENNMNTVSALISEISSRLEKLRI
C1A7M6_GEMAT          LLS-DRPDDRRELFEEAAGVGLYRDRRRSAERRLEETTVDLARLDDLIAEVQSQVRSLAR
C9RN51_FIBSS          VLS-DKADDRRVLFEEAAGVSKYKQQRKETRRQLERVQMDMERVEDNLRSVRRSVRLYET
D1B5Z0_THEAS          VIQ-QRPMARRMLLESLLGIDFYRKRRNESSDRLKEVSEDLGRLMAFYGELSSRRREISQ
                                   ..                                             

SMC_FUSNN             QAELAQKYIDLRDEKSSLAKGIYITELEQKEKNLSENENIKEKYQTECFELQEKLNKTLE
E3H7H1_ILYPC          QAEKALKYRELQSERDSLAKGIYERELEIKSLRLDRINETVENLQSGIEEQQKNFEYSEE
D1AK68_SEBTE          QSDKAKLYKALTRKINTLKLMTVNYNINQKNIDKKDMKDKIEALNEKIKEVENEFSVKEA
SMC_CLOK1             ENKKADEFLRLSEELKDKEKTVLIYSLKKIQHKIDKLESSMERITSSNRESHLELTKLRE
D8GS00_CLOLD          ENDKANEFLKLSKNLKEKEINLLVHSMEKIESKIGENQKSTDFMDKEVKELNLEFVDLKC
Q97IA1_CLOAB          ESEKAKRFVELSDELKTKEINTIIYSIDNIDYRINDLKQKMADLKLSIDENVKDKEKISL
A0Q0Y7_CLONN          ESDKAKAFLEISKKLKEREVTLILDNIDKCKEKINSVKEKIEETNIKLKDAFNKKNIHKE
Q895M7_CLOTE          ESKKAKEFLNLSNNLKEKEINIILYSIEELNSKVGQLDEKIKEVQGEISNLELKKNDYKE
Q0SSA4_CLOPS          EKNKALRYLELSNELKHKEISSIMSELHNIDGVILKQKEKIKDLIAFNGKQKEKYKEERE
A6LSM4_CLOB8          EREKALEFTDLSNNLKKKEVSLIVHTIDKMEEELKGFNEDLNLKIKEIEDKRKEVSSYKS
D9SLC7_CLOC7          ESEKAKEFLKLSESLKNNEISLMIDSVEKIQSKLEVNKEALKQQEEALKEIYEDKSKLKD
D7APA8_THEM3          QKSKAEEFLKLHKEKRKVDISLYIQLAKKSMNQYDALKGKYENLKSQLNVKKIHKINQEE
Q8R9W7_CALS4          QKEKAEKYLFLKEQKKEADISLYAQLAKRAIKRYDEFRMQYDVLVKKLEEKTREKQEEEK
D9TN88_THETC          QKEKAEMYTKLQEEKKRVDITIHYFDVEELFKKLNNLKEEQDIIEKEILKFQSEIEDRNK
C9YKI7_CLODR          QQTKAKKYLEISEKLKILEVNSFIREIEGIEKELSEVNEHRKVIEKELNEKEEQKNVVEK
E3PS49_ACESD          QKTKAEKYLLLKEELLASDVNRLLSSYFSMDSDLEKINSLILETDENNAKLSEQLVSEET
B0S1M4_FINM2          ESSKAKKGMVLEEQLKEMEIQKAILDIEKLSITLSDVIDKKEINDQSLIEIKSKLVEYEN
Q3AC59_CARHZ          DVIKAKTYLTLKEKLTFKAKNYYGIKIKNLLDKVRENEEKITLLHNLIEKNQDQVNRLEA
E4SF58_CALK2          DVEKAKTYLQINQRLQSLKKEKYVYEYNLKGKRYHDFLIKEKELNEELEKLIHMRRKLEE
SMC_RHOBA             QAGKAERYRQASDRLKELRTVVAWNDWLTLSTELNEATTQLEAAQRQHRKADTLRESLEE
D2QWB0_PIRSD          QAAKARRYREYSTRLQQLRTQTAQVDWRKLAEQLEAITAKVATFTSEKEELVVRVQELEQ
D5SU17_PLAL2          QAAKAVKYRELHQELTRWWLGLAADDTRALQFQLNELAAKIVALDAERENLTSEHQKIEA
SMC_KORVE             QAAKAERYAKLRDEMREKLRVVLASKFALIDAEIAGLEAELTTVTEEIATRTDAVQQMDN
C1F1T5_ACIC5          QAAKAERYGALRDELRGRLRVVLASKLAQMDAEQAGLQQEIQETTASIDERSAKVEELDQ
Q01Y77_SOLUE          QASKAKRYGELKAELETRLRVVLSGKYRLLERDAAKTAIDLNNAAAELKQYGEQVAEREK
SMC_MYCPA             QAEVARRAQTIQADLRDARLRLAADDLVNRRGEREAIFEAEAAMRREHDEASARLAVASD
SMC_MYCTU             QAEAAQRAAAIQADLRDARLRLAADDLVSRRAEREAVFQAEAAMRREHDEAAARLAVASE
SMC_MYCLE             QAEVARRAATIQADLRDARLRLAADDLVSRQGQRDAIVEAETMMRRDHDEAAARLAVASE
A4FMG9_SACEN          QAEIARKAQTVQADLRDARLRLIADDLVTARAELARDEADQETAKVKRAEVERALQFAQS
C8XH72_NAKMY          QAAVARRAAGVQADLRDARMRLLADELTQILTKIEQDAVDEQTAVEHRNRVQRDLAEATE
D7GEI0_PROFC          QAAVARKAAVVQAELRDARSRLLADDLTAARLALASEQENQAGQEKLRADARARLEQARS
Q2J6Z3_FRACC          QAEIARKAGVIQASLRDARLRLLADDLHRAQVAITSDLADEEALRARLTTTEAAHAAAAR
A8L599_FRASN          QAEIARKAGVIQAALRDSRLRLLADDLATARCAIASDAADEDALRLRVAQTEKALADGQR
C9Z3S1_STRSW          QAAVARRAAVIQADLRDARLRLLADDLVRLRAALRTEVADEAALKQRKEAAETELKKALQ
D7CC86_STRBB          QAAVARRAAVIQADLRDARLRLLADDLVTMREALRTEIADEAALKQRKETAEAELRTAQQ
B1VYX5_STRGG          QAAVARRAAVIQADLRDARLRLLADDLVTLRVALRDEIADEAELKKRKDAAEAELRTALA
E4NHH3_KITSK          QARIARRAAGIQAELRDARLRLLADDLLTLRRAVEAEVADELALKLRRTTVEQELAAAIQ
C7QGY1_CATAD          QAEVARRAVVIQSDLRDARLRLLADDLVGMRQAFEQEAADEEQMKVRRKQLERLYAEAQA
A0LV82_ACIC1          QAETARKAARIQADLRDARLRLLADDLVTLRAELERDIADENAARARRDELEQHVRRLRA
A0JXV4_ARTS2          QAEVARRAQSVQFDVRDARARLLADDLVQLQSALAQDVADESALKARRAVVEEGLKNGRQ
A1R7H8_PAEAT          QAEIARRAQTVQFDVRDARARLLADELVQLTTTLEKDVADEAALKERRQVVEAGLGSGRR
A6W7T9_KINRD          QAEVARRAQVVQADLRDARLRLLADDVVQASSSLQRDEADEAALKARQVQVEADLAEAAR
D1BJA3_SANKS          QAEAARRAAVVQADLRDARSRLLADDLAQLTASLEQELADESALRARQAEAEAALEVART
C7NGM6_KYTSD          QAATARRAAVIHIMVRDARARLLADDLVQQQAALDSDLADEQAALARRQQAEQALAAASG
B2GFM7_KOCRD          QARTARKAQRIQYDVRDARARLLADDVVAARAGMDTDQEASAGARRRRDELEKTTAELAR
E1VVN2_GLUAR          QAKIARRAKTVQLDVRDAKSRLLADDLVTLNNKLAQDIDDESRIQAQQDDANARLERGRK
A5CQQ2_CLAM3          QAEVARQAQTVAAVVRDARARLVADEVVTLRRALAEHTRTEEERTTERMVLQEKLDRAVI
Q6AE90_LEIXX          QAEIAREAQSIAAIVRDARARLLADDVVGLRRTLDGHVRTEAERHTEQIVLQEQLEQKLL
D1AB24_THECD          QAEIARKAAVIQAELRDAKARLLADDLVTLRTRLEREEADEAALQRRRAEVEQALAAAQQ
D6Y659_THEBD          QAEIARKAAVIQADLRDARLRLLADDVVTLREELRREEADEAAVRARRAEVEAQLAESQR
D7BMZ9_ARCHD          QAATARRAQAIQQTVFDAKARLLADDLAQLNARLATQTANDSTIDSQREAAATAVTQARA
D6ZIF1_MOBCV          QAEAARKAARVQAELADATARLIADAVAQNKEKAGSQTASKEQISAQLADLETRLQELNT
C7R311_JONDD          QAQAAQRAAILQAIDRDTNQRLLADDLTTASALLKDRQQVLTQAREQRDDINRQLDVVRS
D6ZV06_BIFLJ          QARISRRADAIQISVRDAQARLYAEDAQRSMNRRDTVRQELGDVRNQLAVVQRELAHVKV
Q7ZAJ9_COREF          QAEAARRAATVQADLRDARFQIAGFEIVRLSEKLETSTDREKMIRDQVETAREALEEAAG
Q8NNW5_CORGL          QAEAAQRAATVQADLRDARFQIAGFEIVKLSEKLETSTEREKMIREQAEAAQEQLEEATT
Q84F13_CORDP          QAEAARKAATIQSEVRDARLRIAGYQIHSLASSLKDAQSHHDSIAEKLEEVTEQLEEATG
Q4JUZ1_CORJK          QAEAAQKASAVQATIRSTRVQLAAHKVKQLSEELNDSTRRSEMLAEQRAELQAELEEHSE
C4LJD3_CORK4          QAEAAQKAATVQSDLREARLNLAAHSLVTARDDADELTRRANEAREKEEALVEKLEELRE
D6Z8M0_SEGRD          QAEAAKKAHAAGAKLRDARRRLAVAKIARTNQAAAATGVAARETAARKEAAQRELDAKLS
C8WGU5_EGGLE          KAKRARTYQGLADELADLSLSLAVDDLRTLRRGWDDALARERALEAELEEKRAAIAQAEA
C7MMZ7_CRYCD          KARRALAYKEVSAELAQVKLGLSVDDLRKLQVSWDEARTRDTQLTDKLSDMRATIEHAEK
C7N560_SLAHD          KAKRAEAYQGLSSELAQLNLLLAVDDLRRLQRAWDGALKEETEAAALIDVKRFELEQSNE
E1QVK5_OLSUV          QVDKAKRHHDLASELSLLTTTLAVDDLRQLQQRWRLLTEHGKEADAAIELAQYRLDEKSS
C8W740_ATOPD          QVDKASRAKDLSAQLKDLTVQLAVDDLRQLQFAHSKLEVRAKEAEAAIELAQYRASEKNR
SMC_RHOPA             QARQAIRFREVAAKVRKTEAMLYHLRWRDAQAEVGAAAEVHDLGVRQLAECTRVQAEASR
A7IGT2_XANP2          QSRQTVRYKALAAEIRQCEATLLWLRWGEVTRALTEAEHAVEATHRDGAEHTRMQAEAAR
B8EMM7_METSB          QARQAARYRDLAGSIRRAEALLALIHHKEAAQSLAEAEASLDIFTREVEERTKAQAEAAR
B8IQU0_METNO          QAKAAQRYRALAAEIRRHEALLLLIAHAAARDEAMRAERAVAEALDRAAAAQAEQSAAAT
Q92RE8_RHIME          QARQANRFKMLSAEIRRHEAILFHTRWVQAKEAEAEATSHLNQITALVAEKAQAQMEAAK
A7HQY9_PARL1          QARQAVRYRNLSGQIRETEAILLHLRWTQAVETLKHSEERLAATDVRVAELTREAAAAVT
D8JUP9_HYPDA          QARQARRYKEISGEIRQQEALARHLTWQDAQASVDQDEAQLAHAMARLGAATEAEAKSFN
E3I0B2_RHOVT          QARQAQKYRELTTELRKLEAMQHHLHYSAANVAVQSEEAQLLEALRAVGQFTQAEAAALR
SMC_RHOS1             QAKQAARYREIGEELRRAEGSLLYRRWREADLARTEALAILRERMTAAGQAEAAARKAAG
Q2W040_MAGSA          QARQANRYRTLSEQIRRVEAQVLYLGWLEALVTVDAARAAFRESEMRVEEATSHAANASA
D3P3X3_AZOS1          QARQATRYRNLSDQIRRAEAVLWHLRWLAAQEESARAHAAFAAAEALVRDHMLAVNQLTA
B6IR58_RHOCS          QARQAARYRNLQDHIRRAEAVLLHLKWTQAQGQLDRAMAGFAEAENAVRALMLAATQATT
Q2RPA2_RHORT          QSRQAARYRALSEAIRQTEAALLRQRWLVAIRAVDGARRIFAEGGRELAVLSGRTITANR
SMC_CAUVN             EARQAEKYKRLSSEIRAVQGAVLYARWTEARDHLERTTSEATAAARLVEETARASAAAQV
B0T003_CAUSK          EARQAEKYKRLSAEIRAVQGAVLYARWTEARDNLNRTQSDTTEAARAVEDTARAAATAQT
Q0AMJ6_MARMM          QARQASRYRKLSASIRALEAAVWLNRWREAASAVETAEAVLAEKRTATEDSSLAAAEART
E0TC69_PARBH          QARQAVRYRTLSENLKKTEALLAYSRWADARDALEGANAQLEGTRRQLEEAARAAASATA
C6XRC2_HIRBI          QASRAKKYRALQEQIETLEAQIAYYKWKTAREETALAQASVLETSQSVQEYAQLEASCAA
Q0C0X5_HYPNA          QAAKARRYRRLSEEIHGLEALLAHLRWAEARQATETARAQLEVCKREVEDLSREDALRER
Q1GQU3_SPHAL          QARAAEKYKKLSDDIRIAEARLIYARWRDAAAAADQARRDADAAEAAVKAAQDELETIAK
D4YX43_SPHJU          QAKAAERYIRLSEQIRIAEARVIFARWREAAASADAARAEAKQAESAVAAAQEAQQAAAV
Q2G9S3_NOVAD          QARAAERYRAVSEKIRLAEARLVFARWRDAAAAAEAARKQAVAAEDAVKAAALLANQAQA
D5BSU5_PUNMI          QARQAARYRSVADRIRQAEAQLLFARWTSAQNDLAGAEADLNQAKLLVASRTSEAATIAT
A5FVJ2_ACICJ          QARQANRYRNISGLIRDAEAEYLAIERELAERRRRAARAQFAEAEAAVGHAEKLRDDVLG
C5B6I7_METEA          EAEQARRRMEIDGLVRRAEATLLHVRHRTADDRLSAATAKHDGAEREIADAMAALAAGER
Q937L3_DEIRD          AAQDAQEHRRLSERAGLLEGALAREKQLTLLREIAGARAEAASLEARSAALAREVTEAAA
Q1J060_DEIGD          SARDAGLHRELTLRVLMLEDALKRERQTALVREIAQARQEAGELEARSAELAVRVQAAAA
L0A7J5_DEIPD          DARAARRARELALRELALRDALVRSRQEALAAEIETLRAGELQLAARSLEAAQALRQAQD
D7BH70_MEISD          QAEAARQARALSTQILRLRHALIRVRAEEALAEARKAEERITALEAERQELSERLAQIQI
SMC_THASP             QAAVAARYRELDAAHVEKQQLLWLVKRNEARAEQARVAASLNEASSRIEADSARLQELET
A1K715_AZOSB          QAEVAERYQRLSTAHVEKQQLLWLLKRNEAKAERDRVAEELNRNTLRIEADSARLQELAA
C7RKG8_ACCPU          QASVARQYREYSDDLVRRQHLLWLLRRNEAQAERERLAREVAQAANDLEAQNAALRDLEA
Q3SJI0_THIDA          QAEVAQHYRSLQADLTFAQHRLWFARKHDAAQQRARIDKDLAEAQNRLEAETARLRHIES
SMC_DELAS             QAEVAAQYNALQSQVTLKQQQLWFLKRAEAEAEQDRVRVEGLQAVNELEERMADIRNNES
D6CTE6_THIA3          QAEVATRYQGLQASATLVQQQLWLLRQEEAQAKRQQITLAGGEAMNALEARIAEQRAIEA
SMC_BORPD             QAEVARQYRELQADGEKKQFALWLLKETGARDERQRKSQEMAQAQTNLEAAIANLRSGEA
SMC_BURP1             QAVVATKYKELVADGEEKQRLLWLLRKNEAAAEQDRQRRAIGDAQIELDAQTAKLREVEA
A4SYV7_POLAQ          QATVAERHAELSTQMKSQQQLLWFVRQTEAGKEQERHANGIRDTQVNLEEQTAKLRHAEA
D5CRW3_SIDLE          QAEVAKTYRELEARRETTQKLLWLVNKQEAETRRVRLSQQVEKTKNELEAEIAKLREVEA
D9SGR3_GALCS          QAAVAVQYRELETLRDTAQHLFWLLRREEAELARAGFAAQIEKCRTELELKTAVLRENES
Q2YBB9_NITMU          QAETARRFEDLQSRLDKAQNLLWFARKQEAASQRALAEKEIQSLQTTLEAEAAALRRAEK
Q0AE88_NITEC          QAEYATRYQDLHKQLAAAQQAFWTLRKQQATESRHAAQEEIERLTQEMEIIRSSLQETAE
D7DI79_METV0          QAVVAAEYHRLQAALTITKGQVWLLKKRDASAQWEKAQRQVEKLVNELEAQMASLRSNES
C1D4R7_LARHH          QAEVARQYQTMREQLAQQQNLLALVKKREAQEGEARAQAELARLETELAMLSGRGSELDA
Q7NR76_CHRVO          QAEVAAQYHDMRGALTHKQNLLALARREEAARNEAHARGELARIETEEAALEASATHLET
A1KSF4_NEIMF          QAETAERYKSLTAQLNRQQDLLDYAQWQQSLAAADKATEQHQSLQAQQDETAAQVQALND
A1WY82_HALHL          QAETAERYRTYKAEERRLRGELSLLRLRDLDQRIGERDASIRDQENQREAAVAEQRRAER
Q0AAV4_ALKEH          QAEVARRYRELKQAERDTRAELITLRQASLKAQLEEQEAVIAAKVNAREFALATQRQAER
SMC_XANOR             QARQAEQYQALQEERRIKDAEWKALEYRGLDGQLQGLREKLNQEETRLQQFIAEQRDAEA
B8GTL2_THISH          QANTAERYKALKEEERRTKAELLALRLRDMDGDAGQREKGLREEETRLEGVISELRHLES
Q3JAH9_NITOC          QAKQAEKYQELKQLKRKIKAQIEALRWRALNEEAHQQNRQIEHQETLLEGCTADLRRVEA
D3RSW0_ALLVD          QAATAEKYTQLRAEERRLDLELKALRWRALDDELQALSRRLAEAENQGEAGLAEQRRLEA
B3PGR0_CELJU          QAQSAEKYAEYKQEERLLKAQLQALKYQQLDDQAKAKQLGIRDLELRMEAFITDQVNKDT
A6V7X5_PSEA7          QAQSAEKYQEHKAEERQLKAQLGAVRWRDLNEQVGQRERVIGDQEIAFEALVAEQRGADA
Q0VR03_ALCBS          QASAAEKYKQYKEEERLKGAQLKALRWKGLDVQVKQLDHVIGELDVSMEAKVAEQRHVDA
C7RBE2_KANKD          QATSAQRYKEYKAEERELKAQLAAIRWQTFNSKIEALDDAIQKMETEVEAKIADQRNSDS
Q2SD45_HAHCH          QAKAAERYKELKAEERDKRALLNALKWRTLDKEATGVQEELRGQEVELERLLYERTSLDS
E4PL89_MARAH          QAAAAEKYKAFKQEERQKKAELTVLRWQSLDNDLQAWRGKIRDTELELEKYLTERVSLET
E1V8E9_HALED          QADAARRYQTLKQEEYRLKGELALLRGRALKASQDEEEARVGELETAVEREVLGLRQCET
D3SAL9_THISK          QAATAEKYQTLAAERRQKRAEAILLRLRAQEQELEASRQRLQDAETQLAGTQAEAQKVRT
SMC_METCA             QARKAEKFIALRDEERRLKLELLGLRWRALERQLDRLKAELTDSEERFRRLTGEEHACET
SMC_COXBU             QANAAERYKAYKQEERALGAQFKVLQWKALDHKLSEHDQAINQKNTRREEKQSEQHRIET
Q5WTI1_LEGPL          QATAAERYTILKEEEKICRAEIQALKWQEYSEKQTVKQRELQELAIRYEQQQSLLTSCYK
Q12L80_SHEDO          QAKSALAYREFKQQERQLQAQLLVVRYQELALNTEKIDKEIQLLELELAEINAAAQAASL
Q080K7_SHEFN          QAKAALQYRELKNSERELHSQLLVMRYQQLLQQTDRLDAETAEGELKSEALAKTAQQGDT
A4Y804_SHEPC          QAKAAKQYRELKQAERKTHAELLVMRYQELQDQMASLSEQISAIEVQQAAAQSLAQTDEL
D4ZIY3_SHEVD          QASEAKQYRELKQSERQLDSELFVSRYLELIHQTERLTLDVNRLELAKAEVEAEKERTEL
B0TKB4_SHEHH          QAETAKKYRELKQAERKCDAELSVSRYHELLQQIAKIDEQLGKLALQQAQFLAEKQTIEL
A3QFJ7_SHELP          QAEAARQYRALKQTERDQHAQLEVAKYLELSAQSDKLSQEIEAKTLTQSEGDAGREALSR
A1S5R5_SHEAM          QAEAAKRYREYKQAERTTHAELLVMRYQEICQQADALGREITQQDFLYQSAKTSLDTTAA
Q5QUJ9_IDILO          QAAAAIRYKELKASERKFKGELQALRWLKLDNQRQQLQTQYAEQQTELERWQAQQSGDER
E1SMV2_FERBD          QADAARRYRELKAQERTLHGELLALRWRELSGRMDDLNQVIQALETKKTQYESASAGDSA
F2GBA5_ALTMD          QAAAATRYKTLRAQARELKGQLAAIRFLKNSEHIETLQKQQQALQVEVDDLTARLQGDEA
Q15UZ3_PSEA6          QASAAKKYKELKQQERQYRNELAAMRWSNFNAKIVSLEQQTHQQEADLEAFIARQRGDEK
Q3IKC0_PSET1          QSVDAKKYRELKAQERTLKGQIAVLKWQKLHQQQLEKSQQINKLNEQVTFFKTAHSGHDD
A4SKA4_AERS4          QAETAERYKQLKSRSRAARAELIGSELWALETRLGEAKAELTQAEQALAALDAKRTQDEG
D0KWM8_HALNC          QARTAERYRELQKKRRRQVVEQAAVQVVLTERANAALDAEWQTAQAHMTTVAERMAQVEL
A0A2W1K6W8_ACIFR      QAESAQRLRALRVEERQWQWWSLALRVDALEAERRQSLEQRSRLQDEYRREERLLDAVTQ
A0A0J1A050_ACIBA      QSEAAVQYKTLESQIRTLKIEILSFQAEKSVRLQEEYTVQMNELGETFKLVRSELSTIEH
B3E294_GEOLS          QAKKAEKFREYREELREIDLQFTLHQASTLQHDQHQAEQQLAELKNRMQEIVTAADTADN
A1AU91_PELPD          QAKKAEKFREYRDELREIELLFTACEYRATAEQRRTAESEQAVLNGRIRDAFSETALSES
B9M6F0_GEODF          QARKAEKFRECREELKEIELLFSVKKYAALMKEKEDLDRQLDLLKKELSVQIIDQEKGEL
Q39WG2_GEOMG          QVKKAERFREYREELREIEVAATVRRFIALDAAKEQVEEALRQSVSRASTLTADLEQREL
B5EFS9_GEOBB          QAKKAERFREIRLELKEIELLFAAKGYGSVQKERQGLEREIAELESKLVDITARLNEAEL
Q3A212_PELCD          QARKAEQFRNYRDEQKQIEIGFARCRYAELVADGDKHRHDETRARQQVVALESRFQQLEL
A9FIZ2_SORC5          QAAKAERYVNYRKELEDLVLHEASHKLLEITVLTQHESLGRAAHAEREQASRTALSAREA
D0LY52_HALO1          QAQKAERYRRYKTELRDIDLWKASHKYLEFRAEEKLLNHNLRTCRTSLEAVRTEYEATDA
Q1D2R5_MYXXD          QAKKAEKYKKLKARMRDIDLHAATHRQLELMAEKKMLQSRLENLGSEERESLDRVKELEE
B4UDF6_ANASK          QARKAEKYKALRGQIRELELRTAAARYLELTATRRAAEERQAALKAEEAELSARLAELDG
Q6MNS9_BDEBA          QAQRAERYRNIKNQIEDLDLWLSTAQYVELKRAADEAQAIFNEAQSMEVEGETNLSTLQG
A9A0M3_DESOH          QAKKALRHKEYQARKKELDMLVSLIHHNALTDKITETDALLASLKDLDNEHASRIGSLDA
B8FHS3_DESAL          QAKKAERYKEYKKRIEKIDIALAALEFDRYTQRISETHRLLQELKDQEISHVTQLSKLDA
E1QL74_DESB2          QAKKAMRHKELRDKIRELDLALGSFEFAALGQAHGEVSAELAAATAQLELTQRNLSIQET
B3EFQ6_CHLL2          QVKKAEKLRELKSEIRTTDLLLAGLTLHDELEKLDPLKKQIEHEECLCHELAATIAGRES
A1BDT4_CHLPD          QVKKAEKLREIKNKLRELDLILSQNQFAACQTKLEPLRRQLSREEMLDHERAAAIAQKDS
A4SG64_CHLPM          QVRKAEKLRELKTHRRELDLQLSWHTMESLQEKIEPLNRSIEQEELQNHELAARIATEDS
SMC_CHLTE             QVRKAERLKEIREELRTLDLTLSAISMDEHLQKLRPLLDSIAAEERQCHELAATIAKLDS
Q3ATI3_CHLCH          QVRKAERLREIKERIRALELALAWRSMEELHDKLEPMQRSISKEELINHEQSATIARMES
B4S519_PROA2          QVRKAEKYHVLKTRLRELDLMLARLNLEEYDAKLEPLKLKIKAQNRENQTLSTTIALKDS
B3EM83_CHLPB          QVRKAKQYHEINTSFRDLDLTLSKIHFDACVDKLHPLKTDISEQERVVQELTTKIASNDS
B3QRZ4_CHLT3          QAKKAAQVRTLKDELLSLELGLAERQAAALDAKLKPLQAELPIHETKKSELTALIAKLEA
D0MFL5_RHOM4          QADRAERFRRYRDELRALEQALLRHDYDRLREQADALEALLDEVQTRLREARTRYETLEA
Q2S457_SALRD          QAEKAQRYQEAEAELRRLELLLAQVEFNRLTERQDALQQKETEHAERAAARAEDEEATEA
C7PLU2_CHIPD          QARKAERFYEVKKEYREVSIELAKAALEGFNVTFKELTDEQQAESDKKLALETEITAAEA
E4TVF1_MARTH          QAKQAERYYQYKGEYKEKSILLAKKTVADKREVFLNLTKQVEAENDKKLSLNRQLAEQEA
B2KBE7_ELUMP          EAKKARLYQKYREELKESEIAISLESIKEFDANIVKDSAELEPLIKQIEDLNNNTSAVEG
B1H0P2_ENDTX          AAKKAKQYKEYKENLAKYEIVSLVRHITCGIGEIERIKKNLDPKVKEFESDNVFIAQLDV
E4TEW8_CALNY          QVEKLKNYRELKIRRDLLDKTIYAYNYHLSLAQYQEFLKKNDEIQIKLSSSIYEYENLKK
D3PDY1_DEFDS          QVNKLKKYREIKSELEKLDQEYYSNLYKKLKDDYSVLINCINELKLKHSSLQTDLNDKEK
D4H2V6_DENA2          QTDRVKRYRELSAKQSALSKSVIFHRYSKSFSDLKEITETVNQLKIDLSGYTEKFTKLTN
D6YSC9_WADCW          QAEQAKVYKENRMELEELEISLAVARWNHFKNRHDAFAEKEQAKGCELEAAALDLEKMEV
Q04TU9_LEPBJ          QAEKAEAYFKLKAELDETDKIIRYLKFSTLTKKLKESEDELQGIKDKNQTLLDTIGEETG
E1R6H6_SEDSS          QSEKTFSYRDLKERIFDLELDIQLLKLKGILDDQHQKEEKLKEKSQKRDELRSAIDTINN
Q73ML2_TREDE          QSEQTIKYRELKDAVFEHERDIQLLRLKSFVDGLAAKKQSLKEASEKRDSIQEQIDGIHG
A0A0H3BKB7_TREPS      QAAQTQRYRMLKEEIFARDRDLGLLRLRGFLENQARADGALQRNRARRDALQTQVEEAQQ
E0RSK7_SPITD          QAEKVERYRALSEEIFQIEIKQSLLKYRRIEKALVRHRERLRERQEERSRLKEQIHRLND
D5EMY0_CORAD          QASKALRYQRIKHRLSHLDLAFNAYRHQNLSESIDKVAKRANEIRKDLDAHTEALDADEE
B1ZZB8_OPITP          QASKAMRYKRLSFRLRHLSLAWSAYHHAQLAATLAELESKVHVLRDEANARRANLEQQQG
SMC_DESHY             QATIAREAVELTTEQKALEIEIVAFDLKEVRHKLTTSVQETEELQSAIAAAVADLSQKES
A4J682_DESRM          QAEKAKQYKMLYEQAWNLELSLYKRDWDDLSVKVNDLASQLESLKLEYKDERPAL---EE
Q67PF3_SYMTH          QAEKATLYQELDGELTRLDVGLLARQLQTVVSRLEEQRAVGAELAQKAADIEQRMQTAEE
B0TGW8_HELMI          QAELARRYQTLEVERKEVELGLLVVDWEEMTATMEKTRRELDRFSALLWEKEAQLATLEG
Q2RJX0_MOOTA          EAARARRHQKLMALLNLVELILKSREMAESQNRLRRIRERWQALKSQEEELEAREEELAG
SMC_BACSU             QASIAKDYLEKKKELEHVEIALTAYDIEELHGKWSTLKEKVQMAKEEELAESSAISAKEA
C5D8T7_GEOSW          QASIAKDYLEKRDELERFEVALMVHDIEQLHQQWTSLKQLLAQHQNEEIQLSSTLQKEEA
D5DQR5_BACMQ          QSSIAKDYLQKKEELEHIDVAVTVFEVEDLHQKWEKLKAEMAQHEQLEESLATNIRTREG
B7IUK7_BACC2          QASIAKDYLENKEELEKVEAALIVHEIEELHEKWEALRNQFGHNKDEEAKMSTDLQKSEE
Q9KA07_BACHD          QASVAKDYLEKKKELEQVEIAVLVYDIDRIHTEWNKAKEALDLLKEQHRALEQQISEKEQ
Q5WFM8_BACSK          QASIAEEYKLLAEEQRTLDIQVIAQEITELYENWTAESDKLKTLKEQLQARKDSLEKAEE
Q7ZAM6_OCEIH          QAERANRYQQLHGQLRDTEVALLITEIERIHKEWQVVLQDLEVEKDNQAKQQQQVKSVEN
D6XTT7_BACIE          QASVAKEYLSMKAELNELEAGVTVKEIQELHAQWTNLKNDYDQVEDQKRQHEIDRDRLEQ
Q81ZN4_ENTFL          QADAAKKYLALKEELTEIDVNLTVTEIQEAKAIWETKTQELTAIEEKLAGASKQVHDLEG
A0A0E0UX46_LISMM      QASIAKDYLFQQEELEKYEVTLLASEISSLTEKLAEVRKEFGENQTVLIKLREELHAEEA
B1HQH6_LYSSC          QASSARDYVQMSTELKDFDIAILVHDFKNCAQSLRALKEEYTNLSEIEQKQAQDIAAFDK
C6D303_PAESJ          QSEKAIHFKQLREQLKTQEISMYVHNIENVYGSWSEANTKLERLKHEQLELSTVVSKHDA
C0ZFN9_BREBN          QAETAKTYKELHRKLVEHEVALYVQQIEVAHTKWEAATGRVEELKHLLIGQTTEASKQEA
C8WWA4_ALIAD          ARRIAERYQALSDEIEETEIALLVVEIDRLHDRYEQLKRQVAREEAARNEAQERLRLSEE
D5WPA2_KYRT2          EAEREQQYRALQEEAATIAGRLAVHRIEQTHMEYQRAQDEAVKAEQAAAREAAALADAEA
C4L5Z7_EXISA          QAALAREYKVAKARHDELETGIMGAEIQLLQQEIEQVSARHVESVQQLSDCDRSVRDLTE
B1YIN0_EXIS2          QASLAKEFLVARERYDFLERGIIATEIEQYMTQLTDVSTEIESCQAQLLAEQERLQETIA
D3R1B0_MAGIU          QAAAAQAYLELQGEIKRCELTLAQRQLRQCTDQLDILQKDQANAWAELKEIEADLAEQSV
D2RLB2_ACIFV          AAEKARQYGEISGRLRQVKVTRLLTQLGALEGEKTRLKEKIRSLEGQLKELADLSGKLTG
D1BLY1_VEIPT          KAEKTKKYMTLSRAKRDYDGALGFHNYKTSDRLLTRFENDNIAFKDEEIELQTELSKLEA
A5UQ60_ROSS1          QAALARSHRDLMAELHELLQTYYVRLWLTAQTECAATEQAAQTLAATLAVRQAEMTAVST
B8G556_CHLAD          QAGQARQYREWQTELHHLLAHWHHAQWREAQALAQQAQTLAQQADDEVARRRAIHAETAA
A9B100_HERA2          QAREAEQVHEIETALQQALLIAYRRQWQAAQSLVAQAEIAFAKAEKVLAHAQVGQAQAEQ
D1C6T1_SPHTD          AARQARESGEVRERLKAALLRLYAHQWQGARQRLQAAEAAEAAAAQAVEAAVAAHAAAQT
D7CMX2_SYNLT          KASKSRRYRELAGELRNLEQNLLASAIERLYRELQDYLGERDKVKAELAKARTLIQEKEQ
Q0AYV7_SYNWW          KAEKARLYMALNSECQELDKSVLGFELARTEKDWQQKSRDLIQKQNEIQAQAGQVALLEA
SMC_LACPL             QASLARDYQDQKQKFDYLDRSRLVKKLTIARDQLQGVNEKLASAKALVAKYQQQVDAGAT
Q03RT7_LACBA          QSNLAQDYLDQQQKFALLDRTQLVRQLHTEMAQKQTADTQVVAKQTQVAAHQAAAQEQAA
B2GD41_LACF3          ESALAEEYLEQKGRLDRLDRTQTVRQTRANQARLSQVNERVVKGRELTKQYDQDANTASQ
A5VKP1_LACRD          QSAIAQDYLEQKKQFDVLDRTQTVRHYDEYYGKLTKLGAKLKQAEEMVKDYQRQAGHDRQ
Q03FW9_PEDPA          QATVAKDYVQQKRRFDILDQTKLVRTINSNSEAQKQLAVQRQEQKEQLAQLRIKSEALAD
A0A249N2C3_LACRH      QASLAKDYQQQSADYHRIHQTLLALEIEQLAAEQEKTQGEAKVTKATIAALTAKVKDLEH
Q38XR7_LACSS          QSSIAQDYLEQKTQFNALHQQLLVVEIDQLAADQTQYQAQAKTLAKALGEIESEIQETNT
Q1WU99_LACS1          QASKAKDYLSQKEQYDLLNRDRLVLEITQKSSEKEQKESELQKVIKILSDKERMTSEQSK
Q04GL1_OENOB          QADEAEEFLSLRKQFDRLKLVKIARVKKDLSAKELTTQSEITALTKKIEQVEKKLGDKTS
Q03VW6_LEUMM          QAAEATDYLAQKERFDTLDKARLAWSIHDLNGQISSTTKQVETHDKRVNQTKLALDVVNK
A0A0U5K8Z4_LACDE      QSSLAQEYQFQKAALDEDLKTLLAFEIADLDQEEREVSQKLAKSQELLSRLDAEVKQSQA
E4SKB3_LACAR          QSSLAKEYQFQKAGLDKKLKSLLAFEIEDINRQKEDVEKSAKKSQVLLSKLDNEVKDSQD
Q74IP9_LACJO          QSSLAKEYKFQKEQLDHKLKQLLGLEIESLNEEKKAVAKKAAANQGILNKLDDEVKQSQA
A0A0T8KIP4_STREE      QAENARKFLDLEGQRKAIYLDVLVAQIKENKAELESTEEELAQVQELLMSYYQKREKLEE
A4VVL7_STRSY          QAQTAKKFLELDGQRKELYLNVLVAQLSLGKEKLSEKEAELESVKTELTSYYKQRSELEQ
C0MCR5_STRS7          QAKTARQFLALDADRKQLQLDILVKDIEQDRMEQEAQEKALAALREDLAAYHRKRQSLEA
A2RLZ7_LACLM          QRDTALRFQELEAERSDLSLSVLVGQLESKKAKYDQTELDLAQVAQELASLSTRKKVYDE
B9EBB4_MACCJ          EASIAEEYIALSEEMKDADIQVTVHDIKESNAEYERLQQEIQSFDEQLKYRKDKSARISN
SMC_MYCHR             QASKAKIYLEKSKALESVEVGLIVNDLNFFNEKLNNLNTSLLEVEQQRNDLELNIQTYES
E0TKT8_MYCHH          QASKAKIYLEKSKALESVEVGLIVNDLNFFNEKLNNLNISLLEVEQQRNDLELNIQTYES
Q4A770_MYCH7          QAENAKIYLEKSKQLESVEVGLIVSDIKKYQTELDQVQEKLNDLKFQEPKFISEIEANEK
C5J708_MYCCR          QAENAKIYLEKSSALESVEVALIVNDLNDYNAKLTSLKQEISVLSQDDNSNNLEYEKNQQ
A5IYM7_MYCAP          QAEKAKIFIAKTEELRSVEVGLLVDNIKRFGSRYDELSVELEGVQETKNDLNDRIKNLEA
D5E4P4_MYCCM          QASKAKEYLEKTAQLKDVEIALLAHDIQQYDQQFKQLTNDLEGVEETKKDYTEKIENFEL
Q6KHN4_MYCMO          QAKNAKTYLEKSKELKSVEVALIVEDLVLFTNKLDSISTSLNQTSEAREDLKSELEKIEN
Q98PK8_MYCPU          QAEKARIYLQKSKELKDVEVGLIIHNLDFYSTKLKEFEIELEGVVETKENLEQQVRKCEN
D1J8Q8_MYCHP          QAEKAKIYKTKAEQLKEVEVALLVHDFMDYSDKLEKLNVEGQDYNLIKEELETKIRVYNE
Q4A588_MYCS5          AAKKALEFKDKKSKLKEVEISYLAHEIGRLQSENEVYVNEINSSSDVVFTLENEIEKLNA
SMC_MYCGE             QAEKAQQFIRVKNELKELELAVLVGEYLQAQTELDKFNFQINSSEHDFKIHEPQLELLEE
SMC_MYCPN             QADKAQRFVKLKEELKELELSVLVADYLKSQGELDRFNHQIGYIEQDFKLHEPQLQLLED
Q7NBU0_MYCGA          QAEKAILYAETKEKLKDLEITLSVNEYLISQKEIEALSEQIAEIDERLLKNDPQLQINQE
Q8EVS6_MYCPE          QASKAKEYSEKKEELTKLEISILVKDIVQAKSDLETVQTKLNNSKNIKQEVGPKLEMLSN
Q9PR04_UREPA          QAMRFNEYKQIKDELTKLDLVIIVRDIIHWQKQLNDIQENLKEYKKEYNKQKPLIQSKKN
Q6F1N4_MESFL          KAEKAAKYKDKIEELQKIELTILASDALRFETELSSLRDKRRQLDIEVQKLANEINLSQD
Q6MTD2_MYCMS          QSKKALEYQQKVNELKNIELYILTKDLKVLVNRIEELRVEKIEYETQIKKLTNEINMSQE
E3GP81_9FIRM          QSEKAKEYLELREALKKVDLMVFYHNMKDASEQLAAYEKQLAEVRFQIFEIEKKTEEKDR
SMC_HALOH             AAQKAKKYRRLKEELKVLEVNLLLDKWDKNLDRLSSFEEDEQLLIHKLKSLTNNLTESQE
E4RL35_HALHG          AAAKAKKFKEYKAELKDLELSLLNKKWKLLSEEFKTVEKARTKAKKTMDEKESKYNTANY
D9QRN7_ACEAZ          EAKKARKYKKYYEELKGLEVNLLLNKYSEIEAELTEVIETRTRFEDKISQVKAQVAEFDS
A8MHB7_ALKOO          QSMKAKEFTVLKERLLNLEVNLFIREIDKIDAELKLMYEQIHVLNQSIEEQQKEKSFYYD
A6TRT3_ALKMQ          QSERAESYKRFKEVLLRLEVNLFIREIDKIDGELKHIQEQIEVLNHSHIEQKKEKEQFQR
A3DDY2_HUNT2          QSEVAKRYLGLRETLKVLEVNVYIENIARYKEKIKELEENYASVKDNIDSENKRLEEITS
D5X8N2_THEPJ          QANRAKTYIGYKEELDKLEINLAVHQLTDQKDRLETLTGEEAKLRQDIIALETEVRKTDS
D9R048_CLOSW          QSEAAKEYLRLKEELKRYDVNQFLLETQGIQIQMKENLEKETIVSHDLEDARQASEGIRK
C4Z0E6_EUBE2          QSEKAKEYLEYKADLKKYDVNAFLLESDRISKDLEELIGKIGIADEDLSNSRAEYESTKA
C4Z924_AGARV          QSEKAHTYLKKREELKNYDVNMFLLESARIETELKSADEKYTIADDELKETNATYESIKA
E0RV40_BUTPB          QSEVAKEYLKFRERLKTLDVNMFLVENRNQKQQLEDAEKNLEIAVNSLEQARTSYDKTKE
A9KLR0_LACP7          QSEVAKEYLRLKEQLKTLEVNQFLIEYEKNNQLKIEVDNKSQIVTEDFNQTQTKFDNIKI
D9S347_THEOJ          QREKALEYQRLSKRQKLLEVNLLLLDLERLQEKLAQVVLDLSERSLALEQIRNKKADLGA
B2A2N3_NATTJ          QAERASKYKELKDKMMKLEVNLLAHRIDEKRAKWYELDETYKQIENNKEEISSQLRTIES
A8F8R1_PSELT          KAKRAERYREYSSRLENVKKLYYGNILKKEIKRLNHLSNQQEETTEKIKNLQKELVGVET
A5IN04_THEP1          KAKRAERFREYTAQIEELQRIYYGNALKRERKKLEFYQEEEKKTNEKIKNIQKELVELET
C5CIS4_KOSOT          KAKRAEKYLEYTERLKEVRTLYYGNAVRVEREILNTHMEGHEKVSDELKELQRKLIEHES
A7HMD4_FERNB          KVKRAERYIEYSEKLETLKKEYFGGVYKIEKQRLSDMENYHSELNVSLKEKLRHLAQLEM
B7IHN5_THEAB          KVKKAEKYREYSEKLEALREKYFGAIYTFESEKLKELEEEYLKNKKLYKEKINELAETES
SMC_THEEB             ERLHAEKYQALRLELQEREQWLLVRQWQAHEEQKVQLQAQIQTLQQEQTQRQEQLQQKAQ
Q2JHS4_SYNJB          ESEKAQHHQQLRLQLQTLGQQQQVLLWRHLQVQVEETQAAIQRFLETQEQATAQVQTLND
SMC_SYNP6             DREKAQKYQALRQEQATKQSWEAVLRWRAGQRQVQALQRSLAQLATDAATDQQTQQTLEQ
B0C9C4_ACAM1          DRIKAEKYQKLRTELQSKAAWEGVLAWRDLQAQIDKKQKQLATEQQTQAKLEIEATTLAT
Q115J3_TRIEI          DCVKAKKYQQLRGELEEKSLWQTILRWQNLQKQEWKLRENIESGDRSVTEFNQNIQAKET
B2J925_NOSP7          DRAKAERYQKLRTEFLAKQSWEAVLSWRSLQAQQEKLVHEIQTGDRNSSELSTQLTNLNS
E0UKI1_GLOV7          DRIKAEKYRKLKCEIQQKQQWEIVIQLRFLQQQQASLQAQLAAGDTQVTQFQAQLNSLNH
B7K4Q6_RIPO1          DRIKAEKYQKLRVQVQEKQQWELVLVWKSLQQQASRLQSQITTGEQEATQLKEQLTNLSQ
B0JSN6_MICAN          DRIKAEKYQKLKAQVQEKQQWEIVLHWQNLQQRCQQVKEQIQAGEKEKQVLTETIANLSE
SMC_SYNY3             DRQKAEKYQALRQQVQEKQGWAKVIQYKAVEQQRQKLWGQLERDREQSQQIQQALDQRSQ
Q84EC7_SYNP2          DRLKAEQYQRLKIDLARQQQEEVLLTWRSLQLQEEKLQRDLASSAQERTQLTQNLNALDG
D3EQ04_ATETH          DRAKAEKYQKLKQEISQKKEWEAVLLWKSLLKKISNLKKEKSEDEEREEKLIKSNSELEN
SMC_GLOVI             ERAKAEEYRKLRAELGELALWEHLLSVRSLEAQIAQITSQLAAAEAVLAGFDREAEALAE
A5GQT1_SYNR3          DCQRARLYQDLRQKVQLGRQQEQVLVVEQNRAQLEQLAQNSEQLSGRRESEQQALIQGQA
A9B9B9_PROM4          DCEKARLYKQLKEQHQLARQQESVLAFEVAKDSLEQLKTRRRKLLEKETLDQNILLEKQK
A2BNJ6_PROMS          ECEKAKRYKELKAKLLQIMELEKVLIYEKQVKHVESIEKKESEIEKNKILFNKEKESISK
Q46EX0_METBF          ERDQALKYQALKTEKVKFEGYLLLSKLKDARAELQNVEKEITGKEEHLEKVQIVLNERTK
D7EAF5_METEZ          ERDQALKYQSLKQEKAKYEGFVILSKLKDAKKELESVNSDIESKNNSVEELQKSLDEKNE
D1YW78_METPS          ERDHALLYQSYRDEKVKNEGYLVLSELKEAQQLLDSLLEDIRDKTDKRAAITADVEKKSA
A0B8B9_METTP          ERDRALRYRACREERKKQEAYLLLARFKEAEAEISALDDEITSITSEKSQLLQSLEAGRE
D4GT30_HALVD          ERETALTYKGLREEKEEYEGYLKAAELEDKRDDLSRTESRIESTEADLEDLQAELDERQG
A7IAD8_METB6          EREHALEYQKWQKELAFFQGCRSAAQIHDKEKERATLLSSAEEQKIRISRLEADRSIEEN
A3CWK7_METMJ          EREQAVEYRRWQGELEHLGQCRGAALVRQKEQEIGTLHDLAHDQQAAIARTEGEGEAVKK
B8GG37_METPE          ERQQALLYQELQQKLVHFQGCRAAAQLNEKERELGGLTSLLEEYRISQDRTVQDRSLEVN
E1RII6_METP4          ERAQAVKYREWSEKLEYFRSCHSFAKLKEKKNELGAIRELILSQKEEIEKINSKKVTEEE
Q2FLH3_METHJ          QKEQAVSYRKLQDELKYLTMCRSAARLSARKKDQDALLQSIAEEKSQVVQIEADISWKSH
A2SS75_METLZ          AREDAVKYQKLQAELDYLKAAKQIVRLQDLERELGLIAHSRSEQEEKRAGIRNDISLQEN
D3RYW2_FERPA          DREEALRYKSLLERKEELEREILAHKRLEVLKKLERVTKEIIESEREIDELHEEFAKIKA
O28714_ARCFU          DRNEAIRYKEILSKKEEYEGYLRAHNYLTAVKSKEKVERELERLERQKDELTSKIPEINA
D2RFP2_ARCPA          EREEAIKYKNLVEERELLLNYKRIHEYLRLVNTANSLRKRLEELNEERDQILKAITDINS
SMC_THEAC             EKEKKERYDALLKRKRDVEYTEILNRKNAMERQKRTIEGQISDLTKEIAQLEERRSDLEK
Q97AI9_THEVO          EKEKKERYDILSKRLRDIRFTELSKAKEANDRSIQAIDRQVDSIEKEIEKSKVLISDLNL
SMC_METVO             EKEDAEKYTVYNKKLKVTKYILTSKKVEFLKMVLDETKDEIEALKETKNCYIQDISNIDS
A6UQ42_METVS          EKEEAETYVKLNAELKATKYIFTSKRIEFLKGILDKTGEEIEALVEMKSCFMKEISEYDV
A6UVP1_META3          EKEDAKKYVKLSEELKSAKYMLTTKKITILKEAIKNTNENITIIKELKDKFNNDIQNINN
SMC_METJA             EKEDAEKYIKLNEELKAAKYALILKKVSYLNVLLENIQNDIKNLEELKNEFLSKVREIDV
C9RFQ3_METVM          EKEDAELYLSLNSELKSAKYALLLKKVDYLTKILDNLKEDIKNLEELKSEFLDKVKSLDD
D5VT24_METIM          EKEEAERYLELKQLLKEARYELTKKRIDYLNLEINNLKERIEKLEREKEEKIKKLKEIEE
D3SQ87_THEAH          EVR-------KLEEYRELEERRRELQIKLLVKEAQQIKTQLETIESKEKVLREELASLRQ
D3DG53_HYDTT          DVR-------KLRRYRELENTLRDLHIKLLMKEAKATSQSIENLQALIEERKKELLEIRE
SMC_AQUAE             EKE-------KLEKFKELQRIKRETEAKILLKEKEKLLKERERILNELSSLRESLEDITF
B4U7R1_HYDS0          EKE-------RLHQYKALMEKKHILECVLLLKEKQSLLKDLQKTSEEKEALETKSSKLLE
C0QSN8_PERMH          ERENALLAAQLEEKIEKIQKNIKGVKLYFLLTEQKKAVDDLKEIEERINRLYEEKEISVQ
B2V736_SULSY          EKENAILAINIESQIKELENRLLGAKLYHLLSQKQQALEHLQDIEKDLQQFYKSKEENIE
SMC_PYRFU             ERNDALRYLDLKDKLEKAKVSLLLGEIKILETQIKEGEKRRAEIEEEIQKIEKEIEKIGK
C5A612_THEGJ          ERNDALRYLDLKEKVERARVALLLGEIKRLELLLEESMNKDSSIEGEIEKVEAELKALVK
D1CC09_THET1          QVNNLRSKEVEEEKLRQLLEAYYSRQIQDLESQIESARHRKVHLQNRRDQILDRLPTLES
D3TAQ9_ACIB4          DRMDALKYKELEEELKEIKAKIAYLNMKKAENSIESYNSQLRELQSAIDSLREEIEKRRS
SMC_HALMS             QAEKAERARSLKEKIKRNDIIVHAHKVYDLLKDLRDGKTLLNEKTLELEGWGTRKNSLEI
Q6L0R1_PICTO          EKETAEKYHELSESINSMENYLRFKEKERLLSELEIFQKNVTDIENKIIGLRKKGSENND
C1A7M6_GEMAT          QRRRAERHAELTSRRFQVEISLATREMAAWRDELEALDGRLITLREDVPGSEEAIAGAEL
C9RN51_FIBSS          QAEKVNAYKKLNTRLRELDLSVSLDKFEDYKEGLATLDSTTKRMNHEVESSKTQATELQA
D1B5Z0_THEAS          EVERARRAREIQSELEGLHRDHYWWRRSSLEARLSEVRSALESLTAQREMRARWLKVWRE
                                                                                  

SMC_FUSNN             RLNTIDLEKEEVKKEK--LLIDSRNKELRNIISEKEKEKAVTSERLDNVKKEKLVKEEYI
E3H7H1_ILYPC          KLEKANRERENLNEDI--EAMTQKNIDLKKDIDKIINDKTIFTERIKSYERELVEKKDSL
D1AK68_SEBTE          ELREINQYRENSYTRL--QEKKDANMEIFKELEILKNKISEINNRSSNLEVEFQEKGKRK
SMC_CLOK1             DVNGYNIRMENIMDES--TRCEKDYYDKRELINQGENKIKLLKQKIEDLEDNIKRNYLEL
D8GS00_CLOLD          KITNGNEQIEDFNNKN--SDCKTNYYGDRERVQQTEGEIKLLKQRIENLKETIEKNFLEL
Q97IA1_CLOAB          ELKVATESLDEFDAKY--SSNKTKYYESKSEHQKILSEIELLKEKTSNSDVAKNKLYKEI
A0Q0Y7_CLONN          NLDNLNKKLEEFELEN--NEKTKKYYESKTKKQDIINENNLLEERITNLKKSIDKYNENL
Q895M7_CLOTE          NLKKLGLQIDNLEERI--QDNKKGYYNKKEEHSNLKNEIYILKERIDNLNKFIENVSDEI
Q0SSA4_CLOPS          KMFALKEELDSLEGSH--SKKQEEYFAKKEEINKSLGKVNLLNERIKNIDELILKNKEEL
A6LSM4_CLOB8          QLKELEMKIEKLEKKN--LEEKEKYYSLKETVSEDEKSIELYKERIKSFEEKINRNNYEL
D9SLC7_CLOC7          EQNKLIELQEELEKEV--FKEREEFQKQNESREEVRAENILLEERISNSNVIAEKEVVEV
D7APA8_THEM3          NLLYKEKEIHDLKQQL--DSKKEEYHNKLREIEIVSGKRELIVEKLRNLEETSELYREEL
Q8R9W7_CALS4          KFLFLEGEVGKLKRRI--EEEKDRYHNLLREIEIVSGQKELLVERVKNLEENIKYYSEEL
D9TN88_THETC          TLDNEESEINNLKKEL--DINKEDYFNSLNDIETINGKIDLLNEKIKNSQENIDRLKKSL
C9YKI7_CLODR          KQEDINKEVEVLQDVI--EKSVDYINSIKGVISKKESQINLIKERIRNFTNEISRKNLEI
E3PS49_ACESD          ELNELENKLKELEQDK--QILSNENTELERKMNEYVRNKDVDSQKIINLDENLEKSYSQK
B0S1M4_FINM2          KRNELLENINKIDIDV--ELKISNLNDIKSQKIKNESDIQLNDERLKNSKSELERLTEEN
Q3AC59_CARHZ          SFAKILSEEGKLGLFS--DNLQKIVLNLESCLEKLDNVKKYQQEEENRLWLELKSLKEQI
E4SF58_CALK2          SIDQNKLQMDLLTHQI--EEIKISYDNIKGELTEDTARLKFLKKQLESKQQLKDHLAEQI
SMC_RHOBA             QRQAAEMQLQTIADAA--REAEQSRSELSGEIARIGGRRESDQTTLVEQRRTLIGHYRRL
D2QWB0_PIRSD          IVAGSASQSQNAATAL--RTAEAKQASLREQIAQQESAADFHRQTSKQQAEAAREQQQQL
D5SU17_PLAL2          DEKLTEHELSALDGEI--RQVNEKLNGLRQEVAGDQATVQFLKSRMSELESELTRLYRQR
SMC_KORVE             EHGERVQRGYAIDAEA--KQNRESLNNVSREMDRAAQRRRTNEERCAELVARSAGAEAEI
C1F1T5_ACIC5          QHAAGLSQGYALDEQA--KAAQQQASQSAVELERTTTREQANRERLQELERRGEQAKAEQ
Q01Y77_SOLUE          AHESQQLACYEIEHQL--TEARKQLAERQVEAERTRGRLESQVRESGAIEQRIAQNEMDS
SMC_MYCPA             ELAAHEKALGELSGRA--ESVQQTWFALSALAERVAATVRIASERAQHLDLEPVT---TG
SMC_MYCTU             ELAAHESAVAELSTRA--ESIQHTWFGLSALAERVDATVRIASERAHHLDIEPVA---VS
SMC_MYCLE             ELAAHEAALTELSGRA--ESVQQIWFGLSTLVERVSATIRIAGERAYHLDVDPAT---PS
A4FMG9_SACEN          EEKTLEENLAADAPRL--NRAQETWYRLSALEERLHGTLRLAAERHRHLTAQTAE---QR
C8XH72_NAKMY          RLSTAEAELRELSPAV--ARAQETWFALSALAERVRGTVALAAERARNLSAPVRD---AA
D7GEI0_PROFC          REAEAEQALTAANPAL--TAAQERWYAAVALRERMATIESISAERMRHGEVAPET---RS
Q2J6Z3_FRACC          REEQLQADLTAIIPRA--TGAQETWYALASLRERLRGTRSLAVERGRLLRAATD-----D
A8L599_FRASN          REAELEARLAAVVPRA--AAAAETWYGLASIRERLRGSRSLAAERSRLLGSAEE-----H
C9Z3S1_STRSW          REAHLEGEVRRLAPRL--QRAQETWYELSQLAERVRGTVSLADARVKSATSVPV-----E
D7CC86_STRBB          REAALEEQVRQLAPRL--RDAQQTWYELSQLAERVRGTISLADARVKSATSAPG-----E
B1VYX5_STRGG          REAELEGEVRRLAPRL--QLAQQTWYELSQLAERVRGTVSLADARVRSASEAPA-----E
E4NHH3_KITSK          REAVLEAQVEQLGPAL--EAARQTWYRLSSLAERTRGTIGLAEARIRAAATAGQL----E
C7QGY1_CATAD          QESELEQRGAALVPYL--AQTQETWYRLSSLKERYRGSAQLAVERVRNASRTAP-----E
A0LV82_ACIC1          RETELEAALSTDAHRS--AAAQQTWYRLSSLRERLRGTAELAAERCRQARLAQE-----E
A0JXV4_ARTS2          RQAALEQLAAEATPRL--NAARDTWYQLSAGRERFRSLGSLAEERRRLLGAADE-----I
A1R7H8_PAEAT          RQAALEQQAAEATPRL--NAARDHWYQLSANRERLRSLGSLATERRRLLGSSEA-----P
A6W7T9_KINRD          RLADAEAAAAAAAPDL--ARAVETHHRLQSLAERLRGVQALAAERLRLLASEPD-----E
D1BJA3_SANKS          SLREAEAGLAAAGPAA--AAASATWYALGSARDRLESTRSLAAERVRLLSAPVE-----H
C7NGM6_KYTSD          GVEELEQSVATADGRH--EAFRNAWFELGTLIERTRAAGRLAAERATLADRDATESE-QR
B2GFM7_KOCRD          RLQEIEAAAARTAPAL--NEARTSWYELSTVRDSFRALAALAQERRRLLGSTEE-----A
E1VVN2_GLUAR          HLAELISKLELLSPRL--GTVQEAWVSLSTQAERFRSLSALARERGKLLQSNET-----H
A5CQQ2_CLAM3          RSERIVE--EQEGDEV--DGARRTAFALEQVQERLRNLLSLAQQRLALLGSADD------
Q6AE90_LEIXX          RRTRLEQ--AQVSDRA--DAARATAFALEQAQDRLRSLYTLATQRLALLGSQAE------
D1AB24_THECD          REAELEAAEQAAAPVL--ARAQDTWFRLASLKERLQGVADLAAERHRNASEETGE-----
D6Y659_THEBD          VEAELEAAASEAEPRL--KAAQESYYRLSAIKERLRSVESLAAERQRHAAEAAQV-----
D7BMZ9_ARCHD          DVERCERDLAVLTPKL--ANLNDTWQEATALAERYSSLCALAEERYRSLIHAATP-----
D6ZIF1_MOBCV          KLTGTKSSFDEVSPQL--EKLTQTWAELSTLAERLESLANQARERANALKETAEL-----
C7R311_JONDD          NLAHQEKAAADASPRR--SALSQAVITLSRNHERLKSLIHVAEERLRHLGDTHTT-----
D6ZV06_BIFLJ          RIEQVEALSSESSPAI--AKANQYWHEFSQTRERLNALAQLAEERSRSLTGQIVT-----
Q7ZAJ9_COREF          TQAELELQLAGITPRA--EQAQQLWFDLSSLAERVSATMRIAADRANSGVLDTA------
Q8NNW5_CORGL          TQMEVEMELAEITPQA--EAAQQLWFDLSSLAERVSATMRIAADRASSGAADVP------
Q84F13_CORDP          VQLEAEDALGKISPEA--EKSQQLWFELSSLAERVSATQRIATDRAKN-FSEVR------
Q4JUZ1_CORJK          TLAVTEEELRTALEEA--EAAKNLWYRLSAVQEKNSATLRIATDRADQ-AQVAE------
C4LJD3_CORK4          HVDELEHRVAELGPRS--EETQQLWFRLSSLSERVTATGRIAADRASADDQSED------
D6Z8M0_SEGRD          LTSADEEALRVVRAAA--GKAREQAEQLGLVVERVRATARVAHERARQLAKHAA------
C8WGU5_EGGLE          AAEELQEKIRRESVDA--GELARRHRRASSAVERFDGATLLLHEKRRAAQSYEAELRVTL
C7MMZ7_CRYCD          QAETLQHRLQVETADA--GQATALLRRAEGISDKLDSNVLVLREKKRSLASYLAEMQLSL
C7N560_SLAHD          KLEKLQVMLQEKGLYV--GDLTERRGRFHMVVERIDSADMILSEKARSIASRLENARNTS
E1QVK5_OLSUV          ELEKYQYLLEQKGIFV--GDLGEQRRRMQDILGRMDSDMRLLEEKGKNMVSRLSEMRMSL
C8W740_ATOPD          ELEKLQSLLEQKGLFV--GDLGEQRRRMQEILGRMGSDMRLLEEKGKNMVSRLSDTRMQL
SMC_RHOPA             IQADRASTLPSLREAE--ARAAAGLQRLINAREQLDREEARAKERVVELERRLTQFSSDV
A7IGT2_XANP2          LQALAAHALPALRQKE--AEAAAALQRLTHARSELDAEEARLSARKDELERRLIQLAQDT
B8EMM7_METSB          AQGLAAHALPALRDAE--LAAGGELQRLIIAREALDGEEKRAKARSAELSRRIEQMSGDL
B8IQU0_METNO          AQALAAASLPGLRRDE--AEAAAALQRLTHAAASLEAQERRAAERLRDITRQIADLRRDA
Q92RE8_RHIME          AQAVASLKLPELRENE--AKFAAGLQRLQIARAQLEEDAGRILRRREELQRRLAQLAEDI
A7HQY9_PARL1          MEAEVADRLPPLREKE--AEAAARLHRLTVERDNLDAEEARARDQAGRLTARLEQIGQDL
D8JUP9_HYPDA          EELRLAEGLPPLREAE--AEKAAALARFKIEQENLEREAQRAADRARELDARLKQLEADL
E3I0B2_RHOVT          LQAEAADALQPLRDEE--ATRAAVLHRIEVERNTLDREEARAKEREAELRARLVQVQADA
SMC_RHOS1             ARAEAEATLPPKREEE--AIAGAVLQRLTVERDTLAAEEDRARATIATLVSRVDQLGRDI
Q2W040_MAGSA          LQAETAAGLPDLRRAD--AEAAALLQKAMAEREQLEAEEGRLAELRRDLERRLEQAGADL
D3P3X3_AZOS1          RRTEAAAGLPERRQDE--ARAAGALQRLVIAREQLDAEERRVAEQRRGLEARLRQIAGDL
B6IR58_RHOCS          LRTEMTAGLQPKRQAE--AAAAAALQRLLLAREQLDAEERRAQEAFAALQRRLAQIDGDL
Q2RPA2_RHORT          EQAAAEEAIGPIRSHE--AEASARLQRLALAREQLEAESRRLAQTAQENHTRRTQAEADR
SMC_CAUVN             AITEAEAAMPPLREEA--TIAQAILGQLAIQKDRAEREAEAAAAEFERLSNDLSRIDADR
B0T003_CAUSK          AILAAETAMPPLREEA--SIAQAVLGQLAIQKDRAEREAEAAKAEFERLSADLTRIDDDR
Q0AMJ6_MARMM          RAEVLAASREPARQAE--AEAAAALRLLERERDRLQRDAEDVQRSIHGLERRLDDLANAA
E0TC69_PARBH          ERERAHEALPALRKTD--AEAAAALHRLTVEQETYERELIRAEEEIERLRAEKDRLDQAL
C6XRC2_HIRBI          AELKLRDQIPPLRENE--SEASAHLGLLKLEIAKLDGERKAASDSIVRLEQDLKRIVEDQ
Q0C0X5_HYPNA          ERIEAGEGVAPLREAE--MAAAGRLSQTRITLAKLETERRIAADALARLEAEAARLEEDF
Q1GQU3_SPHAL          AQAEVAARVAAARSDA--QARRDALAEATATQLRLQSEERAALQRLDDLAAQQRRIEADR
D4YX43_SPHJU          HANAAVETLARKRAAA--QAARDAASEAGHKLAALRTERDGAVRRLHDLAQQAARLEEDR
Q2G9S3_NOVAD          AQHKSAATLAEARDDL--FDRRQDAAAHGQRMASLTAQLEAAEQRLRDIDRQLSRIEEDR
D5BSU5_PUNMI          TRSELAAQLPPLRNAE--AARAAEYQRLAIGHDELDREEARLKEALHQLDAQQAQINADI
A5FVJ2_ACICJ          RETSQNDALPALRARE--ADTRTRLERARILAEQIDAEIARLEAARREAEARVATLRKDH
C5B6I7_METEA          ARLAAADAVPPVRERR--LAAESALTRATVHAEQIANDAERRRREREDLVRRVADVDADV
Q937L3_DEIRD          RVEQAREAAQEARARR--DAYAGSLDTLRAARTARDQAEQYRQHLTQEREGLERDLAALP
Q1J060_DEIGD          RVEAAREAVGDARARA--EAFAGALDALRAAREAHAQAARYAAHLQAEAERLQAELLALP
L0A7J5_DEIPD          EQEALREELAAATERR--SAHRAALELLRAADEASRQAETYLNHLQGESSRFARERAGLE
D7BH70_MEISD          QKTQAQTALETLQTAH--AEALRQAEALVGRRRLLQQERQHHADLARRLEREHSLLESEH
SMC_THASP             SVESRRDAHFEASEAV--HVAQNDLFAASAEVARLETELQHLGEARRRLEARLAQLELDR
A1K715_AZOSB          AVESARESHFAASEAV--HLAQSDLFAVSAEVTRLETELQHLGEARKRLEARLAQLDTDQ
C7RKG8_ACCPU          RLEAAREAHFAASDGV--HAAQSDLFAANAEVARLEAEIRHRRESQREYETRLAQLTDDR
Q3SJI0_THIDA          TLETARQSQFAGQDTL--NTAQAAYYQAQSEVARIEQTMAHQNATRERLYRQVQDLGARV
SMC_DELAS             GLETLRQAHYDASDQV--NQAQAKLYESTAEVGKLEAEIRYVLEGRQRVQQRLQQLSEQV
D6CTE6_THIA3          EIETLRQAQFASSDTL--NRAQAAFYAAQSRVSQLEAEIRFVVEGRQRAQAALQAIDAQM
SMC_BORPD             ELESRRQAHYAAGDAV--HAAQGQLYEANAQVSRLEAEIRHVVDSRNRLQARREQLQQQI
SMC_BURP1             QLETLRVAHYSASDAM--QGAQGALYEANAEVSRLEAQIKFIVESRNRVQAQIAALVAQQ
A4SYV7_POLAQ          ELETMRTQQYALQDKV--SEAQGELYQTNADVSQVESQIHYVQEARQRLQQQTQDLQAQL
D5CRW3_SIDLE          RLETARSEHFGLSDAL--HAKQGELYASNAEVLRLEQQIAFIVEQRNRLSQQIQNGERQI
D9SGR3_GALCS          ALEMARSSHYLLSDEL--QAKQGDLYAANSDLVRLEQQIKHAALARQRLQQQIDQTGQQI
Q2YBB9_NITMU          QLEEKRADHFAASDLL--HDAQGELYAANAEVAYTEQQIQHVRENYQRIAQQIAATRHQL
Q0AE88_NITEC          KQDELRVHHRIVNDRQ--HQAQGALYAAEGEIARIEQSIQHIRINREQLDRQIAEAELQL
D7DI79_METV0          ALEVARQKNFSATEAV--NQAQAKYYEANAEVSNLENQVKNTADARERMQLQLQQINTQL
C1D4R7_LARHH          AIEEAREAHFAANEQV--DRCQQHLAGVSADVARLEEQARHVKDNAARIERDRNAARTEQ
Q7NR76_CHRVO          EQETVREQHFAASDAV--HEAQQRLFEANAQLARLEEAQRHREQSRQRLERDLLAARGER
A1KSF4_NEIMF          EVHALQTAEQSQQQAV--HELSNKRGVLREQIARLEEQIRHQQNLHQRIERDKQAAQAQL
A1WY82_HALHL          EIEALRESARERHEAL--NTIQGRYYEIGAEIASVDERIQSARDLRRRREEELAEASRAL
Q0AAV4_ALKEH          EIEAIRATQGEAGDRL--NAIQADYYGVGSEIARIEQQISHRRELRDKQLRELRDSEGEV
SMC_XANOR             RIETGRVRREESAEAV--AKAQADVYQVGGALARIEQQIQHQRELSHRLHKARDEAQSQL
B8GTL2_THISH          TLEKNRERHAEANEAF--SEVQGRFYGLGSDISRVEQSIQHARELRERQGQELRQAEAGL
Q3JAH9_NITOC          QLEQQGEALHQARDKA--VEIQEIYYSQGAEIARLEQQLHHQRAQRAQHQQEQAQIAHRL
D3RSW0_ALLVD          EIESKREAYNAASDDF--NAIQGRYYAVGAEIARAEQAIQFANEERGRREAELVRLDQEL
B3PGR0_CELJU          QIEKYRSQYTELGDKF--NEVQGRYYSIGADISRLEQSIQHANERARQLQTDLDQTNRDC
A6V7X5_PSEA7          GIERLRDGHHELSERF--NQVQARFYSVGGDIARVEQSIQHGQQRQRQLQDDLREAERTR
Q0VR03_ALCBS          EVERLREKHHEVQERF--NEVQQHFYALGAEVARLEQSIQHQRERKQQLYEELDQVRASW
C7RBE2_KANKD          EIEKSRELHIELTDAH--SEVQGRFYGIGADIARLEQAIEHARQQKSQLLEDKAQVQSSL
Q2SD45_HAHCH          RLEGFREKRADANEAV--NRAQADYYGSGAEIAKLEQQIRNAKEREQQLQAEMQQLQDTN
E4PL89_MARAH          SLESLRDNHQERTEHF--NRAQARYYEAGADIARIEQSLEHQRERSRQMAAELDQAMANQ
E1V8E9_HALED          RLEEARAEHDRLASEL--EGYQARFHETTTAIARLEQDLEHTRARDQQLARDLESARREL
D3SAL9_THISK          ETEQQRQTRVDLEAAT--TEAQSAYYDRAAEVSRLEQSIRHAEDELARERAELQQLEQRI
SMC_METCA             QLEGLNRLRGVAQEKL--DVQQGRFYELGAEISRLDQFIRHTQKSRAELVQERERVEAEL
SMC_COXBU             EIEKMREQLTDVNEKH--NAVQKRYYGLGADIARLEQRIKDTQEKIHQWQSELEENENVW
Q5WTI1_LEGPL          ERTVLNEQVQDAIDQS--QSIQDSLYHSGTEIARLEEAIQQQEREKKRLENDRQQMQVDS
Q12L80_SHEDO          SLLQWQTQLAELNEQE--QQQVEHFYQSRTDIAKCEQALHHWQTQHSQWQQQKQALTTQL
Q080K7_SHEFN          SVIQLKQQLAELSDAE--HKLVEQYYQAGNTMTKLEQQLAHQQQQDSQLQQQIQVLQQQI
A4Y804_SHEPC          KATELQVQLAQLAEQE--QRAVEAYYLTGTEIAKLEQQLQNQKQRDSQLQAQLTQVNDQV
D4ZIY3_SHEVD          ELTRLNVQLVELDGEE--QKRVESFYLSGTQIAKLEQELKHRQQQDSHVEQRITGIVHKL
B0TKB4_SHEHH          RLTELNLKLSELDTKE--AHQVEDFYLTKTHIAKLEQSLKHREQQDESLSLRLQEIAAQM
A3QFJ7_SHELP          NLTEIKLKLDELERQE--QQQVEAFYLNGNQIAKLEQEVKHRQQQDAHLKQRIKQDEEKL
A1S5R5_SHEAM          RLDEQKLVLAALVDEE--QDTLEAYYLAGTEVARLEQQLSHLEERSHSLRSRGDSLAEEI
Q5QUJ9_IDILO          GAIELKEQAEEARDRV--ELSQEQMFSVGNEITRIEQTLKHQQELKEQRSQRQQQLNEEI
E1SMV2_FERBD          TVTTLEQQRADLGAEV--ERCQQRLFALGSQITRLEQQILHNRQRRQQLEDEVRRNQVQA
F2GBA5_ALTMD          GLVSYKNKQGETKQAI--DDLQQQLFSTSNAITRLEQNALHAKQRKAQVEQELSRINEQH
Q15UZ3_PSEA6          EITVYRTRQQELKQQL--QDTQQGYFRLGTDITRLEQNQLHSKQRIGQIKQELSTLNEAV
Q3IKC0_PSET1          VLASLETQVQASQESV--SDAQQQQHVIHTELTRSEQQQINIKQQIQALKQNQIKLQQRQ
A4SKA4_AERS4          RHVTLSVARQEAQAEQ--ASRQQQIFLGGQAIARLEQQQLHQTELGRDWQIRRQALGERI
D0KWM8_HALNC          RCAQEDEARTSAQSDL--QQVQARQYQLGAEQAQLQGRLGELAARIESAEQQRQDDLAQR
A0A2W1K6W8_ACIFR      SLDQLRAEDRRMQEDI--AAAQGELYAVQARQSDMEHQLREQQAALQRVQTSLDQGQAQQ
A0A0J1A050_ACIBA      DLESTSALFQRLIQQS--SPLQQEWQQAEKKLSELKMTLEQKQSLFQQNSTTLVQLEQQK
B3E294_GEOLS          QVELQRLAMLEAEKAL--NIQQEEQFRFRSEAAACESDLNFCRKERDAIAERLTRLVAEL
A1AU91_PELPD          RIEEARLSQVEAEKRL--AMAQEEIYRIKSEFATAESGLEFQRKELSSLTGRLSRLEAEA
B9M6F0_GEODF          AFEQKRLLLVEREERI--QKAQEEIYRMKGELMAGDSRREFHKKELLNLDRLFERSRQEQ
Q39WG2_GEOMG          GLDERRLALVERERSL--ASAQEVVFSLKGEIQGHESRIEFQRKELGGLERQEERLVGEL
B5EFS9_GEOBB          SIEGKRITLLETERAL--TAAQEEIFRWKSELQGGENKLEFQRRELANQERHGARFEEEL
Q3A212_PELCD          ELSELRLVQVAAEKEL--GQCQEGVFHLSGELQRVEGRIEFGQQSLQNLERQQQQHSQEQ
A9FIZ2_SORC5          EIEVTRLEALACEERA--ERAQNEAFAADNQVRTHEAEIARARDRLRHLEERLVTAAKEQ
D0LY52_HALO1          KVVAARTELAAEERRL--ATLQETIYEQENRVRLAENKIAFQTREADDLSTRASSATEEI
Q1D2R5_MYXXD          TITRRRTELEAETAAL--QALAAEVHTLESSLQRDTQEMTYGKRDLEETRARVAAAQVEL
B4UDF6_ANASK          ALEQDRALGGESEARV--ADLGTREHALESAARVSEVSVEAAARELDQIAERTRAQAAEV
Q6MNS9_BDEBA          QLEVLKLQILEKEKAV--EEQQTEYFTKQSTVQKKEMEIQELRFEIEQARRNEQMTGTIL
A9A0M3_DESOH          AIETVKLERDAKSREI--SGQKERKFELQRKIDKTENELTHLRTERQRLEEEAAGFEAEK
B8FHS3_DESAL          AMEEIRQERASMAEDV--NKKEIRCFELQRQVDRMEKDLQYAKTESSRLAQEAGELESQL
E1QL74_DESB2          DLERARLAMLEAEQLI--DQAGAKRLETQGAIQRAENELTLLGREAENMRRLAQRLGGER
B3EFQ6_CHLL2          ELQDAELLQLRHEEEL--SASQKALNGISAVIHDLEKNLLLHEEQQKSLFAAINSIRITL
A1BDT4_CHLPD          AVQDAEVMQLNKEQEL--ASSQKKLNDLNNRIHELEKQLLQDEEQRKSLSSGIGRIKTTA
A4SG64_CHLPM          AILEAERQQLEEDQAL--ANLQKEVNRGNEEIHALEMQLLQLEEQQKNLTGRIERTETLA
SMC_CHLTE             AHQESELRQLELERKL--ADAQKELNASNQLVHTLEKQLLQHKEKQKNLLQTIERLNYSI
Q3ATI3_CHLCH          ASQEMELTLLKQEGAL--AELQKVVRESNQKIHELEKQQLYVEEQQKTLTADVGRMQAAR
B4S519_PROA2          RLQNDELRQLEQEQSL--SEAQKIINTENERIHALEKKQLQLQEQEHGLKETIVRFSSAL
B3EM83_CHLPB          ILQESELEQLEQERML--SEAQSVLNEKNKELHALEKNILQAQEQEKNLRHNTTRIAGAI
B3QRZ4_CHLT3          DIESQQLKLVEIERLR--STSQKEINARRENIVVTEKQLVSNKARLHSLQESIARAEKEV
D0MFL5_RHOM4          EQTELQQQLTQTETAL--EAAQERLHALQNRLQALDSEGRLLDERLQAARSEQERLQREA
Q2S457_SALRD          RLQELRETLATREATL--QERREALQEHRARVRELEAEQRLQRERLTRARNDRDEAQQAQ
C7PLU2_CHIPD          SVEEDKLHFVAKEREL--QVLQKSFNELVSTIRTKENDKNLASQQLTYLKERERNISQFL
E4TVF1_MARTH          ALEKGKSELLQKEKLL--ASRQKALNEHVNKIRQYESEKKIKNERLRFLQDKSDSLKNQI
B2KBE7_ELUMP          SVAALDLNLTHKQKQL--GEFNEKISTIKYQIGVLEGAVKNCENLTIELTAQITYSASEG
B1H0P2_ENDTX          EIQDMRFSLDGRNEQY--VNINRDLSEIKTQIGVADQIIQHAMSREIEIKAEQERLGHEL
E4TEW8_CALNY          QEQNLKDEISKLESEL--RDKNNKVLSITEEIGGITSEVSVLQNNITTAENAKQQMNEEI
D3PDY1_DEFDS          EYNSIKNKLSEKRGDL--KKYSDQLIEINNKIFGVENEIKLLQNNIDGAGRRKESLKHEI
D4H2V6_DENA2          IETEISSKLSTSRKEY--NSKNELILQAESESGKTEADIRLLENEIEAAEKSKDSLHGDI
D6YSC9_WADCW          ERQDANIYLNHVIKEL--QVQKEEMFKTRSQKEIQIKAWKSQEDRLEEMVCKGSEWQQEL
Q04TU9_LEPBJ          RIEVLEKDKSGIEMKV--SEIDKKLYDHLSQTKIQKEKIEKNRQIILEYEERVSEMTSIL
E1R6H6_SEDSS          LLEENLDQVNSMESSL--IEAQKKLYGIDIEKSNRESRRQILTERSSELEQQAKTAVERQ
Q73ML2_TREDE          LLSENMDIVNEMEEKF--NAYRTKVLNLAIEQKGKQEQVQIYNKRRSELKLKLNQLEAKT
A0A0H3BKB7_TREPS      TLSARIGEINDMEKRV--DALQKEIYGLAIEQKAKQNEASLHRKHLSELKESIGQIEMRK
E0RSK7_SPITD          SVEDSLDTMGSLEHDL--ARYQRELYGLEVKRHSLSSQMTLLSEQISEIEGKISTDRVRE
D5EMY0_CORAD          SLAVKKLARTELFEKM--QDLQQRVYNLRSEKENADNQSEFAGIRSKDLEGRIAEYQGEI
B1ZZB8_OPITP          ALESKKTERSRLNQRV--QDAQQAVFDVRSQREQAENQANLAHIKRAGLEDRLGSSRTNL
SMC_DESHY             EILGNKVKLNLLDEQI--QKQQETTYQLDQAVNQIVQELRLRQEREGYLGEQINRVTTEL
A4J682_DESRM          EITQAKSEFLKIEASI--SLLKEQILELDGGIDRLKNKQALTIEQINHQVSEYQRIEQYQ
Q67PF3_SYMTH          ALEVSRQLVAALDEEL--NVLSVRLTEAASRQERAEGRLALAVQQRQGLEADRARLEREL
B0TGW8_HELMI          AEADAALAARQVEEAL--TATRQEAHRRTEGVIALQGRLNVVRERIKGLAAQLQLLTKEQ
Q2RJX0_MOOTA          RSRDIRERLARNQEAR--ERSRVELQGLREQLVQVRGRLSLVDEKLAALARQRVEDRERE
SMC_BACSU             KIEDTRDKIQALDESV--DELQQVLLVTSEELEKLEGRKEVLKERKKNAVQNQEQLEEAI
C5D8T7_GEOSW          EIEQLRDHITALDESI--DGLQQVLLVASEELEKLEGKKEVLKERKKNAAQYKKQLEDTI
D5DQR5_BACMQ          EIQTLRLHIQQIDEQL--DSLHKKLLYVSEEVEKLEGKKEVLKERKKNAFQNKEQLERLV
B7IUK7_BACC2          ELEELRGQLQAVDESV--DSLQEVLLLSSKELEKLEGQRELLKERKQNATTHCAQLEQLI
Q9KA07_BACHD          SVQGLKQQIAQLDEEA--QIAQQQLLSASETLEKREGRRDVLKERLKNAAENREQLLQTI
Q5WFM8_BACSK          KLASYREEHAAIRQTA--ADLHKKRLEVSEALEKNEGRRGVLEERKKHALHNEEQLIESI
Q7ZAM6_OCEIH          RLFEQKQVSSTIDESL--EKLQSTLLQATEQLEKYEGRKQLLDERSKHLGENREKLIQQL
D6XTT7_BACIE          TVLTGREALQELDDEL--SEQQQQLLIATEELEKAEGKKQLFEERLRNFDERRAQHEQEM
Q81ZN4_ENTFL          KLVRLRSKRNRLDEQI--ETEQQQLLQVTEALKQAEGQKNVLIERSKHTSQTASEYEETL
A0A0E0UX46_LISMM      VISREKQALNETDIAL--DNLQERLLVETEKLEQLEGERNLQLERKKHSSENEQVYAETL
B1HQH6_LYSSC          QTIHIRKLLKELDEYL--DVSQADLVNATMEVERWDGRKALMAEKRQNASNQLQQLNTSL
C6D303_PAESJ          HLEKDRQVLRELEEAL--DRLHGDMLHYSEEYEKCEGFGEVLKERKKNLEQNKKQLEETI
C0ZFN9_BREBN          DLEQARFHVTQIDQSI--EELQQVLLTVSEETEKVEGQREVLRERMRNLNANRQQTMEQM
C8WWA4_ALIAD          AWKARRQALNEATARL--ESLQQQYVEVVEARQKAEGSLALAEERLAALAQRAEDRRRRR
D5WPA2_KYRT2          HLEQRRLELVRQDREL--EEIQSSWASWQAEREREEGQRRLLEERATHLDQTWTEAKNRL
C4L5Z7_EXISA          ERSGLEATLAELREEL--TELNQNEREHSTYVERLTGDIKLAKAQEEHGAEMKERLIRQR
B1YIN0_EXIS2          TRETQETSLEEKRRLE--TEMQDRLRLVSTKLVEIEGALNLAKEREKHGAEMKARLEQEV
D3R1B0_MAGIU          ADAAQADLAQGFEQRQ--ISLEEQQKAWQNDQLALVSRRTAGQERMTALRERLELCRTEA
D2RLB2_ACIFV          QEEELEQKLQNQEDAY--SACQEKIMAREKEAAGYRSQKAVQEERIQQSRNRMDQLAKAR
D1BLY1_VEIPT          RRHELQSSSSKEQEQL--KLWEAQYTEKQRDEERLSGHLRLLEEQLKTARRELDETSMRI
A5UQ60_ROSS1          DLLHLRERIRAIRDRI--GSLHAESSALHARAGSVQRALAVGQERLAALSRQIEEQDRAL
B8G556_CHLAD          AVQTKRAALRERREAL--SALHHQATVLHQQAETLQRDLAIEHERLAAAAQRSEEMERHL
A9B100_HERA2          QLGALRQQRDQQQQLV--EQQHQQLAQFEREWEAVEREWAVLTERQQALITRRAEAHERQ
D1C6T1_SPHTD          ALADIEQRGAAQRAEV--ERLAAETARLRAEEREIEHRRALAAERRAAQVRRRDDLEQEA
D7CMX2_SYNLT          ELALLKAKTGEVKENL--SFYNEERHRLQSELQRCEAELRLSAERLMNARQRREDLAGEE
Q0AYV7_SYNWW          KLREEEEGLARQQLSL--GELGEQRHLLESRLNLLQGEIRLGEERIKNNNKRIDDAVADE
SMC_LACPL             KLANLKTQQTAQLKQK--DELVAQNLELIKTIENTQGQQGVDAERRQNQQSEQERLTASL
Q03RT7_LACBA          TVQALKQQQTELLAQK--DALQEKLVTATQQVAHSQGQVNLSGEQQRHQDEQRQQLQAQL
B2GD41_LACF3          RQAQLEGQRRQLLATR--DEHQAKLLEATQVIAKLENQQSLSSVRKEQRQAEQDRLTKRQ
A5VKP1_LACRD          QLDNLKQKRQQLNATK--DRLQAIILNQTEAIAKYENQQSVSSVRREQRENEQRRLTAQQ
Q03FW9_PEDPA          QREKIKKVISEQNHQK--DQLQIKLVKLNRLEQQLEGEHDLRVERQKYVDQEKERLVSEQ
A0A249N2C3_LACRH      QSEQLSAVDHQYEEQL--NHLNDQVLSRSMKLENLSGEANLSSERSANAATTLADLKERL
Q38XR7_LACSS          ALADNQQEVATLDQEI--ETANETLLVKSRLAENLQGQENVSKERASYTDANRQNLADRI
Q1WU99_LACS1          QVEVLHSRQKKLESLI--DNEQNELTELVRQEEKISGQQNMSRQEEKFQKERLSELQEQY
Q04GL1_OENOB          KEDLIDSQSNELESKL--NNLNHLVEELTQKYEHALGENNLQKQKRDSLEHNRDLLNSEQ
Q03VW6_LEUMM          K--LLDKRQERVSAQLSRDSLQATILECTQKRERLIGAKNLGAQQISTLNRDVESAKKQE
A0A0U5K8Z4_LACDE      KLAAKRQEFQLESQKR--DQVQAEVLKLTNRLSEINTSLQVSQQSRQFDQATRLEYQRQL
E4SKB3_LACAR          AVSEKRGEYKKLQTER--DNTQKQLLELSKKLSDLDASLQMAEQSRQFDDATKVEYQNQV
Q74IP9_LACJO          DLEEKRKQSNERHAEK--DEKQQELLSLTQKIAALTTDLQMHQQSREYDVATQKEYNAQS
A0A0T8KIP4_STREE      ENQTLKKQRQDLQAEM--AKDQGSLMDLTSLISDLERKLALSKLESEQVALNQQEAQARL
A4VVL7_STRSY          ENLNLKEKRHRLSEQL--EREQAVLLDLTKLISDLERKIEVHKLESSQNESSHQEAQARL
C0MCR5_STRS7          ENHRLKTKRQKLSAVA--EQTQADLLELTKVISDLERQIDLIKLDLSQKQEKKTEASQRR
A2RLZ7_LACLM          QVSQLRTECQKVEAEQ--EKLQADQLNFSNLKSDLTRKIELFDVQKDSSEKSAAEREERL
B9EBB4_MACCJ          KLDAHKSERNKQQKLL--ETYKSDLLHITERIERNIGLLNVNKERLIHQDANFEEKHQLQ
SMC_MYCHR             SISQTVHFKTEVESSI-------------------------------------QEITSKL
E0TKT8_MYCHH          SISQTVHFKTEVESSI-------------------------------------QEITSKL
Q4A770_MYCH7          IIITNTQKRSEIEAEI-------------------------------------NTKNREI
C5J708_MYCCR          VIVENTNIKQDLEKKI-------------------------------------SNIKSEI
A5IYM7_MYCAP          KISQNIEFKTNLEAAQ-------------------------------------KEISIEL
D5E4P4_MYCCM          RLNKSIPLRDTLHKEI-------------------------------------TALMGKA
Q6KHN4_MYCMO          ELKVKNSYRSNFETEL-------------------------------------SKIDQKI
Q98PK8_MYCPU          IIEQNSGDRLKFEKEL-------------------------------------HFLVQDL
D1J8Q8_MYCHP          ASEQKSKFVLELENNI-------------------------------------KKISERL
Q4A588_MYCS5          SEAELKLDLRDKTEKL-------------------------------------QSLANQI
SMC_MYCGE             QIVIFNSRFHSADMQS-------------------------------------NELQKEL
SMC_MYCPN             QLNIFNQRFRDADEQS-------------------------------------IKLQQEL
Q7NBU0_MYCGA          KLEAFKKRYNSADQNV-------------------------------------QKIQDEL
Q8EVS6_MYCPE          QLNAHKEMLTKAEINN-------------------------------------DKFSWEL
Q9PR04_UREPA          EIESLRVISDRYAKEY-------------------------------------TNLEFEY
Q6F1N4_MESFL          ELDVMLSKNGDADKEI-------------------------------------TQLNLNF
Q6MTD2_MYCMS          EVNLIIDKDSEDNQKL-------------------------------------GELNAKF
E3GP81_9FIRM          AFQNARGNIRGITEQA--DAMAEALEQLKKRIGECERELLITQGKSENESANAERLTQDL
SMC_HALOH             KLESLQRTLKVKKDEL--SRLRDRYYRQKSKREEAENTLCILEERRQGLSREKENLNQEI
E4RL35_HALHG          KLQTKKDNLKEKKKEK--EENNSNYFQNQNKVNEINNNLNLLAERKKNYLAKKEELKAEK
D9QRN7_ACEAZ          KEEELNLELDKAIEAI--SLNKDEIYQTESDIERINNKLEIIKEKRNNADYRINQLENEI
A8MHB7_ALKOO          NLQELEALLNQCSIKI--ANKQDEYFNIQKSIEKIEGQINLKKEKSNNTDSNIKRIEIEI
A6TRT3_ALKMQ          QLQNMKNHIEEQEQEI--QVCQNQHHHIENQIEKKGGHVNLIHEKILNNNENIKRLDFEM
A3DDY2_HUNT2          LNQTNLSILKDMEGRL--EAAKQEYYAIDGNLEKSNSEIRLNQEKINNLFSNIERLDGEI
D5X8N2_THEPJ          EIEELKHHLHLTNEDI--NNLQQDIFEKSSAIEKLEADIRINGERNKNLKERQERLQAEI
D9R048_CLOSW          EYDVLDTYLAELDEAV--SGARNEKNKSSVEMGSLEGRINVLKEQINTEQMNAEHIAARM
C4Z0E6_EUBE2          EYEEAEEQLSKVNSDI--ENVNSLLSNTELESQRLNGEINVITEQINRFTDNEKHYSDRI
C4Z924_AGARV          EYERLGNDMQQMDERI--ESLRESITSTSSTRQKLENQIELLKEQIHTAEMTDEHLQSRL
E0RV40_BUTPB          EYENIQKKLEILDAEI--DEARARITDSSVKKEKLEGQIGILNEKIKAASANDAHFKQRM
A9KLR0_LACP7          EYEKLEEDLEQLGEEL--ELAKSCKSELQLSIEKTDGEIKVLREQVASITQNENSFQSRI
D9S347_THEOJ          RLLHIKRELDKKQEEY--ERLRGEFFNKTTEKKEIEKEKEWQNERLKRLKEDLNITEQKL
B2A2N3_NATTJ          ELETIKTQLVDLEKEM--EKQQQQNVEVVSEIEQKQGQDKILSERKENLEKEQVRLESEQ
A8F8R1_PSELT          NWSALKQEFANVDREI--ENFTNLLEDYKKRQTTLIELREMYTKRLNERENKFVEMTTRL
A5IN04_THEP1          KWSTLRSEFGEMDQEI--ERYTKLLEDYKKRQNDLVEMKGFYSSKLADSENKYVELSTRL
C5CIS4_KOSOT          KWSTLRQEFSEMDKEI--EGFTRLLEEYKKRQNDLLELKEMYSKKLSDKESKLIEVSTKL
A7HMD4_FERNB          EWSNLKDEFNQIDVEM--ESYTKTLEEFKTRENQLLEIKEKFSKKLSELENKYIEITTRV
B7IHN5_THEAB          RWSILREEFNKLNKKM--EDFTSLLETQKQRQNQLLELKNSYTNRLNDLKSIYVEKMAKI
SMC_THEEB             EMAAAAVTLEQLNRQVK-ALGEEEYLRLQATLADLHAQQRQCQRQQAANQQQQEQLAEQL
Q2JHS4_SYNJB          HLQQAEAALGELQSRIH-ALGEEEYLHLQAQIAAAEAQRQQVSRQIAAWQEEIQQAQRLH
SMC_SYNP6             QIQQTEATLDRLNQRVK-ALGEEELLKLQAALAQQEAEQRQSQRQQQELVESQTQTQQQI
B0C9C4_ACAM1          ELEEISQKLETLNAQVK-ALGEEEHLALQAQIATQEAELKQLQRQQGELEQSQEQIAQSI
Q115J3_TRIEI          EVRQAQTELDDLNAQVK-ALGEEQLLALQSSLATQEAERCQFQKKHKELEATIQQTQKNL
B2J925_NOSP7          EIVQKTAELEQLNAHVK-ALGEDELLAVQSTLATQEAERKQLQRQLTELQTASQETAKRL
E0UKI1_GLOV7          QIEQTSTTLEQLNTQVK-ALGEEEQLSVASQLATQKAKRHQLQQQQQQLELTTQETQTHL
B7K4Q6_RIPO1          QISQTSSELEQLNRQVK-ALGEDEQLTVASKLATQKAQRNQLEQRQQELLTLTQQNQKSL
B0JSN6_MICAN          QIAQNSQELEKLNQQVK-AFGEDEHLSLTSRLASQQAKRQQQQQRQKELENLEKESQAQK
SMC_SYNY3             AIQTQQTELEKLNAQVK-ALGEEEQLAVAAQLATQKAQRDQLQQRYNDGDRQITNHQQQV
Q84EC7_SYNP2          EIFQTGQTLESLNAKVK-ALGEDEQLSVASKLATQKAKRHQWGQRQTELEEDQRRSLQLH
D3EQ04_ATETH          KLDILNTDLKNLNLQVK-ELGEDERLTIASKIATQKAQVDQLQQHKKESYCTSEKIKLEE
SMC_GLOVI             RCEQALDELDTANTRVK-AMGENEQVALRTQMASVQAQRAQAEAALADLAQQQRQAQGRQ
A5GQT1_SYNR3          QLKGAAEELAALQEAVK-SLGEDQLIAVQGQLAELEAAGRELQRRAERHQQQASELQQQR
A9B9B9_PROM4          TLQTSSEILSKLQEEVK-ALGEDKLIAVQAEIAGIETQARELERQAGQHKLDGEKLQEKR
A2BNJ6_PROMS          EISVLEDALKILVDELK-EKGEDKLIKVNSDIGSINSSLRELDRISSLNKEEGIKLQKQR
Q46EX0_METBF          ELQALEETLEKLSVEIR-KKGEDEQLQVKREIEETKGEISRCVDSIELSESELEEADSRR
D7EAF5_METEZ          QLQELEKTLSDLTNQIQ-NMGEKEQIQIKKDIEEIRGEISRCNGSIEIAENEIQDIDTRR
D1YW78_METPS          AVQKLKDDIKALNATIT-EKGEGEQILIRRQIEEARAGIKACISIIDFSKSEIANRDSEK
A0B8B9_METTP          ELRRLEERLKAVEGEIS-HKGEDEQLRVRREIEEIRGKIAREETRIEAADADIEEADRSL
D4GT30_HALVD          KVTRLEADLEDLTREIE-RKGEDEQLRIKSEMEEIKGDISRLENAIDAAEEKRDDAEAER
A7IAD8_METB6          ELAYLKADLADVDELIN-QKSGPDYLKLIADLEEAKSGIKLAEQTIGRLKKDKEANLEGI
A3CWK7_METMJ          EIEEARERQHAVEEEIN-HKSGPEYLELVGRLEEARSAIKLGEKTIERLKVNREENAEAV
B8GG37_METPE          ELAYLRADQKEVEAEIN-RKSGAEYLKLISQLEETKGNIRSTEQTIARLKREKETNLELV
E1RII6_METP4          KIEELRKNVLELEKEIN-EKSGKEYLELLSEIESAKGRISVSEQTIVRLQQSIESNKETV
Q2FLH3_METHJ          ERDFIRDEIAEIDQKIA-ARTGSEYMALVSRIAEAKAAIDGFYRSIDRAGRDKEEANKRL
A2SS75_METLZ          EKNSRLEEVREIDKEIS-HKQGPAYMRIIGGIEAEKGNIRVAEETIIRRKKEKESNLAEM
D3RYW2_FERPA          EVEKLNEEFEEIVREIS-SRMDERYKELQKRISEAKAEIEKIFEEKEFYGSQIHELESKK
O28714_ARCFU          RIAELNEKINELAAKIS-ELGDERSAEIQSRILELSSELESLRRAERFYLDEAKRLEEES
D2RFP2_ARCPA          RLVNLNEEVKEIVDRIE-SFKDSRLKRINEEINVVSNEISGLKKLISLFSSEVEDLNREK
SMC_THEAC             RSEAIRIRREDVAKRID-DLTSGEMNRVKTDLHSVEVDIAKIRGIIDEKNRNMEKLEETI
Q97AI9_THEVO          RYHSIEQLLSEETKKLN-DLTSGEIRTVQEKLRSLEISIASLDSKISEKKLRMQDMAKQE
SMC_METVO             EIIGLKVKINELVNELN-EKGSEEVMELHKSIKELEVNLNNDKNALENAIDDLKHTLKME
A6UQ42_METVS          KSNDIKIKLQNLISELT-EKGNEEIMEIHKSIKEMEVTVENDKKSLNRGLDDLKNVNLTS
A6UVP1_META3          NIVDLKNKLENIISELK-EKGNEEVMELHKSIKELEVNIDNDKNQLNNGLIDLKNSKNQM
SMC_METJA             EIENLKLRLNNIINELN-EKGNEEVLELHKSIKELEVEIENDKKVLDSSINELKKVEVEI
C9RFQ3_METVM          EINSLKNRLKNIITELN-EKGNEEVLELHKSIKELEIEIENDKKILNSSKNEVIKIEREI
D5VT24_METIM          EIKKKKEEISKVLEKLK-D---SEVLDIYNKIKELELEIRHENEILKSLREENLRIKNEK
D3SQ87_THEAH          QEEEKQGELNLLEEKL--KELREKLLPHREMVGRLSQKLESISNRLQQIARTKEELLDQR
D3DG53_HYDTT          KLKVLELEYQQREEEL--RSVNDQLLPFREKLGKISSDIEYLEKSIKEAIKKREETQEEI
SMC_AQUAE             QIQENEKELNERERLL--KEVNEKIMPFKEKVGKFTAEIENAERSIKEKERELKESENRV
B4U7R1_HYDS0          TIDIKTKELKDVEQKI--TNLQETLLPYRESSGKLSAKIEYIKEQKASKEQELKKELSHK
C0QSN8_PERMH          KQKEQISVIKELEDRL--NRLQESLLPLKEKEGSITAQIRTSSDKKSEIEKEIQSIKENL
B2V736_SULSY          KQKQILNQIRDLENKL--NEIQNSFLPIKEQEGSITASIRSLNEKKDTLEKEIQSIDSKI
SMC_PYRFU             EIVEKVKVLREIEERIE-KESGEEAIQITKKIGEVTSKIELTKRNIEVAKEELEDAQRRL
C5A612_THEGJ          EIIAKERELSGVERELE-EKSEDGILEVTRRISEVKSRIEMAKRNIENARREIEEDQRRL
D1CC09_THET1          QKRLIEQDIEKRKNHI--EWVNASLRENKALMASLQRQIADLQKDLTENETQARITESEI
D3TAQ9_ACIB4          EEEEIKKKIEEVDAKIR-SMGSGEIVEMKNKIEELKIKYAEEKMKKENKEDRIQEYKERI
SMC_HALMS             SLEEERFKKEEQTEKL--EILQKERNEISTQLATAEERFSNLCKTLTDKENLIETRQKEM
Q6L0R1_PICTO          ELNKTRNDINELEKKIN-DLSGNEINKIRSEISSINVEIGKIDAIISSEDTELKNIQMKL
C1A7M6_GEMAT          QREEAHVARSTAEASR--LELARLASEQRDRTQKLERELAVSEERQRSTTMRRERAEEER
C9RN51_FIBSS          KIEEKKLAISEDENTY--RDLERNVQAATIALNDLNNNIMRLRDSMAALESSNEKAQGEI
D1B5Z0_THEAS          AASGLDSKGRELDLAL--GGARAAMEDLERRMEEWRRRCFSLGTMVMEARRSGAEVARER
                                                                                  

SMC_FUSNN             LHLDNKIEKKLEEVTESKNKKDEISKNI-VEMA-AANKEFENKIFNLENIKVEKFDLIEN
E3H7H1_ILYPC          SKLEEKFLEKEREIGSLEIKESVTSEEL-TSQE-SENSKFELFISEKEEIKRENELSLNM
D1AK68_SEBTE          DNIENELKEKNLVLENSKKELDEIKKVF-DEKN-NDKNNLEKELESIKEESLAIEKTLES
SMC_CLOK1             KQIENDKIKKSEGITLQNQNLLELKNRE-KEVN-IGILDYENNIKKIEKDIYSRENICKK
D8GS00_CLOLD          KQVEKSNRKKLQQVELQKDGISKLKADK-DKLE-NDISEYNDNIGNVQRNAVEREDLYKK
Q97IA1_CLOAB          EDLDNSIVNLKSRYEIQLKTLTEDKNYN-KELL-SKINKSEEKKKNIDGLIEEWEKSIKQ
A0Q0Y7_CLONN          YSLQEKLKKLTHNKLEEEKRLNDFIKRQ-QLLE-SNIIEFEKSIGEKNDSIKQQLNFINE
Q895M7_CLOTE          KKDNIKLEEIYKFKKIGEERFSKNKKLL-EELL-VDFIEKEGHIENLNKEFKNKELELKK
Q0SSA4_CLOPS          EENKKKLNVLMKEKNSIEKDFNLNKSKF-EKEL-EEINNLEKEVNELNLKFISKEKEIKK
A6LSM4_CLOB8          DDILIKVNQLNENKKLLESELSERLKEQ-RLRE-EDIVNLEENNIKSSKELKSIDEEIKS
D9SLC7_CLOC7          ENLRKKITDMQAISTQHSLDIKATDEKL-KELT-SAIENTEQEVQSVNDSISIQEVNIDK
D7APA8_THEM3          KKAVKREELLREELKRVESNVALLHLNK-KELE-EKLKQFQEEYISVQKQQKDKIEEVEK
Q8R9W7_CALS4          EKLEKKKLLLKEELKKSGDRIFRLQEEK-NGLQ-SKLKEMEEKQKNLHRLYREREEEIEK
D9TN88_THETC          DEGKTKSTTVLKDIENIKNDIKRLESRK-MELE-ANLNDLTLKYNSIKEEADMKQIEVET
C9YKI7_CLODR          NDIKEKLNENKQYIKELESNKLSGSEEL-STLQ-ENIKVLEASKDKQKIKLESLNNEIEL
E3PS49_ACESD          EKIIFEINSNKVNLDSIQKTHDDLLKQK-KVLE-DSHSNKREKYETLEIELKKYDEEIEN
B0S1M4_FINM2          ENSSLEVKNLITKIDNLRKTIEDSEKKI-EEIN-SNLETY--NIDDFENELNIKKQLSEK
Q3AC59_CARHZ          KANGRKLVEINQELNSYQRQVKDLKAKE-REII-GNLKVQKQKLGINEEKLLELKKSLEN
E4SF58_CALK2          LQLEKQKEDLKKNIEELQKSLSEKEEEH-RNVL-EVYAKLQKQITALKESITKIDSEIQK
SMC_RHOBA             RAMRTEAGSAIADLRKTIAALEVAEAEL-ADVQ-QKKESIAAKRDVEQATVHRIESARDD
D2QWB0_PIRSD          VTMTDRFTEISARLKETHEQLAAATVEQ-SSVE-AQLAAAEATAAALTTEYQTLRSSLQE
D5SU17_PLAL2          VMLAQRYDASFQEIQSSAARSAEIQTEY-AQRR-ESFEKQQTQLVHLDQQQESDSIQLQL
SMC_KORVE             QNTTEQLGRLEEELATNRQVLESAAADV-AVAQ-SDLQTKQQEASAAAANLMNVEREQEQ
C1F1T5_ACIC5          QQARQQLEATAAEREAQRGFLQNAEEEA-ASFR-AQAQASQQKMRDASQAVSAAEQKIEA
Q01Y77_SOLUE          HDLGLRLDALDEEIAGHKKNVDGLEAQI-AQAR-ERMTEINQQREGLQIKVRERERAIEA
SMC_MYCPA             DTDP---DALEAEAERVAAAEQQLLAE--LATARSRLETARAELAEREREAAEADRAHMA
SMC_MYCTU             DTDPRKPEELEAEAQQVAVAEQQLLAE--LDAARARLDAARAELADRERRAAEADRAHLA
SMC_MYCLE             DTDP---DVLEAEAQQMEVAEQQLLAE--LAVARTQLEAARAELADRERHAVEADKAHLE
A4FMG9_SACEN          AGR--DPEQLEAEAEEAAEQEIELREE--MEQAREVLSEVVRRRSELESSLKAAEQAHMA
C8XH72_NAKMY          ESRR-DPDELEARAERAEAEHEALVEA--VEAAAERLAAASDERQEREHALRAAEHELSA
D7GEI0_PROFC          ARDP---AELEAEATRARAEEAELEAQ--VEAAQESLARATTRRESAEHDHEAAETDYAA
Q2J6Z3_FRACC          VRGRRDPEELEQEATAVREQEIALTER--LERDRDLLAEVVTRRADLEAALAQEEKELIA
A8L599_FRASN          RGGR-DPEELEQEATAVREQELALTER--LELDRETLEEVVARRGSLEEELAREERALLA
C9Z3S1_STRSW          ERRGRDPEDMEREAARVREQEAELEAA--LEAAERALEDTVEHRAELERELTVEERRLKD
D7CC86_STRBB          ERRGRDPEDMEREAARIREQEAELEAA--LEAASRALDDTVAHRSELERELALEERRLRD
B1VYX5_STRGG          ERRGRDPEDLEREAARIREQEAELTAA--LEAAEHALEDTVAHRADLERELAAEERRLKD
E4NHH3_KITSK          ERRGRDPEDLEREAARVREDEAALEEA--LEQARYALAEATEERADLERALADEETRLKA
C7QGY1_CATAD          ERHGRDPEEMQAEAARIREEEADLAEE--IAEAQETLAGAVMQRTDAETALQQEERRLAA
A0LV82_ACIC1          TWQGRDAEQLDAEAAAARAEAGQLDVE--LTALRAALAEASERRRAAEAALATEEQRFAL
A0JXV4_ARTS2          PDSGRDPEQLERNAARVREEQAALEDA--ILRQRTALEAASAAKQEAESAASAEDKRLAA
A1R7H8_PAEAT          PDTGRDPEQLERQAARVREEQAALEHD--ILAKQAALLEATVAKDSAEALAAAEDKRLTA
A6W7T9_KINRD          QTGRRDPEELQAAADRVRAEEAELAGQ--VAAHRAALDEVLAARAEADRAARAEDQRVAA
D1BJA3_SANKS          RRGQ-DPEELEAQAERARDTEDELVAE--VAGHEAALARSTERRAEAEAEVALRERELAT
C7NGM6_KYTSD          SRSGRDPEQLQAQAAELKQQEADEAAR--IDSTEDELAEATSAREQAEAAHAAEAQRLER
B2GFM7_KOCRD          PAQGRDADALEEQAARTRAEAGQLAER--VTEAQQGLERAQQSRAEAEDEAQAAEKRSAE
E1VVN2_GLUAR          FDSSRDPQRLEAQAERMSEELEELEEA--LEDRHEILAEAVEAKEQAEEASRAEQQRMAT
A5CQQ2_CLAM3          -APEAAAGTTPGQVQESRDEAARLIAL--IAEAEAGWASARQATAAGRQALDALDEEIQA
Q6AE90_LEIXX          -AAADGPRVSLQMVQDAADEAERLRTL--VAEAEAAWRTAQEATRQARSRLDSVDEEIAA
D1AB24_THECD          ERRGRDPEEMEREAAAVREQEEQLRAA--LEEAQAALEEAVRARAEAEDALREEEHRLQA
D6Y659_THEBD          QRWGRDPEELEREAAEARAQEEALAQE--LEEANARLAAAVDYRAEAENALAAEERRLAA
D7BMZ9_ARCHD          QHRGESPDSLRERARTARAEEEQLRAA--VQQAHDALSAAITAREDAESTQRTCDHELAV
D6ZIF1_MOBCV          -TRTADTTELEKRLEKTHAEISEKQAA--VAKAEEALTQTQTAEVQAKEREFAVRSQIEK
C7R311_JONDD          -PPITTTHTTEAAARHVRTAITQLDAQ--LTEQRDKLARITATRTALTERLNKAERAHND
D6ZV06_BIFLJ          -NFGEDPGMLVKRAEELESQAAAQTKA--VADARIALDKATEERADDEKKLASVRQTLTE
Q7ZAJ9_COREF          -YTGPDPDDLLRRAEQADQDLEELEMQ--VEMAAERLDSIRQEVEDRAEAAREAEREHLA
Q8NNW5_CORGL          -YAGQDPDELLGRAETADKELEELEMA--VEMTTERLTSIQEEAEDKAAQAREAEREHLA
Q84F13_CORDP          -YSGPDPDELAEKAARADAEYAEAEET--VDILSERLESIQDNVAELEEQAQRADREHLA
Q4JUZ1_CORJK          -WSGPDPQELLERAERAAEEQAELEEN--VEIAAEKLETIAEQVAEAEEAAHAAEQEHFA
C4LJD3_CORK4          -YHGPDPEDLEARAREVAEREEETTAA--VEEAAERLETIREQVDEKEEKAQQVEKEHLA
D6Z8M0_SEGRD          -APQFE-EDLTDQRAELIAAHAQLEGQ--LAVSAAELEAARGAERAAKAEASQVAQRQRE
C8WGU5_EGGLE          EANAAKRAQAEADRAQAVEQLAEVQRD--REQADANVARLASEQSENAQKRRSLEREAEE
C7MMZ7_CRYCD          EAGTSRLQEAEGRQQEAREAADAAVQA--REAADAALKRAQDEADEIQAHKRVLQQKSDE
C7N560_SLAHD          SGSARRIGLLSDEVDELSARLDAEVAK--RDTLETETKELESRVAVLRANLSAFDTQAGE
E1QVK5_OLSUV          SSMDRQGRQAAAERERVAAGHSDARLA--CEELQARVDELGPLARQASERRRALGSKVAQ
C8W740_ATOPD          SVMDKQKADAAKEKEELSGQLATIRAK--VADLTESVNTLQEAANQAIAERRALDVKISD
SMC_RHOPA             AREQQQAIDADAALERLDTEDVELREE--ILERVEKRSGVDERVAEADASLGEAEQLFAE
A7IGT2_XANP2          ERERALSADAEGVLERLATEAETLRFE--QEEAAELEAIAADRLEEAAAHLEDAERALEE
B8EMM7_METSB          ARERALIADAAGVLERLDVEQAELSGC--AAAEGAFESETRKKLVEAEAALAAMEAELAA
B8IQU0_METNO          TREAASRVDAQASLARLDEEAGALATD--PEGFDSRE-AVEARAAAAEAELAAAEAALAA
Q92RE8_RHIME          AREERLVADNAGILARLDQEEEELRDV--LAEADDRGAQARERLDEANEKLAASEAGLAR
A7HQY9_PARL1          GRERHLIEDTQGAMTRLETEAQELRGA--EEGQAEAQAAAEARVGETQTKLEASERELDQ
D8JUP9_HYPDA          TRESGFIREAKETLVHLDADLTAISEA--DAKAVDEEASERSNLEKAEARRVETDAHFAD
E3I0B2_RHOVT          EREDAAIAEARELLEKFDRDEEALRAL--GDGS-EARAETEARAENAMEGLNEAEDALNV
SMC_RHOS1             EREAGLNRDAAETIGRLEWEREALETA--HEGHEERLAEAAEAAREAGAALGEREEILSE
Q2W040_MAGSA          QREHARAADAVGALARLEEERALLAEA--GEGEAEAKLLAEQAVDLAAEAVVQVEQELSA
D3P3X3_AZOS1          GREEALAADAGEALARLEAERDRLIAA--QADEEMLEEAAAEALAGAREQVDALDRELTR
B6IR58_RHOCS          TRERALAADARQAMDRLAEERHALAEA--QAEEALLNEEAQTALIEAKDGVEGLDRELSR
Q2RPA2_RHORT          ARETARAADAQAAISRLEGERRAIEAK--AAGDDAARREAEARLSAAEAGVAEADAALAT
SMC_CAUVN             AREAQAKDDAAAALARIAPELEEVRAL--VAAAPERGPELAAVAKAAEEARAAAEAAVEQ
B0T003_CAUSK          AREAQGLQDAIQALARADAELTELRAQ--IAAAPARGPELAAAAKDAEEARAKADAEVEQ
Q0AMJ6_MARMM          RRETDIAEDARTSRAEAEAQITRLDTE--TKDEQAALDAAELASVEAETARQAAEDGLDA
E0TC69_PARBH          VRERDLGADAAEALDRIAADVAALEAG--AAAETEALAALGTKVTEAETAFSAAEKAAAA
C6XRC2_HIRBI          SREHALREEALTSAERAKVSLNALPEED-QDTFDTQLASLRAELAEAQHKLRIADTESDN
Q0C0X5_HYPNA          ERETAGRAEADAALVHARNELAALPVED-EDANKALETEAQQALEAARARLAAAESAADD
Q1GQU3_SPHAL          AHEGELAREAHAALTALDAETKSLAQD--IAGHDASKAALADANFAAQARLRDAEVALAQ
D4YX43_SPHJU          EREGTLANDAAEAIARLTDEIAALKAR--IAQTESMRPDFAGRIARAEDAARDAELDLAR
Q2G9S3_NOVAD          ASADRLTEDAAAAMARLEQDLAAAETA--LAGDEARRPTLAAAVDDADRAARAAEVALAQ
D5BSU5_PUNMI          NRENGLREDAKIAIEALTSETETLQQQ--IDDAAPRREAARTGLEAARAHANTAEVALAD
A5FVJ2_ACICJ          AGAERIARDAEAAAIRLEAERSQLAAD--HELAPARIEQARREAEAASAALAQCEAATQQ
C5B6I7_METEA          AREAEAEAEAADSLGRLAEERAVIVEA--QADESAEIEEASERFEVAGETAEASGEEVER
Q937L3_DEIRD          QTAPAEAAPDLAALQAAAAERRARAEA------------AEREARRLDTDLTRARESAAR
Q1J060_DEIGD          SRPPVEPAPDLPALEGAVTAARTEAEA------------AERRVRALDAELTRAREGAAR
L0A7J5_DEIPD          LTAPDRAAPDLAALELTLRRTRDEAER------------LESECRSLERDLTRIRTVHAQ
D7BH70_MEISD          SRLAALQPPKPPQIPEEQVEKRLAEAS------------RLQHIEIELHEAQSALRAAQA
SMC_THASP             GHWSSRRETLAADRARWQELAENAALRA-EHAE-ARHLEIADRLPELDSSRQGADATMAA
A1K715_AZOSB          LHWSDRRESLTEERERWLGLADNAAMRA-EQAE-ARHAEISDRLPDADAARQGAETTVNS
C7RKG8_ACCPU          THWQAQAEKLSDDDERWRSLLALAEERV-EQGQ-ARLAARHERLPLAEESHAVAVEAVTR
Q3SJI0_THIDA          ETQQARRATTGDALSEVTAEQPALEMAV-AEAEAAARQATDSTLPQKEALLREAQQAVGE
SMC_DELAS             LLWNSRREEAEAEIENLEGAGMDAEEQA-EMLA-AQVEEQSMRLPDLEDALRNAQKADTD
D6CTE6_THIA3          QDWQQRHDTAVAQAADTAERLADAEVQA-EVAQ-ARVQEQSERLPTLEAALSDAQLRAAD
SMC_BORPD             AEWDAQQTHCVEQIAQAEDDLATGAART-EEAR-ALAEEAHASLPAVEARVRDAAASRDE
SMC_BURP1             EQWRAQADKAQGDLEVAEEARAVADEKA-AIAE-DDAAAKHDALPALEARWRDAQTGLND
A4SYV7_POLAQ          QRWTVQETDAAQAQRTAEHELSLASEKE-QTLL-ADLGSQQEQMPGREEAYQASARELNH
D5CRW3_SIDLE          AQQQTQLQGLRTLRTHWQQQQEDAAVRV-ATCENRSESEAQS-LPQVEEAARVAQERLNS
D9SGR3_GALCS          EQQLQQREVAQHQLLHWQSQQRVAAEKL-TEAEQ--QFACVD-LSQVELQAHEAREAYHR
Q2YBB9_NITMU          EHYATQADTSVDSLNRWHEEYKQARSDS-EASKQKATVENEK-LPLAEAAFRTRQEKLAE
Q0AE88_NITEC          QNHEQQLDKANESLMSWQNKLTQAEDDH-LSCREEHAREAGE-LPQIESAAQSDQVQLAE
D7DI79_METV0          EKNITQQSNLQESLLNAQNELNLANTDF-SAVE-LLVEEAREAVPALSGRYQQALTAFNA
C1D4R7_LARHH          VALSAQANQVSEELAHWHERQAEAELLA-EDAA-FARESGDDSLPDAELRFRQLDQQLSG
Q7NR76_CHRVO          QQLADNRQQVEAELDDWLPRLEEAQLRQ-EEAQ-MALEDGADELPTAEAAFRQLDQRQSQ
A1KSF4_NEIMF          QRIHQEQQQIRVQLEENELYVEEKQTEL-AEWA-MQVAEHEERLPELEETQTALNAAFQT
A1WY82_HALHL          EELDGTVTADQEKRAVLEERVEELEPAL-EAAS-EEEQVAESAQEDARGRLDAWRDEADS
Q0AAV4_ALKEH          QALERGLEEDREKLALLEERLEALQPEQ-EEQA-QSEAFAQEALDDARDRLEAWREAREG
SMC_XANOR             QELTQHISGDSAKLSVLREAVAAAEPQL-EQLR-EDHEFRQESLREAEARLADWQQRWET
B8GTL2_THISH          RETREHIELDQARLRELDRELETLAPQH-QAGM-QAREQANEGLTVAEQAMSEWQGRWED
Q3JAH9_NITOC          TRTEQLQEEKSALIGQTRQALVSHVESE-RGAQ-QQFQAAQEMMETTETAMQDWQASWDD
D3RSW0_ALLVD          YEAGQHLERDRERLTEIARALAEDEPQL-EQAE-SELSEATGSLMTLEDQLKSWESEWDA
B3PGR0_CELJU          KEAEESLLIDAQKAEAWEAELLELEPEL-EMVK-AAEETSGESLIDAEESMQRWQNDWDS
A6V7X5_PSEA7          QETESHLGHDRTLLATLAEEMAMLAPEQ-ELSA-AAAEEAGIALEQAEQDMQAWQQQWDA
Q0VR03_ALCBS          KEADAHLRIDSEKVAELDAILAEREPEL-EMVC-EQQEASSEALALAEETMQSWQQAWEE
C7RBE2_KANKD          DKLREQLRFDESKLEELMTELLQTEPDL-ELKT-EQVEEQQQQLQDMEEDMRLWQQDWDV
Q2SD45_HAHCH          RELNEELEREQQHLQELEEELMMIEPEL-EEHL-AKSEESAELLAQAEDAMQLWQQEWDD
E4PL89_MARAH          RELARELEQDEDKLAGIQEELDMMEPEQ-EALA-VRSEESGEKLQQAEDAMSDWQHQWED
E1V8E9_HALED          DDLKRVGEDDGERLTRLDERLETLGPEQ-EEVA-ERLAELEAALEEAEPLAEEADAAWEA
D3SAL9_THISK          QTAGDEFAALEQRIVEAERERDQRQQEA-ETAE-AERERLEAAAEQAENEFQAAREAQSE
SMC_METCA             RKVESDRDDDRLRLEAVRAEAAELKGKL-ASLE-QEVAEAVSVRQAAEAKLKTCREGWEA
SMC_COXBU             EELQNNTAECEAQITELETELEHLKPRS-SDIH-SAAAEASKELAQAESNMARWQEAWEA
Q5WTI1_LEGPL          QLIEEQLKLDNEELHNCKLKAQQLEEHL-RHLK-MEFKEQESLWQEKQKEQSQWEKIWQE
Q12L80_SHEDO          AQTAQDNVQGENELQRLEADHVQQHTVW-EASQ-YALEILDEQINQLEESSDALNENLSR
Q080K7_SHEFN          KQADDNIVSMTDVHQRLVAQSDTHQPAY-EQAN-IVLEQIDEQVFAIEEACDDQQQQVTQ
A4Y804_SHEPC          RQQTDKLAGYQSSLSALELELSQLAPQH-EQQQ-EIMDELQSQWEMSVERNEQQSETARQ
D4ZIY3_SHEVD          NQHKDKLSSDETSQQALSEELVLKRPQI-EQTH-LSLTQVTADLSAHELKAAESRTLLSE
B0TKB4_SHEHH          QAYRARLAEDEAKQTLLNEQQASALPEA-SLLR-QQLAEHDAELSTLVEQLEYLSEQLNS
A3QFJ7_SHELP          ALLKAQEQALILARGDLDERQHGAREAH-QALQ-LQLELLDEQLGEVELSLEQAQEAESQ
A1S5R5_SHEAM          SGLMARQASLEAAQQEAADKLAGQEDAL-LGLE-ETQDAWSQSAEEAEEVLEQLKDAVTQ
Q5QUJ9_IDILO          DQLNEQLADDRLQREQLEEQQLMLEPQL-EQVE-EQMESVAEQSQQANEKWRQWQQQQRQ
E1SMV2_FERBD          GSAEQSLASLAEEQQELEQSLELLEPER-EALA-EALETLVLSLEEAQEAFDALSDQRDA
F2GBA5_ALTMD          ELLNHSIAEAQKALAVSNDALDTIEPEI-ALKE-AELEQAKERFEDAEQALREFNIKARE
Q15UZ3_PSEA6          KDSEVELQASVTRLAELTDVIEQHGPEH-ELAQ-QALEDAIWQLQNTEERTSAEQNQWRE
Q3IKC0_PSET1          THSLELKTQQQTVCEQLEHALQQAIENN-LMRN-EQVSELSQELESALELKQQHTEDWQS
A4SKA4_AERS4          EGIRAQLASQQEQLTEGTLKGEQESARL-EQCE-QLLTEQQGLRLVAGEQLEQARQRQQQ
D0KWM8_HALNC          TRLEAACTRLQAELSRLAEERRTLESQR-QQAA-EQRAKAQAELRAADTHLNEMRAEWAR
A0A2W1K6W8_ACIFR      QKVRSEQICQAEDENQRQQRLQDLAVRR-QALS-GEEDSARRLRREAERGLEKQDEERQN
A0A0J1A050_ACIBA      AQTKERLQLSELQLETLNSQLEEQTEAL-TAIE-HTAAEAEQSFAGLQSQQRQAQQQFEQ
B3E294_GEOLS          QTISLQRDALATELTNLLQLQQTTGSDL-LTAE-TELAGLLEGHKEQEQRYEELNRQLDA
A1AU91_PELPD          GELELRQRECAAQREALEQRRDSSSSEG-EELQ-LLLLREEAALAGQQQSEQELSLLLEG
B9M6F0_GEODF          DTCALRHTEAQTELAALNEQKISLIAEL-QRES-SQLVEDERLLDESSRTEQGASAKIEE
Q39WG2_GEOMG          EGLEGQLAAAGEELARLVEQSGTYAVEA-AGEE-DTLATREKELEEMAAAERELSTDLEE
B5EFS9_GEOBB          QGLRDQLAASERELVSLETQQASFLEEH-ARES-EALEHREALLEEMAASEAGVTRELDE
Q3A212_PELCD          QDLHRRLQEIAAEIEELTAAGSALAQEY-QQRS-SVLEREAASLEEQQDKERQWVASLED
A9FIZ2_SORC5          GELEKTVEELSAEKAQLEAQLAGVDEEE-ARES-ELALEQHERLEELRHGERTAEHEVGA
D0LY52_HALO1          AELEKRREDSVAQLEVQRQELEAMVEQA-ETEQ-FAVESREMAAAEARQMQANAQSRLDE
Q1D2R5_MYXXD          DGLLARKAEMSEAMAAREAELSGIAGSW-KEDE-VAMQVAQEELRRVSQLQTEVALRLEQ
B4UDF6_ANASK          EALKDQAEALAAERETLLRQRDDLQSLV-TTDE-GRLGEAEAALRDAGREQGALQAEADR
Q6MNS9_BDEBA          QEQQARKELLARDKAALDEQVTELKEES-ESLS-AAFAEKNEIFQNFNSRIGTVDEDLTT
A9A0M3_DESOH          VSLNEKQAVVETEIAEADVSYRRITEEN-QTVR-EQLARQQEELQEIKTTREETGRQLES
B8FHS3_DESAL          AGLREKQERIVQDRNQCREDMEKAARDL-EQTK-ALLTNDEQAVTGVRQNLARYKAALEE
E1QL74_DESB2          DELVGRLKTMGEDMAKAAARAERCRAEA-QSGQ-RLAEEAAEQVALAQESLRVRQRRADE
B3EFQ6_CHLL2          KEKQEKILMLEKRKDELLERKKPLEKNC-NDRL-EEYRKLSGEQDRLNLELQAHRSGIAE
A1BDT4_CHLPD          GDKQKKSLAFELTAKALGHEKPALQKEC-DKQL-AEYKKLSAEHEELNSRLQEHRQELAE
A4SG64_CHLPM          TEKQDKILNQETLEKELETKLPEIENLS-SKRQ-EEFQTLAAEHDQLNTTLGEQRSRLTL
SMC_CHLTE             ADKGRKRLEQEALSKELSEKQTPLQEVC-TAQL-AEFERLKKQEVELNSALDASRQALQS
Q3ATI3_CHLCH          HRKEEKSRELQQQDLELRQRLEPAKSTK-ERLL-SEYQERSREHEEHNATLIEQRNRLKE
B4S519_PROA2          IEKKNKTQELLDRQQELKGSLAPLEAQC-DKEN-DALQKLNAQLDTQNSRLNAARSELRD
B3EM83_CHLPB          TEKKQQAVAREHEKKQLTDQLQPLEKHF-SIIE-NELLTLKKEQNTLQRALVQSRNDVEK
B3QRZ4_CHLT3          REIELQCETLAVEKQKNEVSLEERRKAY-DEKK-KAYEDARKAHEELEQNLREQRDEIED
D0MFL5_RHOM4          KEAEHQEQRLRQALEAAETAVREAMPRH-EAAE-AALRQALEARDAAQHALEQQRERVRE
Q2S457_SALRD          EEARERRRALTDEVERLESALEQARPAL-DDAE-AALDDAREERDAAKAAATDRREDVRE
C7PLU2_CHIPD          SNAEGQLQGLTDSISFTSTQVEEEQEAF-ETLQ-DQLEGLQDMVEEKKEVFNQKKLSLEN
E4TVF1_MARTH          EQDKQSNERASFSIKSLEQEKTSAEKIF-FETE-QRVEVLKSEFEEQKNKTAAIREEVNT
B2KBE7_ELUMP          QRGQNRLKEITPIISGFKEKLNAIEAEL-LPLQ-KKYNDQFALVKENEEALKNVDITSQQ
B1H0P2_ENDTX          VTIRDKVVQMEEQLKTLNTDDGSLSVEV-VCLE-NVFKEKELQYNSIKVGLLELESKENE
E4TEW8_CALNY          NSITNRLRDLSLMRESIVKLQDEIKSVV-ETKR-SEIAELENTIEELVNQRDEYKEEVDV
D3PDY1_DEFDS          SELESKIKELNTRRDELISAIKDIDNSK-KEID-YHLKEKEEILNEYEIKIEDLKDEVST
D4H2V6_DENA2          EFLQKKLNELTERRVNVLESKSEQTEKL-KETE-EKIDEFNERIADYETMREDIKEEMFA
D6YSC9_WADCW          EEMIRKRKARQLEAEQIEARKKKVDKEL-SALE-QVRNEFREQLREIEYAVNEIRDRQHI
Q04TU9_LEPBJ          NGEESSLSLLVIDLERIQKEVSELEGET-ELLE-DEIRKLKDSKLGLEKRIEDE------
E1R6H6_SEDSS          SSIREKIASTGEGISAREASLAEFDKRI-GEIE-EHIASFTRNIESANGRIGENEKHIAQ
Q73ML2_TREDE          SSTKENIESLEDDISEKNADVFEFKKQV-SAIE-KNAEDFEKNIDLASHKITSNKEEVKR
A0A0H3BKB7_TREPS      IGVESRVQNLEEEVAEQDAHVYQLGSAL-SSVE-EHIESFARSLHVASEHVSENDQTLRD
E0RSK7_SPITD          QHLRDRLLRIESSIVEKEKEYERILEER-RHIQ-SQIQEWEESIAVSERQIIAFEQEIAD
D5EMY0_CORAD          DDLEAQKDALAEKAESEAESKQMQLDVV-DDSD-RIFQDRSSELVRAQEQLGEMEAQLQR
B1ZZB8_OPITP          EELEMQLREVTAQADSGAQDKQMQLGLL-GSSD-AVFQQRNRELAIVEGELTKLEQELNQ
SMC_DESHY             SSHEEKVRQSTEQLRALEDRKALLHKTL-EQAN-QALAADEQRLAEAKARNG--LEEIEI
A4J682_DESRM          KDSTVFLQQLNQELTVEKEKIRQIKESI-ELEN-TSDSHQILEGIEQEVLQK--QDLFQN
Q67PF3_SYMTH          ESLAAKLAQVDAELADLKRQEAAVEQEG-LRLA-QELSALEAECRAAEQAAAAAQSEVEA
B0TGW8_HELMI          EQSRLALAELRNREGEQRERRRLVAEEL-MASQ-QAVDARLLRNAAAREAVTAVEKEIAD
Q2RJX0_MOOTA          GLLAREEEKLRAAAAELARQVETGREEM-AALE-QDLAAGRETREKLRAERDELAARLAR
SMC_BACSU             VQFQQKETVLKEELSKQEAVFETLQAEV-KQLR-AQVKEKQQALSLHNE---NVEEKIEQ
C5D8T7_GEOSW          SSLSEKKERLELTLKHEKEQLAQLKKTV-STIQ-AELKEKQASLSAYDA---NVEEKIEQ
D5DQR5_BACMQ          KEYTHKHQELSKAKDSEGKDLEQSQKEV-QEIR-LKLTEQEQLFRQYSE---NLEEKLEQ
B7IUK7_BACC2          VELTEKAKSYDGEIASSTEALMQFVNEV-KELE-QKLHDNEQLLATFAD---NLEEQIEN
Q9KA07_BACHD          REGEEKVASLKVHLAKEEEAKQKAYEQM-TALE-AEIRNQEKALHGNEK---ELEETVDR
Q5WFM8_BACSK          KEREANQKAVQQKLDELFKQYETVKQKD-DELK-AEFDEATRHLTRSKE---DVSSELED
Q7ZAM6_OCEIH          QEIDQQIEVLANDLKTEQSNLADIQQSK-KQTK-DKVEILREKLSTSQE---KIADQIED
D6XTT7_BACIE          TQLRDQLKKTESELMDVVSNKKEQTEQV-KQLE-DELKELEVALFTLSE---SSEEQLEE
Q81ZN4_ENTFL          AETAEKIVRYREELQTLETAIAEKTAQR-QTLK-EALALATKDVEKYSK---SSKELMEE
A0A0E0UX46_LISMM      AAITEKITALEEQKEVLSSSKLEKETAL-EIAV-KAKKELEATLAKYDD---LSEEAIEN
B1HQH6_LYSSC          QEAKAEVEALLIQEQEKKAVFSEKQQAV-SVLK-QSIKQLEQSLNRSVK---EIEQEIEE
C6D303_PAESJ          SAQDERIAALTSEEAEFRNRAAVLELQL-AELK-QKLAVEENNLIGVSGG--TAVDAEEM
C0ZFN9_BREBN          HRITEKQHGLEAELAEEQERAKEADRRM-TEAH-ASLQEAEGQFFSMVQ---SLTDDVER
C8WWA4_ALIAD          EELARDLAELEAAMEAVARAEAEAAAAL-GERQ-HLLADARQRADDARRL--ELADEIDR
D5WPA2_KYRT2          QDLISRRETVQGELQRLEVEVRSAEAEL-EEGR-RRLEEAEGDDGDAAGA--GLKIRLDE
C4L5Z7_EXISA          EEVRAEMTELEAQLKVVREELDQKGNTL-KQTT-ATRETLQQQLTAASR---DFNAEIEA
B1YIN0_EXIS2          TVAEQRVAQIEQEEQTVLKQQQETQQLY-LQTV-AKREQADAALSYSDR---DFEKEAEQ
D3R1B0_MAGIU          AALEKTLSELSVERTEQLTGKEEAANGL-AEIR-KKLESLQDKLSDSENIVAVINRRQQD
D2RLB2_ACIFV          TGLEEELARSQENLRLVTEEYDRLEENQ-YRSR-NLLEKAAAEKETLTGLVKAGEEKLQA
D1BLY1_VEIPT          SELEATQKGEEQQLRILNQLIQDESAQL-VEKE-SNLEELEASYKKAVEDVRSEQAKFQS
A5UQ60_ROSS1          RDLDHQRAARHTEQETVAAQLASAEQRL-EQVR-QEYAAHEARRAERIAGRAAFHQAFDA
B8G556_CHLAD          MILAEQYQAALYERDRVVAMLTQLAQEI-ATIQ-DELARADHERGVDEQARAALAAELQA
A9B100_HERA2          QSLEREQTQAQARALELAEQAAQAQAAL-IAQR-HALTTIEAGEQATIAARREADQALKQ
D1C6T1_SPHTD          ARLRGEAEAAAQEAQEASDALQEIDAEI-AERE-AAIARLAEADAAARAERERLAAALRQ
D7CMX2_SYNLT          ANYQGLLAKLEENIRLGEDKLAKEEAEL-KAKV-ESLREVESRVGQLENVLADYNRDYED
Q0AYV7_SYNWW          KKQLILLDNIQRDLHLCSVDYDKEQQNM-AQRV-AEYNELEHEVQEMESIIAGFKGDFDK
SMC_LACPL             TATEQQIATQTEQQTQLEQTLSEQQAQV-KAVKAQVAELTTATSAAGRQQLADELEKLRN
Q03RT7_LACBA          TMLSQQLTTNQTNLAAVQAESDQLATTM-KDAQGAIRQLTAATDPQVVTDLRQQLEDQRT
B2GD41_LACF3          SDLTEQQRALADQITAVNGELTKRKEAI-KDHQAQLRQLKTMSAEERAAQLEETIENLRN
A5VKP1_LACRD          AELNARLKEVKASQRANDEQLAEQKALI-NSQQAEFEAARKMSSSERIATLKQQVEDLRN
Q03FW9_PEDPA          QVLKKQLVEKKASLEAAQGQLAAVQQKL-TNTKQSLKVLESDHLEQQKEALKREIEDLRA
A0A249N2C3_LACRH      AHTQQSLTEANQRLADLAKQAKTAQAKQ-LELKTQLAQ-QKQASQDP-AAINRQLETVQN
Q38XR7_LACSS          AQLETQSTTAKQQQIALKATYTEKVATL-TDLKNELATLKRQASGSE-AELKAKIEQIRQ
Q1WU99_LACS1          SANLDNLTEIRTGKQSVKEKIANLEDDR-EKLSKKILELEKIIDNVK--EPEEILEKLKS
Q04GL1_OENOB          TKLKQQLQELADKTNRLKQQIEEEKKSQ-EKAEQQVKEITDKLAKSGQLSEQDKLANLRN
Q03VW6_LEUMM          FDLQNRVRKLDEQISQVEKQNDGLQKQY-QQLKISLGQFDTSVQVELQREIQSKIEVNRH
A0A0U5K8Z4_LACDE      ADLKENLAATDAEISKLADQEAEYAGQL-DQLKCKRQKLVDQLKEDP-ASLKLKVEDLRS
E4SKB3_LACAR          KSLKNSLVKLNEDLASLQKNATELKDKQ-AVLQKQRDELTAELKEDP-EELNKKLESCRN
Q74IP9_LACJO          EELKERRKRLLDQLAANEKDLNSQNQVL-ADFVEKQKNLKQELKQGP-EQLNNQLEQVRS
A0A0T8KIP4_STREE      AALEDKRNSLSKEKYDKESSLALLEGNL-VQNNQKLNRLEAELLAFS-DDPDQMIELLRE
A4VVL7_STRSY          ENLLTRREQLAEQIEQKQETLAQLDSSL-SSLKDDIAAVDKEISYFS-EDPDQVLDHLRE
C0MCR5_STRS7          QQAQEQLLAFQQEHQQKSHQLDEIHQAL-AEFNTKVSELSQELERFS-SDPDQLLEALRE
A2RLZ7_LACLM          ENLKSRLEITQQNLTEVQKKSELLLTEK-NDLDKLLTELSADLATLS-ESPEVVMERLRD
B9EBB4_MACCJ          KTLTQTLEHTKKELSATEDKIQTLKQEK-LSKKQKLSQVEHDQSALA-DDIEALIEETRS
SMC_MYCHR             DNLKNALSEINLQEARIEERRKLIISGE-IVVDQ--------------------------
E0TKT8_MYCHH          DNLKNALSEINLQEARIEERRKLIISGE-IVVDQ--------------------------
Q4A770_MYCH7          HRLKEQINTLNLAYAKATQLQEMILSSE-ISVNF--------------------------
C5J708_MYCCR          YEIKKELDNINIEEAKAQKFREMVLSGE-IEVNF--------------------------
A5IYM7_MYCAP          EAVKDRLNNLSIAIARENERERLIVEGE-LKVDT--------------------------
D5E4P4_MYCCM          KGINERLKDLEIIASKESHRQELIARGE-IKVSS--------------------------
Q6KHN4_MYCMO          NSLNEKLQELEISQQKEEQRRELLISGQ-INASS--------------------------
Q98PK8_MYCPU          DNLNEKLRNLELISANENQRRELIISGQ-IKVNP--------------------------
D1J8Q8_MYCHP          SEISEEITTLEIRNAKEAKHREMLLSGE-LTISP--------------------------
Q4A588_MYCS5          ATDIDLLHKFEKTYNQKDQERSLAASGK-LNVSQ--------------------------
SMC_MYCGE             QDIYQKINELEQR-KVIIDVQ--LRQGF-SQKDE--------------------------
SMC_MYCPN             QAVYQTINELEQR-KAVIDVQ--LKNEL-SKKDE--------------------------
Q7NBU0_MYCGA          QKIYDEIVLLEKR-NVFNDLQ--LKSDL-DSNDK--------------------------
Q8EVS6_MYCPE          GSIKDKIKELELQ-KVTFEND--LAIDM-NSSDF--------------------------
Q9PR04_UREPA          KKLEDTINDLNLKLSLTKNTL--ETTAF-NATNT--------------------------
Q6F1N4_MESFL          QRIVERIANLKNQKQQVEARE--NSENV-NENID--------------------------
Q6MTD2_MYCMS          NSIVEKIANLKVRKQKAKFKE--QENLN-TKDQD--------------------------
E3GP81_9FIRM          NAHLDEHGRFQAEYDELTASRDAAAQAY-EAENADLQKLVDEKSRHQAELEAEKLKQAEG
SMC_HALOH             KDLNLRREELTGRLDEIGSRLIELKEKI-DNYN-QNYESKKVLLDEIKENLDREKQDLFF
E4RL35_HALHG          EKLEQEISKKEELLNKSRENFAVINSDQ-KALK-AKIAELNNQLSSIEKELQKTEAEVNT
D9QRN7_ACEAZ          KDLRDEIKDLKRTEKENQKKLKTTENRL-QEKQ-EELKTAEEELAAVTDRLEEKEGSKDS
A8MHB7_ALKOO          KEIQKEQDHLSVKLEEKLKYFNEICSEL-DSIQ-EYLRSQALAYDQLHHTNSQKEKDVED
A6TRT3_ALKMQ          AKINEDKIQLSIQLEERLKKFDEICIQI-DEVK-NDLEKKSDLLKGLMNQSELEEKNIED
A3DDY2_HUNT2          AEIDEKIKTILEEEASKNSKIVYLQERY-NEYS-AKLEEAEKKLQAIIATLNENERHIEN
D5X8N2_THEPJ          NELSGKQAAIREQSRGEMESYEKLVHNI-RTME-TELAELEAQLRELEADNRSKIDDIEQ
D9R048_CLOSW          RSIHGEIQMKMAQEASYEEERSQIAGQV-NSAV-KELKEAEEMLGSEDELIRSLEQQIEE
C4Z0E6_EUBE2          TAIDKDKAAKQTNVADFKKQLEELSTSV-EEFE-NNLKAKQNAADVIKQDIDGVSDQIES
C4Z924_AGARV          LAIEKEKAQRLKSRKEYDDKKAALEADI-EQMK-QNELLAVNEHEAVLAEVNRCNDGLEK
E0RV40_BUTPB          QDEQTKISEKNSEKDKYLADKAEIDEAV-EELS-VKRNEVRKELDAVILKISNINDEIEE
A9KLR0_LACP7          DSLRANSENKLNELEGYRKEKQDIDEKL-RGLA-EKKSRSSEAILQIEARIQEFTREIES
D9S347_THEOJ          SALNEKLESAGNNLNCKIKELEDKIREI-NGVE-LKLYEKEKALTFVDSSIKEKQATIDN
B2A2N3_NATTJ          ANIEKEIEKLTTSLTDLDNKYESLKKEK-HQVE-EDLHNIKNRLDKMSQE----NNELEN
A8F8R1_PSELT          DSINEQIESIEKRSEELNLIFKALMEEI-NTKE-KMLQDVEERRNQLISRYSEKEKELLS
A5IN04_THEP1          DELEKRREEHKRRLEEMEYIFKGVTGEY-EKKA-KELEAFEKEKENLLSRFSEKEKEFLK
C5CIS4_KOSOT          DTLKAEVEDLEKRKDELKLISDGMKQQI-EDEE-KELKELESIKDSMVHKYSEKEKDWLK
A7HMD4_FERNB          DMLNEETNTLKNRNEEIKLILAKILEEL-NEKE-KVLSELEDEKSKIFTQYTEQEKEILK
B7IHN5_THEAB          DSLKEEAQRITEREKEIQLILESLKKEL-LEKE-EILSKVEEERNLLTSKYSEKEMNLLK
SMC_THEEB             QQGQAQYHRQQAQHRQLAEE-LAQQRGD-RTPLMTAVANSQATLEALRQQVQELSTAAQT
Q2JHS4_SYNJB          QECQAQQQHLQAELEHLHSQ-QEQLAQA-QGSLQAQVQKAQISLEQSREQLRALAQSADA
SMC_SYNP6             QALLQTQAQLQTEGQQQAEQARTLQTTI-AQTLQPQYQQALEQVEAARQSAHALAAQSQD
B0C9C4_ACAM1          QNTQQQLQTLQAEIQQVGEQRQTLETTE-IPRLTQARNQAQEALDTTRQQAQAIAQSADA
Q115J3_TRIEI          SQLEQEVNKHQQNLEVLATE-IVVQTQN-VSFLEAGRNEAQEILNQQRGSASAIADTAEA
B2J925_NOSP7          TQTQQEIQKHRHSLEEIDET-QIVETRF-IASSQHQRNEAHQSLETSREAAAEIASASEA
E0UKI1_GLOV7          EQTSKDIQQYQQTLTQVGEQKQHLLSEI-IPHLITQRDQTRETLETSKQKSHEVAAASEA
B7K4Q6_RIPO1          QETQNTIAQLEHNLTHLTQETLELDNNT-IPFLIQQRDRTRQTLEMVRTQANAIAEASDA
B0JSN6_MICAN          TRLLEEINRYNLELNQITAQKSRLETEI-LPNLLLTTQTARETLENHRLQASSLAEASEA
SMC_SYNY3             GQIQAEISQSQQQFLHIQQEKSFHNTQT-LPQLEAAVQTSQQQLEQLRHQAQAIASASEA
Q84EC7_SYNP2          RQLLETVQVNQQQLLRLEEEKLTLQEET-LPQHQAAQAAAAKILQDSRQRADELASSSEA
D3EQ04_ATETH          NKAVENILQKEEELNVLSQNSNKLQQEL-LPLLKEQKSRSYNTLQKVRKQAAIIAETSDS
SMC_GLOVI             QQLELELGELALTLTGFSRRQQDQQ-AL-VAQWTARLESDRQVLETSRNDLEQLSASSRR
A5GQT1_SYNR3          HQQQQQRAELQQQSQ---QLQSTDDVQQ-RQLADEACRSAEAAVELSRRRLAEVAGRSGS
A9B9B9_PROM4          KELINRHQEINEDVP---EDIDSELSKR-LQLAESKCKDAESAVEVSRRRLADVAGRSGA
A2BNJ6_PROMS          DEIAISKRNIESEKM---RQENFDDNFL-NQL-NFQIDDLTLKHKLSRKKLSDAAGESGE
Q46EX0_METBF          RKAFVEIDSTKGNVEELKEKIEAENLRK-ESISSELSER-KTERMLLQSRIADVDAKFAA
D7EAF5_METEZ          RKTLVDIDDAKSKVEELESKINDEEIRK-ESINSELSER-KNELKLLQSKINDVDAKFAE
D1YW78_METPS          QKLFLETEKAKGQIEEYDGKIAEEEKRK-LSLTNELNFR-QASLDEVQKKISAIDEKFIG
A0B8B9_METTP          SQCFIEMDRVRAEIAAISEQLSDKAMRR-AGIQGELDDQ-RSQLSSLRANISDADSRFAK
D4GT30_HALVD          RKAFVDIDRKQEQIDDLEDDIREVKVEK-ASVKSDIQSK-RVELSEVQAEIDSVDTEFDE
A7IAD8_METB6          NRVFADTKRAEARVAELSDQIRTLSIDR-TNIAMEVATS-KAQVEKIETEIRQYSSDTEE
A3CWK7_METMJ          QRIYLDGKRAEAKVEECATQIRNLSIDR-ANLAMELATQ-RDEMKTVEERIASESKEVEG
B8GG37_METPE          NRVFMDIKRAEAKVTADTEGIRALTIDR-TTLAMEQAMI-RARIEKVEGSLGHQQAETGE
E1RII6_METP4          QRVFMDKKRAESRVQECSDSLRSMSIDR-SNLSMEVSGL-RADLEDVQAKLQKESSALEG
Q2FLH3_METHJ          SDVFTDVKRQEERIQALDTEMRNLMIDR-TNLSMTASAV-QKEFDRISQAIAQETKGLEE
A2SS75_METLZ          NRLYLDLQKNQNTLNDKIRESQTLQIDK-ANLAMELEAQ-KKTLEKAHELVSKCSRDSKG
D3RYW2_FERPA          IKVLSEVSKLKDEIDEILKELEKLSLQR-MSVEEEKEEI-ESRINLLKIKITQADEKYGK
O28714_ARCFU          VKIISEISKIKEEMESLDGELEEYAIKR-IQVGEIVDEL-AAKMELLRQRLEEVDKKHRE
D2RFP2_ARCPA          EKTLISLQRAEEEIKRINEELRDIDVKM-ESLENILNEK-ISYLNALKIKYDEITSRFRA
SMC_THEAC             AKYESERDSTDREIEDLDRQIEEKAKRK-RALEDRYADL--------KKRYDDLFSRAQA
Q97AI9_THEVO          AIDDARREKYEAEAEEIRKSLESERRER-DKLQEEFIAA--------EDEYNKLVAEAQE
SMC_METVO             ESKNNDLNETKEKINNIRIDTLKKEAEA-KVLIKEIEKL-NEERQNLEKKVEQSESQVKA
A6UQ42_METVS          ELKSKDLIETRNKIENIRIQTLEKESEI-NNLKTEIGNF-ELEKGKLKSKVEESETQTEI
A6UVP1_META3          ETKKNELLETKGKIESIRKETMDKEKEI-NDIIKTIKQL-EGERSSLKSSMEKSETHINI
SMC_METJA             ENKKKEIKETQKKIIENRDSIIEKEQQI-KEIEEKIKNL-NYEKERLKEAIAESESIIKH
C9RFQ3_METVM          ENKKREIEETKQKIIENRDLIIKKEEKI-KEIEEQIKNL-NYEKERLKTTINESENTIKY
D5VT24_METIM          EKLLNEKEKLREEIKLNEEAIEKNREKI-KEIVKSSDML-RKEYLKINLSLKELEEGINK
D3SQ87_THEAH          TTLERQLEHLKHDADRLRIEKEDLAHQL-IQREEELTED-EVMLEELQKTLQEKESFLKA
D3DG53_HYDTT          LRSESHLRSLRANLETLLEEEKHINSLI-TQKERQISAK-EEEAKALYSALKSKEERLKV
SMC_AQUAE             KNLEELINNLLSDKENLEREVGTLQLEL-EKLKEEYKSL-KEVEREKLRELEEEEERLKI
B4U7R1_HYDS0          EDIEKKIDFLEKDLLSLEKELLGIEQEK-LSKEKEFYSI-EELIKEKEKELKSTEEKLNL
C0QSN8_PERMH          KELAREKEEKIKEVLSLEEQIKELKRKL-PEIKKELEKA-EAVLEEKNRKLKEIEIGGSR
B2V736_SULSY          KQLIQEKELIVKDILKLEEEIKTLEKQL-PDIEKELLEA-EKELEEKNKKLKEYEIFDSS
SMC_PYRFU             AKTKEELRKVLSEIEKSKGAITRWKKRR-DALINEIKKK-EEERNVLVVKLGEIDKTFGA
C5A612_THEGJ          SKAKEELRKVSEEIEKSKNAIVRWKKRR-EKLLAEIKEK-ETVRNGLIVRLGEIDRSYAV
D1CC09_THET1          EHLKAQKLQVLTEIHKLEAEIELLCKQK-RQVETELLTLEQGSRNSIGKK-QQIESSIAG
D3TAQ9_ACIB4          KDWNEQLSQIRQELKDKEEELRSLKERR-DAIR-KEYEDRAKELENKERNLGSANEKFRE
SMC_HALMS             TELEEELVEREEKIKALEDSLVELQTRN-EETV--NFEEVEEKIELLKERLELKTDQVDT
Q6L0R1_PICTO          KTAEEALAFSEKNMKKQIDERDSKLKRL-SIIE-SNVSKAAKELEHFREENLNRSKRLSE
C1A7M6_GEMAT          KENEAFGRRLREDRERAATDRTTLEQDL-RDAG-EALQERLTAEQTAREGVQRERSVLDQ
C9RN51_FIBSS          ERSEQKSQELSEEKARLEEEIAVLGSENDMDELNALLERERETLQVMRDKVDDLRTQSRE
D1B5Z0_THEAS          DSLLEALASAHEELRQATEQLASAQGEV--EALRSQEASSRGRLQDLEERVRSNQSRLER
                                                                                  

SMC_FUSNN             RAKKVRDLELEKQLASNEIENNE------KKLKSSQDEVENFKQELEEANKKLLANNKEK
E3H7H1_ILYPC          KKDKLMTLEVDRLKFINETENTS------RRMKSSFSKIETLKEEIEEYKTKISKNNLEI
D1AK68_SEBTE          LSSENRNSEIEKIKLNGELEDLE------KRINLAKARVNSILKEKEKILEDFDKISATI
SMC_CLOK1             LKEDKIQYFSNISKLRNHIISIK------KDGENIVEKIDKLKSSYESYSKAIIISSEKK
D8GS00_CLOLD          LKDDQIEYLSNISNLKNDISSAQ------KEIEDTLDKINNMKSSCESYVHSIKINASTK
Q97IA1_CLOAB          YKNDAIDIISTISQNNNEVVILK------KEIESNESKLESIKRAGEGYSKSLKINEVTK
A0Q0Y7_CLONN          TKAYQVELLSNISKQKNEITILK------NDINNLELKKEDAKSSVEAYSNSIKINNSTK
Q895M7_CLOTE          CKEDHIQYLSEISNLKNKMSLVE------NNIKSTKDKLINLKENYESCMNSIKINITTL
Q0SSA4_CLOPS          IKDEELELLKRVSLSKNKMTMLE------SELSNINEKLDSSKSKQVNYDNSLKINLATN
A6LSM4_CLOB8          LREGEFELLRSNSDMKNEITMLN------KDLSLREEKKETLNSSISFLENNIVINLATY
D9SLC7_CLOC7          AKVEASDLDVKIFDFTSEIAVIN------NEIENVKLKNQGILASMESNENTIAINTNTK
D7APA8_THEM3          AKEDIIEILNSIADVKGKLSLNN------SLKEEAISRQQNLRKHIEEIQNRIEKLDKEK
Q8R9W7_CALS4          AKADIIEILNQMAEATSKISLNK------SLKEESESKRENLISTKKALEQKLKALLLDK
D9TN88_THETC          AKEDIVDILNEIAENKNNLGTTE------LMKNNMVEKLNELNKTQEMLLGDINNKKEEI
C9YKI7_CLODR          LKESIIDILNKKQEFSNKLSTLN------ANKENMNIRDENINSEITELNKNIEIKSSEL
E3PS49_ACESD          NRNKILELMNEQSRLISRNEILS------ENINDLEKKMSSWQNDHQNILNQIEEVQKSI
B0S1M4_FINM2          KSEDLNRLQSIYTQHIIEKSSRD------AIEKERLKEISEIRKHKEESELKLNRLEEEL
Q3AC59_CARHZ          CKDEQFELNFREVSLRNEINFIS------DSLTRLTNDSLKIEKDIYELNREIGEIENTL
E4SF58_CALK2          KEAELIECISQIEKFNQKLNGIL------HLSGTLENRKEKIIEQTNAILNELEKLTVAQ
SMC_RHOBA             LQRDHLAAVRRVAEHEANRGRVA------QQMREAARALEEIARNSVTAEEGLKTALRDH
D2QWB0_PIRSD          KRDAHLAASRLAAQLAAHLESRQ------KQLEVLEQTTRDSLGQQEQLASALATLATDK
D5SU17_PLAL2          QEQQLRELERKTQQIESQLTQLA------AQTDSQQLALLMNEQQIEELREKLHHAQQKR
SMC_KORVE             RRSQIFQAVNAASNVRNRITQAE------ERIANLDREHGRVTGELSSATLQLESFGGQR
C1F1T5_ACIC5          GRRQAGQLLNQLNVVRNQSAQAE------ESLAALDREAARLEAEMATAKRDLENLGAER
Q01Y77_SOLUE          GRQVILRLLGEASTLKNQLAQID------EYLAGIDRETARATREEQVAAAEIERLDGAR
SMC_MYCPA             AVRAEADRREGLARLAGQVETMR------ARVESIDDSVARLSERIEAAAARAQQAKAEF
SMC_MYCTU             AVREEADRREGLARLAGQVETMR------ARVESIDESVARLSERIEDAAMRAQQTRAEF
SMC_MYCLE             AVRAEADRREGLALLAGQVETMR------ARIESIDDSVARLSERIEEVTARTQQILAEF
A4FMG9_SACEN          AVRAIADRREGAARLAGQVESMR------SKAGDTADEIERLSTALAEAEERAEVAERAA
C8XH72_NAKMY          ASRLIADRREGLAKLAGQVQAAR------SRLSAGSDEVQRLSAAVTEARDRAAQAQVEF
D7GEI0_PROFC          QLRAVADRREGLARLSGQVGSLN------SRLEAGAEEVDRLSQRRDEALARATEAEQAY
Q2J6Z3_FRACC          AARAASFRREEIARLAGQVEAAR------SRATSAENEIARTTEALDAARERETETSASR
A8L599_FRASN          AAKAASDRREGIARLGGRVEAAR------SRAGAAEADIVRMTEALDAARARDAETAGSR
C9Z3S1_STRSW          VARSIADRRESLARLNGQVNAAR------SRAASAQAEIDRLAAARDEAQERAVTAQEEY
D7CC86_STRBB          AARAIADRREGLARLQGQVNAAR------GRAGSARAEIDRLAVARDEARQRAAAAQEEY
B1VYX5_STRGG          AARAIADRREGLARLNGQVNAAR------GRAASAQAEIDRLAASRDEAQERAASAQEEY
E4NHH3_KITSK          AARAIADRREGLARLQGTAAAAR------TRAAAAEAETDRLATARDEALLRAEAARAEH
C7QGY1_CATAD          SVRAAADQRESLAKLEGRVGAMR------SKAAAADAEIGRLGAAAEDARSRAAGVQREY
A0LV82_ACIC1          ALRAAADRRETLARLAGQVAAQR------TRVAAGEEEIGRLAAAAAEARARADRAQQEF
A0JXV4_ARTS2          VLRAAADRREGLAKLAGQVGAAR------SRVEAAQAELGRLRESQTAGDERRRRAQSEF
A1R7H8_PAEAT          MLRAAADRREGLARLAGQVAAAR------SRAEAAEAERGRLRESLGAGDERRRKAQSEF
A6W7T9_KINRD          ALRAAADRREGLARLGGQVAART------SRVEAAEAELERLSGALADAEQRRARAQAEF
D1BJA3_SANKS          LVRGAADRREGVARLAGQVAAKQ------SRVDATRAEIDRLEDSLAEASTRQSGASSEL
C7NGM6_KYTSD          LAKAAADRREGLATLAGQVEVRR------SRVASAQTEIERLEADIAAGEQQAQAARDRL
B2GFM7_KOCRD          LVRQAADRRAGQARLAAAVTAAR------SGVGSAEADVDRVRREISDVVERAERARLET
E1VVN2_GLUAR          MLRAAADRREGMSRLASQVASAR------SRVDVTRAEIGRLQENAQTFDSDVELDQRSY
A5CQQ2_CLAM3          QSALVSRHDLEIAGLTGRAETAG------SRLAAVRGEVLRQQNALDAARARLAAAEAER
Q6AE90_LEIXX          QSALVSKHDLEISTLNGQAEAAA------QRLAAVRGEVLRQQNALDAATERREKARAEF
D1AB24_THECD          AARAAADRREALARLRGRLEALR------SKAQAGEAEIGRLSEARAEALRRAEAAQAEY
D6Y659_THEBD          AARAAAERREALAALRGQVESAR------SRARAADEEIGRLSRALEEARRRAEQARAEL
D7BMZ9_ARCHD          HNRAVADRRETIARIGGKIATVT------SKIEVLESERIRTTQAVTAAKERATSTENQI
D6ZIF1_MOBCV          LQRAQADRRETLERLRGAVATAA------SLAEDAVTNLNRMEEALQAATQRESACAEEL
C7R311_JONDD          QVAAHRHYEKKRDQLTADLAAHR------ALMDN-------IADDLATAQQSATEALAAL
D6ZV06_BIFLJ          LRKTAQERDAQIARLRELIAREE------SAVQLATSRAKDYASQRDLLTSQRDDAQQQL
Q7ZAJ9_COREF          QVRAIADRREGVVRLLAAEESLR------TRLQAADDEVERLGEQLAELAGRVLEVEGER
Q8NNW5_CORGL          QVRAISDRREGVVRLLASEESLR------TQHTSAEEEAERLSEQLEEFIGRILDVERER
Q84F13_CORDP          QVRAIADRREGIVRLLTLESQQR------EHIVAAEAELERLREAESDIAAQARSKDAEH
Q4JUZ1_CORJK          QVRAIADRREGVVRLLAQHEAAA------TQRDNAAAEVERLQENAAEQQETLGGLMEDI
C4LJD3_CORK4          ALRAIADRREGVARLDAAEDSAR------QRLEAANDDLQRATKAVDAVVPALAQAKSDV
D6Z8M0_SEGRD          QEQKLQQLRAQAAKASGQAASLA------GKSQALLAEADHARHASAEAHGRAERARADA
C8WGU5_EGGLE          LERAKRDGERAQEQARRELAETQ------EALTSGLAHVKLIEGHGKELELQLERAKTEA
C7MMZ7_CRYCD          ATRARRDALAQLEAARARQAQML------KQLAENEAAEEMLSTQTAQLTERLEAARRTA
C7N560_SLAHD          VQTRLRTCERDIEKKNAALVKMQ------ESAASATARRTMLTERRAEVLQDLERAKAEL
E1QVK5_OLSUV          LTADQRGAQRTSDQETLAYAKLK------DQISNAEVEDQMFESRLAQISDVAATAEEAL
C8W740_ATOPD          CTASERSARNTADKETLAYVKLE------EQIAHAQVEDQMFESRLTQITEALEIAHAAL
SMC_RHOPA             LTTQLAELTARRNQFEQSVRTHR------DRLARLDTEIKNVESEIDRLSAETSGAGDL-
A7IGT2_XANP2          KTAHFADLGARRSSLEQAVREIR------DRLVRNAAERASVEAEESRLK-QQAGTEAL-
B8EMM7_METSB          AQDSRALIEARRSGFETTLRDER------QRLARVEADLARVLDERAAFELQSDSSAES-
B8IQU0_METNO          AQQEAAEQQARQAALVLRLRDER------ARADRLAADRARLARDRAALPAGAPGLATL-
Q92RE8_RHIME          ITAERAEAQAARNQIERALRDLS------ERQARLARQLADQGRELDDLDGQMARLPDP-
A7HQY9_PARL1          LNQEIARLSAERTSLVRTVEAGR------QRIEKLERQLAEIARERETLSDAEEKKAQI-
D8JUP9_HYPDA          ITHRAAEARARLRSLEEALQERK------DLVTKITRQVASFDTQIADITANAPDRQQL-
E3I0B2_RHOVT          LTSKVAELRAERRQLEAQIAEHG------GRAGRFAQQEAELSRQLADLRARAEAASPV-
SMC_RHOS1             RTEDAARLSARHQSAQRMLVDSR------TTLARSEAEAARARETVEAAAEAQERAAETW
Q2W040_MAGSA          LMEEVAAADAERAAALRRLGECE------TRLGRMAERLGVAERQKAEIEGESIDRSDL-
D3P3X3_AZOS1          LTETVAADEARRAASQRQAAELE------TRAAGLAKRLAEQQAQRAALEAEIAARADL-
B6IR58_RHOCS          AMEGLAAEEAKRAALDRQVRELD------GRAETLRRRLEEQQATREALARDDTVGGDA-
Q2RPA2_RHORT          ATATLADLEARRAAQERGLREAI------ARGAKVVARLAELEGQIRAAEGEAIAPGAL-
SMC_CAUVN             LAARVAAEEAQGRAAAARLSEAE------ARANRTNRALEQARAERAAVGPEVDP--AAA
B0T003_CAUSK          VAARAAAEDARARAAAQRLAEAE------SRLARTVRALDQAKAERAAVGPVVDP--AAA
Q0AMJ6_MARMM          RASEAADKRAAIDSARRDLSRHE------ARLVQIEREIDGARSELDRVRGSTAL--AEL
E0TC69_PARBH          AQAQYTDAKAERSANVSRVEAAT------RAQQSAEAELARLRDDLAQFESDAAG--EDD
C6XRC2_HIRBI          LAAKLATAQAEASSAKAALERAI------LKQNNLETEKQNALTSLADLGSSEKLEAQQ-
Q0C0X5_HYPNA          AQARLSEVRARRRAAEETAAQQA------RRKTQLTAEVDRLKNEMTGLEDAAIHVLRV-
Q1GQU3_SPHAL          ARAKAASEAADRRIAASARDSAE------AAVRRIAADKARIEAEIAALGDSAALAATH-
D4YX43_SPHJU          AMAKQAGEQAELRVAEAALAAAR------SRLDRASREAQRLEAEAAALPDATPLEGKR-
Q2G9S3_NOVAD          RVAEQAGIDAEWRVAEAAVSAAR------QRLARLDADATRLAQQAEALSREADPEAQI-
D5BSU5_PUNMI          ASALLRSAATSRNGLTTRLN---------DLLARRQKATQSLADLSLD------ALGAQT
A5FVJ2_ACICJ          ATEAAARAQAQRQAMETRLTQARGTAGQADRRAREAEAAHATAQAALVSPERLAAAEATR
C5B6I7_METEA          LVALQAQSDARRLDARRRVDEAG------VRARAAAQRLLTVRDALTALLARAEELDPAA
Q937L3_DEIRD          AAEAHARSDASLTTLRAELERAE-------------GNLETAQTRLDAAQEALTVAAAAR
Q1J060_DEIGD          AAEAAARAEASRETLGGELERAE-------------GNLEAALEALAAAQERLAAAAHAR
L0A7J5_DEIPD          ASERLARVDAQQSTLRAEFERVE-------------ETLEQARLAREEARMALETAHMWC
D7BH70_MEISD          RYEAYLKAQATYEAQRTAFLQAQ-------------RERERLEAEQAQLSQRLAEATQHR
SMC_THASP             ARRELAQTEQQLRVEETKRASAL------RALEALQQRRGRLEGERGGI---VGPDERVL
A1K715_AZOSB          ARRELAQTEQQLRVEEANRASAQ------RALDALQQRRARLEGERGNI---QGPDERDL
C7RKG8_ACCPU          QRAEIAQAEQRLQVEQANRGHAQ------RSLQIIGGRRERLALERQAM---PIPDDVEF
Q3SJI0_THIDA          AQRTVTQLDQSRQVDENSLGHTR------RQIEQLDARQRRLAQEHAQL---PRADAGGL
SMC_DELAS             QRASVVQVQQQIQVLAAEQRSLD------EQRRQFETRFERLRADRNAL---ETPDEARL
D6CTE6_THIA3          ERAQAAAAQQALQAEAARQRGLG------QQIQQLQQRAERLRAEQRAV---VALDSLRL
SMC_BORPD             MRSSLARVEQNLALAAQTQRDAD------RQLQNLEQRRERLQQELREL---HAPDPVRL
SMC_BURP1             ERGRIAQTEQALKLEAAHQRNAD------QQLQQLQQRHERLKVEAGGL---DAPDEAQL
A4SYV7_POLAQ          ARESLASIEQRLASLGERIRAMS------AQADELKGREARLTGELDGM---RRPDADAL
D5CRW3_SIDLE          MQREQMLIQQQLQIAETQRGHVQ------GNVQQLDSRRSRLMLERDNL---PQVDAGLL
D9SGR3_GALCS          LQREQVKLQQQLSGGE--HGNLA------RNIAQLEAREARLTGEAGSL---PLPDLPAL
Q2YBB9_NITMU          VQRDLLLAEQSEQLEKSHRDHAE------KALQQLEMRRKRLLVEYAAL---PESKVEEL
Q0AE88_NITEC          LREKLALARQNEKLQQNQQAYAE------KTLQQLIMRHERLLEEQLSQ---PEIDPVQL
D7DI79_METV0          SQAALTHAEQRLKLEQANIGHIA------RTITETNEHLQRLQQNLNGI---QFPADEVL
C1D4R7_LARHH          LTDRLAELTRRRDLARQQAEHGA------RALRALAERRGRLADEAAVL---DLPAPGEL
Q7NR76_CHRVO          LVAQQANLTRERDLSRQKIEHWQ------RGMQQLDGRDAALTRELSDL---NLPEHQAL
A1KSF4_NEIMF          QQDEANRIRRELALKQQQLAHAE------QTVAKHEERKGRLKQENQAL---NLPDEAET
A1WY82_HALHL          VRSEQTAAQRREEVERTRHDAAA------RRVRELDERIEALDDEHESV--DLHALESAI
Q0AAV4_ALKEH          FQRERAEAERAEQVEKVRVEGLE------RRADELARRLERLEVEYEAE--DLYALEQAI
SMC_XANOR             HNRDTGEASRAGEVERTRVDYLD------RQALEADRRREALVNERAGL--DLDALAEAF
B8GTL2_THISH          FNQRAVEPAQTAQVERTRMEGLE------RQIQQHQSRLERLQQERGQL--SGDALRAEM
Q3JAH9_NITOC          FNQRAAEPTQRAQVERSRQQQLT------RQQEQLQQRRVRLEEEARQL--LEGDDANLL
D3RSW0_ALLVD          FNAEAARPSEQAQLERARLTALE------QAQGRERERRRRIEEERARL--DASDVSARL
B3PGR0_CELJU          FNQRAAEPRQRAEVQQSRIQHLE------QVQQRLLQRIEKLREEKNSL--QSDGEDEAI
A6V7X5_PSEA7          FNQQSAEPRRQAEVQQSRIQHLE------QSLERLQDRERRLQDERGQL--AADPEDAAI
Q0VR03_ALCBS          FNGKSGESRRQAEVEQSRIQHLD------KSQERLRDRIDRLKKEQESL--DAGPLAQEM
C7RBE2_KANKD          FNQQAHANAQKTEVEKTRIQHLE------SHIARYTKRLEDIRAEINQQ--ESSPMENDL
Q2SD45_HAHCH          FSRSSAHLQKTAEVEQSRIQQAE------KLVQQLLERKRKLADEQSLI--GGAYDDEDL
E4PL89_MARAH          FSARSSDARRQAELAQSRIRSLE------DAIEQLLARQRKLQDEQELL--EGQMDRAEL
E1V8E9_HALED          FGERWQEDSREAERAQDRLREQE------SRLERIEDDTRKRRQQREELP-DLAALEAQR
D3SAL9_THISK          WERALAEPRQNAQLARSRMDHAE------HQLARLAQRRERLDAERAALP-QTHP-GEEA
SMC_METCA             LAGDRHRLEGQAALQRSRLQQLR------EHGQQLGGRRQRLLQQQSEL--EKALAALDV
SMC_COXBU             FQAETSQTMSQLEVMRTKREHCE------RQLTDLEKSKQQLQQNLKQL--QLDQLLNEI
Q5WTI1_LEGPL          VQTKSNTIKNQYQLTQAKLQHLE------QKRHQVLVRLEKLNLEQSAI--LLDDLQKNK
Q12L80_SHEDO          CQETLANAKMAHAVENAKREHTQ------KNLLHAEHKLTELANELETL--QAIDNSDAR
Q080K7_SHEFN          YAEILATHKMQLALSQSTLSHQQ------QSLVQNEQYLAQLQTELAAL--AQQDNQQQL
A4Y804_SHEPC          QAAIVSQHQLQLELRRSQLVHQE------QLLQHKQQQHDEQQTELNAL--ACIDLEDKV
D4ZIY3_SHEVD          HKEKVSSYRLAYEVSRGKLSHQG------IMLEQTRAQLSSIEQDAAGL--LKQEDVKIG
B0TKB4_SHEHH          LNEAHTQAHLAFEMNRNQLSHAE------TDISNKHKLVARLEDQALQT--ASDLELLKS
A3QFJ7_SHELP          AKQAVNQCQLRLELTKGELKHKQ------SALAQVKSQHQSASRQLEQL--SHQDETDNL
A1S5R5_SHEAM          AERRHGETKARCELTSQRLVHLK------QVSQEKAQSLSGYREQQASQ--GDEDVDPVT
Q5QUJ9_IDILO          QQQQQRDVEKQQQQAQLKLQQLK------QSQQYALQQVEQFHSQQQEL--QQQEQALSV
E1SMV2_FERBD          ARDAQAQAQRAAQVAQTELAGLA------RESQQMATSAQRLAEQLAQW--NPQLLESEL
F2GBA5_ALTMD          QEQTYNQLRQNVQQCHSQIQSTM------SMQLRTSQRISELNDELTQL--DDEDYAFQI
Q15UZ3_PSEA6          QEQTFQKYKQQAQRYHSQIQSIL------AMQMRSEERISEITSEINSL--KTDEFATQI
Q3IKC0_PSET1          LSEQLQQLNNKLQMQANNIEQTQ------QQSKHVNEQSEQLNKQITHL--KSSDVEQQL
A4SKA4_AERS4          WQQQLGQLRGQLNQTRAQVNGLQ------ELQAKTRLARIKLEDERAGP--LGGEGE---
D0KWM8_HALNC          SHDDLARPQQDLAAAKAEHAALL------RQLQRLETERASVTS-RDFTE-PMAASIQQI
A0A2W1K6W8_ACIFR      QQQALAEMRRKRDVTMAQIRELE------PRLEDIERRLQRQ------SA-NIPSERAAM
A0A0J1A050_ACIBA      VKAQVEKQQQQKMQMSAQIEQLG------KNVQRIEQQKETLQHQANQI--QSQVHEDEQ
B3E294_GEOLS          KRRELFSATGEATHCRTRHEQAQ------KRLVMLAERLERHTREEAQLIEKQAENAASH
A1AU91_PELPD          RRRELFAALAESAQFKNRAEGAR------KRLAALGERLERQAREGIQLAERLELASRNV
B9M6F0_GEODF          ARNGLFQVLSNNAQLNNKLAADV------KRLELLVEKYERNQREIIKLQEQREEAFQAV
Q39WG2_GEOMG          VRRELFSLLAEVAQLNNQRTAAT------RRLEGLAERVERNRREGLLLNERLVESSGRA
B5EFS9_GEOBB          ARRAMFAALSEGAQANNQHAAAV------KRLASVDERLQASKRERVLLGERLFESNGKV
Q3A212_PELCD          ARRNLYARMDELSRSRHALEDAR------RRLQGLDERRGQQRRESVQLQENRVIAAETV
A9FIZ2_SORC5          LRRRAAEATAAVAAAEASLAGFD------RRMAEMSQRRAKLEDELGRLMYESEELERRR
D0LY52_HALO1          ARNKLTQARAEQVRAESRREALG------RRRDETARRLERIMGDTETTSARVSQLEKES
Q1D2R5_MYXXD          ERAGLVAVATRLANHESNLVNLA------RQRGDLGARRAKLQGELETLRAQEQTLENVR
B4UDF6_ANASK          SRAAAAAALSEATSHRSQLAQIE------RQRLDLRGRIERNRAEADDLAKRAGQLDEAR
Q6MNS9_BDEBA          KRRELFAVGQTESSLDARVNSLS------SQIADLTDRQDNEQQVLNELREKQVEFENRR
A9A0M3_DESOH          AKASLMRFTAEEARYHSSCQNVA------ENKEALKKRRAEIGNEKTTAARNATRLRNQA
B8FHS3_DESAL          EKSRLTQLLGNEAKYSNIYQNAA------NTKQDIARRLRQLSEEVVRAGQREQETKRAL
E1QL74_DESB2          AKHRLVDHLSRRGQINNRLGDLE------RRQAEIRRRQEQLAIRRGELEDELAQAEDDL
B3EFQ6_CHLL2          TRKEISEREKALNRLILEKNGLE------TRKQQLRSLVQRAESSRNAAMQKTEESTILR
A1BDT4_CHLPD          KRKKNTELEKTLNRLSFTRHSLE------TKIEHRKTTSDRLGQQKLEIARLLDQSSSDE
A4SG64_CHLPM          ERTKSAERQQAVNRLAIERQALE------AEQQHRENEQEKIRTKRQAAKARLETIASWK
SMC_CHLTE             ERRAVAELQKSLNALNLTRQSLR------TRKEHLEGSVNRLDQRKRDLERSMEQAEPER
Q3ATI3_CHLCH          QRQASSALLHKANQFILQKQALE------SEQQQLRAALLRLEERLTATRHKLQPTAQAA
B4S519_PROA2          IRSTINNADKQSAEHQIARHKIE------NSRDYLNTALCTMEQKTGTLQASVENNSAKQ
B3EM83_CHLPB          ERARISGLQKAASHLHVTRQRLE------TTIDHLKSSMASLDQHRNELLKNINDALPAR
B3QRZ4_CHLT3          KRRELAVISKKISEAKLRERSLE------GKIENIEENLARAAERKILLERNISERSAKK
D0MFL5_RHOM4          ARRLLQQAEQTLHEARRQLDRQS------NRRELLEQERERLDAEQKTLDAQLQTLETEQ
Q2S457_SALRD          RREAAEAAEAEHAEQRRALDQRT------NRQELLEDERTRARTQYDDLAETIDGLDARI
C7PLU2_CHIPD          QRRDQQQWQRQQFEAEKKVAVAD------TSVQNLQRSIQQLQEEKAGRLQQITQLEEEK
E4TVF1_MARTH          LNQQQKALQNEVYQLNKSLEIKE------IQLSSVKQELEKSSTDTTEQSASLEEFDAKL
B2KBE7_ELUMP          LNTNLMRAVQAEMELSNKIALEE------SSAAHEQQNLITLEKSGAGNNENLENLKKTL
B1H0P2_ENDTX          VRSRISELKSEKEQQLKLKTELA------EIKTRLDADIISLERMITMLENDVEFANREI
E4TEW8_CALNY          NRRRFLDITEKISKIRSNIIKHE------SEMNRLNKDISRLENEKSNILGEVSKIESLI
D3PDY1_DEFDS          LDEKYLGLADKLAEKRNLLIRYE------TELENYQKSIKAKDTEKSNFESELNTKKQFV
D4H2V6_DENA2          LDDQYLELAQRASDTRNAIFENE------TLLTRSEKDKERLRNEKEESEKDSQFARKNI
D6YSC9_WADCW          AQQERVQCLQEENKIESERKQTA------LRLEHHKEKIQRLQENQQMLKERLTHLHEQI
Q04TU9_LEPBJ          ----NVSVLEKESKIVSNDKVHN------ELREKLKEVIFELVSRLESRKK---------
E1R6H6_SEDSS          -----------------------------------------NEKTVLSLERQREDLQVKL
Q73ML2_TREDE          -----------------------------------------LEDDIKRLDDMRGDMELEL
A0A0H3BKB7_TREPS      -----------------------------------------IQGQMQEISAACVELEASL
E0RSK7_SPITD          -----------------------------------------SEGMIAELEREREHLHGEL
D5EMY0_CORAD          RKQEVLQAENRISRARSNCTTLE------VELKTYQVKHASLSETILGLNEELEVLERDL
B1ZZB8_OPITP          AKFQLLQIESSVARLRTDCSGYE------VDQKTSVHRHDMLAQELEGVRQQLAEATQVA
SMC_DESHY             LRGSLSHLQSKLAESTAELNRFT------HQLATLNSTHEQLVKEKKDKEAALFSHEQQE
A4J682_DESRM          LNTDLIEQLNRVANQRNIQNQAM------DRKEQLSHRREHIERVAQEVHDQGISLQSNI
Q67PF3_SYMTH          RKDRIVAILQLEAERRNGVQAAE------RAADEARRRLARLGEERKRAEADAAATRARS
B0TGW8_HELMI          LRRRLFDSAQALARLRTQLHEAD------LRVARQEAQVRRLEGERERSRSRASELVGEA
Q2RJX0_MOOTA          LKEDLFQVAHERAGCHNELVRLE------EKQAGMERVLEQKQRQLQELNNERERLEGLL
SMC_BACSU             LKSDYFELLNSQASIRNELQLLD------DQMSQSAVTLQRLADNNEKHLQERHDISARK
C5D8T7_GEOSW          LKSDYIELVHEQASLKNERSHLQ------TLLEKLQAKQIALAEENRKYLDERKYLEEQY
D5DQR5_BACMQ          MKSEYFELANAQTSARNEISFLE------QQKLQTFEKEQRLTKSNEQYVEQRRELTQRK
B7IUK7_BACC2          LKGDYIELLNQQASHRNELSMIE------EQSKQQTSKNERLDEENAKYVEMRMEITAKK
Q9KA07_BACHD          LKSDYIELLNEQASLRNETRYLE------EQLQQLQQKQERLIRENEAYFQKRKELEAQE
Q5WFM8_BACSK          AKGDYIEWLNEQASLRNERRYLE------EQLQQKQRNARRAESAAAASKKEAQQLEQEA
Q7ZAM6_OCEIH          LKSEYIDLLNQQAAKRNELQSVT------QQTEQIDQKSEHQSSKFKDLVTKREQFQSEK
D6XTT7_BACIE          LKSEYMEWMNARATDENNLQNQI------ASKNRLLGRIEQKRAQLRELDQESREALTEK
Q81ZN4_ENTFL          LRSQYVEVMQEQANTANDLKYLE------RQYQQETAKNQQSLAKHEALEEQMVEALAMK
A0A0E0UX46_LISMM      RKSDYIDLRHTQTTINNDLGYIE------RQIGQINSRIDKLDLENSHHVDDRKDMLSQI
B1HQH6_LYSSC          QKNRYIDSLNEEATIKNELKNID------QQLAQQKAMATRMSDQTDEIGQELMQIIAEK
C6D303_PAESJ          LKGELLEVLSTMAQLRNEIRYAA------QQQEAVQRRMERLSDEEAKWTEQQRKLNARR
C0ZFN9_BREBN          LKSDYFEKLNEMANLRNENRHQE------QLLKTSEARVERQLSGKKQLDDEEEQRLAQL
C8WWA4_ALIAD          LSGELIDANHRAAALRNEWKTLE------EKFQAGALRHERFEEEAARIEAERDRVEAGK
D5WPA2_KYRT2          YKAELIERLNQAAAARNEERHRR------EALEMAARRRDRLMEESAERGREAQDLKVKL
C4L5Z7_EXISA          LQSEAFELATTKATIGNQQKREQ------RDIDVAVESKERLLRENKHRLEDRSSQEAAL
B1YIN0_EXIS2          LRSEAFEVASRLAATTNAYHRAQ------QDLLHAEEQQRSFSENVGSKQTDRSTYEAET
D3R1B0_MAGIU          LRQQAGHLQEEFYACKTLAADAN------AELKAFEALRERRQNEQDDLNKQLNQLTADG
D2RLB2_ACIFV          YQEQAFDSMRTLVMTRNKLAGIR------QEQERLHRQQEQLKEKVREAEEGLEGVTGAL
D1BLY1_VEIPT          LQSNREAFEKRQLEVVSAIETAK------ASIRSLEARKGESKNQCAILESEIAQVDSEL
A5UQ60_ROSS1          ARRSLMEIGAALGAVQRQIAQIN------DQRDRLIRERATAGEALAIAQDELVARRAAA
B8G556_CHLAD          AQERALQAARAEATVVSQIEQLL------TQQARLRTELERLATSLTQATGATDTARIAV
A9B100_HERA2          AQEAALQATRTLNEAQQRAKLQQ------ERWQALANELTTNQQQLAASQTRIQQAQTTL
D1C6T1_SPHTD          AEQAITEAERAALAAASRRDLLD------QQERDLLATRERLEREQRARAARLAELEAQA
D7CMX2_SYNLT          LRTELIEKLKEETEDKNQLTVLQ------ERLKRLEDRLERCQEDLKQKEAHEKELEQAE
Q0AYV7_SYNWW          KKALVFDKMKQESQLKNELAEKA------ELLSQAREKKERLKIHIEELAAKLLKGRKGH
SMC_LACPL             AYI--DEKQVQAELNNEAKNLVK-------QHQQSGSQSTALAERLAQAQANLKRVQTTV
Q03RT7_LACBA          AYF--DQKQQVANWRNQRQYRQQ-------DQQRLQQQGQRVAQQLTQLQATAQSAQTAV
B2GD41_LACF3          KQV--DLMQEQTTIQNNQLFLKR-------DHQRNQSQQEAGAAALSEAKQKLAELTKAA
A5VKP1_LACRD          QQV--SLMQERTTIHNQQSFLSR-------NHEQAMSLQRQNVEELDATKNQLAEINQEF
Q03FW9_PEDPA          EYV--DQLQALTSLKNQYNFNQQ-------DRERDQQQRQKIQLTMDTLNEQIKQRKTEC
A0A249N2C3_LACRH      HYI--DLLKAQADNKNAQAALQK-------DQQLAASQNAAHDRRIYELSKQAQDQEAKV
Q38XR7_LACSS          DYI--DQMQAQTTNRNEQQYLEK-------ALLQTKTQLTRQDSSISETSAQLTQMQADK
Q1WU99_LACS1          ELN--RKIQEKNLVNNSNNYIEQ-------ELEEKSQNQAETNKNIQNITNEKNKLKLQL
Q04GL1_OENOB          NYV--QSMQDAASLSNQLINLDK-------EKLRYDARKKSLSTLSQQLKEKLSEKRAAL
Q03VW6_LEUMM          HYI--QTMQDIATLHNTQKNDEK-------LLQQLESRQKVLSVRLDNENKELTAIQRTF
A0A0U5K8Z4_LACDE      QYI--QTLQDQTSVNNQLVYLEG-------EIKRAKESK---DQRYEDASSQLAKSQEEL
E4SKB3_LACAR          DYI--QLLQDQATTNNQIVNLNT-------ELKRSKADT---SYQNSDVSKQLSEAKTEL
Q74IP9_LACJO          DYI--QTLQDQTSNNNEIVYLKN-------ELTRSKKSN---DNRQQEVEEQLDEAQKVL
A0A0T8KIP4_STREE      RFV--ALLQEEADVSNQLTRIEN-------ELENSRQLSQKQADQLEKLKEQLATAKEKA
A4VVL7_STRSY          QYV--ALMQEEAEASNSLTKIQQ-------DIANQISLSESKSEDLARLQTEKQTAQEVL
C0MCR5_STRS7          DFV--GLLQQEADVSNQLTAIVA-------QLDKESQAKASQAQEYQVLQEKVNQLSQDT
A2RLZ7_LACLM          EFV--QLVEEEAQISNEIVRNKA-------EITDLSRRQSEQDESVRENLTKFEKISQDL
B9EBB4_MACCJ          EYY--EQFTMKTKLENDIQHMNS-------RIEQFNR--KEETQVDESTMTQYEDLLSEQ
SMC_MYCHR             -------------------------------------------------KTKIEEIKKQV
E0TKT8_MYCHH          -------------------------------------------------KTKIEEIKKQV
Q4A770_MYCH7          -------------------------------------------------EQKMAALRQKY
C5J708_MYCCR          -------------------------------------------------EQKIAALKREY
A5IYM7_MYCAP          -------------------------------------------------TEQINAYKTLI
D5E4P4_MYCCM          -------------------------------------------------HEQIESLKSLL
Q6KHN4_MYCMO          -------------------------------------------------SEKNEAMKQQL
Q98PK8_MYCPU          -------------------------------------------------EEKMKVIKEQL
D1J8Q8_MYCHP          -------------------------------------------------KEKLAAMKEEL
Q4A588_MYCS5          -------------------------------------------------EEIKSANLSKA
SMC_MYCGE             -------------------------------------------------KQKAAALKKLI
SMC_MYCPN             -------------------------------------------------KHKIQALKKLI
Q7NBU0_MYCGA          -------------------------------------------------NKKINALEQLL
Q8EVS6_MYCPE          -------------------------------------------------ESRINAIETSI
Q9PR04_UREPA          -------------------------------------------------QERIDAFATLI
Q6F1N4_MESFL          -------------------------------------------------DIKARAIKKEF
Q6MTD2_MYCMS          -------------------------------------------------EYKAALIKKQF
E3GP81_9FIRM          VSLREEREQQRAVLNDTLLDLKT-------RLAGFTTKKSFHEDQLKRVSAEQERSSQLL
SMC_HALOH             LRNNILDGNVELKDISSQFEQLK------ERGRHLEEEIKRIKTTRDKISSEYDALNERE
E4RL35_HALHG          KKEKIENFKKQIQSNNSLLERLG------ERVEISEQRLAEISEQKSALERKIAAKTEQK
D9QRN7_ACEAZ          AEEDKLEYLNRINKKQNQVTNLT------RQIKDIKEEKKEKQEEITEIEANIAAAKTEL
A8MHB7_ALKOO          YKTFILDTINEISDLKSEIKGLK------TLMTTMEERNRQVSDERSEYEQRISERAKQL
A6TRT3_ALKMQ          SKSMIIDMLNQISEKKSELNSLK------TLKKTIDDRKVQVQQTGQAHQENAIENQNMI
A3DDY2_HUNT2          LKTEIMEMLDIQSDKKTQINNIK------NHIEGIKKRQANIDKEVYQLTLEKDKECMKK
D5X8N2_THEPJ          AKGEIIDTLNETAALNNRLHALE------AEEKSLQKRREQLVTLIKDVSADRQQILATL
D9R048_CLOSW          GKGSIIEILNEKASLSAKQQRYE------TMLEQVNVRRSEVCQKLLKFKSDESEQDEQL
C4Z0E6_EUBE2          RQNDIYDRLNAKSSINAENQKFA------TMLEQLNIRKAELNSHLIKDKSDEAEQNIKI
C4Z924_AGARV          GKNELIALLQERGSIQSRQQRFA------TMLEQINIRKAELTKRLLDRKTREAGLDDIL
E0RV40_BUTPB          CKNTIIETLGTRATIKSKLSSLE------TMKEQVNIRKAELTSKLVRARSDESRQEEII
A9KLR0_LACP7          CNNEIFRILNENSNIKTNLQRYE------TINEQNSIKKAEINQKILKIKSEESSLSIRL
D9S347_THEOJ          LKGDVIDLLNSASEIKNMITSLR------TMKDNLQKRIAQIDKELSQIDEANSLTSREL
B2A2N3_NATTJ          AKASLIEVISHRQRKETEYDNYY------KEQTRLKKELDELKTEVKKLQSRQEELDNKI
A8F8R1_PSELT          LKEKSDLIQKKKLSLENELSRIE------DALEDISKRISMVDTQLNLKSQRLYGLQQEL
A5IN04_THEP1          VRDEISRLEKQILKLESELLRIG------ETLEDLEKRRKITENQILTRRRELEDKKSEF
C5CIS4_KOSOT          LQEELDSVVKRMSKIENELERLS------NVREDTQKRLNLIGSQLQSKGERLEDLKKEI
A7HMD4_FERNB          KKQEYEEIEKNLSKIHNEIIRLN------ENNQDIKHRLEMIQSQRVNKEDRKQELEDEI
B7IHN5_THEAB          KKNEYDEIEKNLNKLENEKKSLT------ESIIDLTERLKMVEEQLETKLERSKELNEEI
SMC_THEEB             WFQEHSQRRQRIDALIHELEPSR------TELSRLQERSQQLRQRQGELHQAATALEGQQ
Q2JHS4_SYNJB          WVKQQRYLTRHIEELRAEQEPLQ------QEQIRLQERQRQLERQSQEIQAEIAQIEAWL
SMC_SYNP6             WVTRQTSLRQQADAIAAQVEPQR------AEQAQLQERQTQLQQQLEATQSALVTVTAEL
B0C9C4_ACAM1          WIEQQSHLNQQIKTVLQALEPQR------AEQAQLQERVQQLDRQSDLQQQSVEQIAQEV
Q115J3_TRIEI          WVKEQGQLHHQIESLQQTLNPQR------TEQARVRERAYQLEKQIQEQQESLGVLGEEI
B2J925_NOSP7          WVQQQTAFNRQIETLLQTLEPQR------TEKAQLTERNNQLQQLISEQTQLIERDEPLL
E0UKI1_GLOV7          WVQEQTALTHQIAQLQDTLNPYR------TEQAQLQERYQRLEKNIDEQTQRQQSTESEL
B7K4Q6_RIPO1          WVQEQSALSRKITAIQDTLNPQR------TQQAKLNERRQQLNKTIDNETQQLQEIETEL
B0JSN6_MICAN          WVKEQSDLSRNITRLQEQLNPYR------SQRAQLTERCDRLQTNIVEAGQRLQELEQVI
SMC_SYNY3             WVQEQTQLSRTVNQLQDELIPQR------SQLAQLEERQQQLLTNLAELTPLLTKVSVEL
Q84EC7_SYNP2          WVQEQAAIAKEIQGIQDQLNPQR------TEQALLQERLSQLQHNITSQTEQITQLSTDI
D3EQ04_ATETH          WIQEQAGLSIEASSLQSELNPQL------AQKAKLSERQQLILGSLNKEKEQFEKYEKDL
SMC_GLOVI             WVEEQSQLRRRLDQLQSEHDPLQ------RTLDRLGDRLVQATGEGERHREELARIEAGH
A5GQT1_SYNR3          WMEEQQERSRRRQELQALLGPQQ------AEAVQLDERLRQEQERQQELQAELDREQQGN
A9B9B9_PROM4          LVEEHRDRNFARQNLHSQLKPLQ------HEQQKLEERLLQITERLDELAVDQTKDSCED
A2BNJ6_PROMS          FSKQSIKLNAELESIKNQINPLE------IKKRKLEEETIQNNIQKDEILSQIESLDLEK
Q46EX0_METBF          TRDELMAARKKLEDAKNEKNELI------RTEDRLLDTLRRKSLELREIENQIKDAEAAV
D7EAF5_METEZ          TRDKLSELKNEREQIKNEKSELI------REENRLLDAVRRKSAEKRDIENEIQDSKEKI
D1YW78_METPS          VRTRLVEVKAALEASRNLRNEKL------REKDRILDAARRKQDEEQDASTEITSSRSRI
A0B8B9_METTP          YREELAQLIKEIEDTRSQIGERL------RERDRLLDAIRRASMEKEEIATEITEALSSI
D4GT30_HALVD          LKSELAERKETLDELKDEKNDRQ------RAKDRLLDDARRRSNQISETRDELERARERI
A7IAD8_METB6          ARQQLFALMEEAEAKKGDRSAIL------RQQDILIEKSRMRTSELERLTVLQKQLDEEY
A3CWK7_METMJ          VKDQLFERMEDLESKKELRSKIL------REQDIFIEKSRMRTSERERLDARIAQIEEEL
B8GG37_METPE          ARERLFGLISSLEEKKGERSTLL------HQKDMLIEKSRMRTKEQDRLSQRLTEVRNER
E1RII6_METP4          AKEKLFELMDGLEKKKGERSEFL------NQQDVLIEKSRMRTDEKERLSSRIALIDQEF
Q2FLH3_METHJ          EEARLENLRSEIHKIREERGELL------HQQDILIERSRMRSAEEDRLTSRIIAIDKDI
A2SS75_METLZ          AQAELVDLMRQVEEKKEVRGSIV------VQRDGIIERSRVRAQELEKLQREQGSLAEER
D3RYW2_FERPA          LRDEFLRKREELEKLKSKLNEVI------RERDVILESLRKLDMFSAELSAEKEAAEKEI
O28714_ARCFU          LRDRLVSRKEELEMYKERRGEIL------RERDKLIELLRRIDMDVEDIKNEIASIESKL
D2RFP2_ARCPA          QREELESKLNLLNELKEKRTSLL------KEREKILEGLRRIGMEIDDMELSRE--KIDL
SMC_THEAC             EAVDAAETRRKSKEYQEKIDGLG------REIEELKAAGSQMNADLAVLLQKKAALEERK
Q97AI9_THEVO          KEKENATSRVKTKDYQVKISKLN------DEINSLKEKLAEINMAIKGKIDRITELEERM
SMC_METVO             LKNQESKLSERINDTQKELYGLK------NELNQLENTLNNRTFDYQKNNETIENLTNQI
A6UQ42_METVS          LKQQERKLSEKINEFQNEFYSLK------SEMNTLENEINKKSFGLNKNEEIIQSLKNEL
A6UVP1_META3          LNQQERKLSERLNGYQKELHELR------TEMNKINNKINNKNFEINKNNEIIRQLKEEL
SMC_METJA             LKESEMEIADEIAKNQNELYRLK------KELNDLDNLINRKNFEIEKNNEMIKKLKEEL
C9RFQ3_METVM          LKKMEMELTDEISKNQNELYSLR------KKLNDLDNILNRKNFEIEKNTETINKLKEEL
D5VT24_METIM          LREEKENLEKEIEKKREKLLKIK------EKLNLIRTEIYKKELEIKNNLAKIEELKKEM
D3SQ87_THEAH          SFGELESVEERIKKLEGTLRHKK------DQLSQLEIKIKDIQLRIERLEEELQNTEREL
D3DG53_HYDTT          SLEEAQATQEKISIIRKDLDSKK------RLLSSIDIKLREMDLKRERIMEEMQRLREEK
SMC_AQUAE             TFDEVKKLEEEKEKLTEKLNSLN------KEKQELEIQRANLKNKIERIKEDINKLISER
B4U7R1_HYDS0          SPEEIEQIEKKEKELKSILEQKK------KQYQQYIDQIQDISQKQNRYKDDIQRLKADL
C0QSN8_PERMH          AKLDLGEVEKEEKSLKDRQSSLQ------KEKIHIEMEINRILEKIEEYHNEIRSLSEEV
B2V736_SULSY          VKNDLGEIERQEKELLDKIKELE------KQKVEYQLKYTTTVEKSENYKKEIENLKQEI
SMC_PYRFU             AREEFDSVVKELEETTRKMYEIE------GNIRRLQEEKEKLHSRILFLRAKLPGIKEKI
C5A612_THEGJ          AREDFDRVVKELEEAKKEMYTRE------AELEKFREEIERQRSLITRANLRRNALKESI
D1CC09_THET1          FEQELSELQREIASKKRLVEILT------EEISNLENEIEIHTSERLSIQARSEEIQTKR
D3TAQ9_ACIB4          LQRRALEIQEELKKLRNEYATKVE------EENKVLGNISRIKGDIAAKEESMKDIEAAI
SMC_HALMS             LKEEIELKKSELNTLSQAAFQNT------SKLEEYAANLQDITEEIEALEKQYSGVSTQI
Q6L0R1_PICTO          LNLKLKSIDEKIKIKSDEIGSIN------ERKSDYINKKSSLLKESSILEEELKNLRLKE
C1A7M6_GEMAT          LERQVREHRDQARRLELDRDSAA------REQTETEQRRDALELERQTLADTLDTIEREL
C9RN51_FIBSS          LSNARLQATNRVNSLRGRFERMD------AEVNMLQSNIAKWQTEIEGLDKQKSDAEANI
D1B5Z0_THEAS          IRQEEARAKEALSSSMASLKALG------VQRLDALKGLRGLESALEEARGRLMQERARL
                                                                                  

SMC_FUSNN             DLVHSQLEARKEELTKTEERNEFLVNQ-----------LSEISKSINKLSQDIREF----
E3H7H1_ILYPC          EKSGKEHGEKEKEYKGIDGKTQAMEEK-----------ITQVSLDMNKVHSQMRET----
D1AK68_SEBTE          KKYEEASSKNSENLEEKKQKLKINSEK-----------LQEIQKNKDLILKKLNEL----
SMC_CLOK1             NKLLGEISNIKKNISVYQNKIDENNSG-----------ILELTNVLNLKENSLQKL----
D8GS00_CLOLD          DMLVSKVSSIKKLISEYQDKVKENKRK-----------ISKFNTNLVLEEKNLKEL----
Q97IA1_CLOAB          NTLSEELVKINDKISGYENQIRENRSK-----------ISKLNRIISDEEKLNREL----
A0Q0Y7_CLONN          EVLKKEVAKIDNKIQSYKDQIKQCAKE-----------MSLKRRELSIAENKFKEN----
Q895M7_CLOTE          EALKDKVEVRNITKENHQNKIKENKKE-----------ISKINSILNRKNKEVKDL----
Q0SSA4_CLOPS          LNLQKELQIIEEEKKDKERELREKEEE-----------FREGLKIIKETQGKLNQI----
A6LSM4_CLOB8          KDLTNESEKNKDNIKLLNMQIVEHKKK-----------IGSLSANLTKKENELREL----
D9SLC7_CLOC7          LALLKETEELKKKSLELEDQSFESKKN-----------LSRLSRNLTIEEKDLKEL----
D7APA8_THEM3          NKIVEELQILQKELDKKNQQKITEQQA-----------LQKIENEIILKENNLKII----
Q8R9W7_CALS4          KESEGKLTELQKGLFKLEKAKEDLEEK-----------LKRLEEAFKLKERLLKEL----
D9TN88_THETC          FKISSNIQSLKDEIKKLYSEKNSVETD-----------LNALENEIKIRNEEYGRM----
C9YKI7_CLODR          DTINKEFNMQNENLKNVNNRHKELSIN-----------LQDSISEHNKLEDEIQKS----
E3PS49_ACESD          IENETKIKLTVNQIEKLDEEKSLLSLR-----------ITENTNKIEALKSQNNKN----
B0S1M4_FINM2          RNYETIISDFDKSLRDLNNDKERISSI-----------IKEKEKYLLNLRDKLSSL----
Q3AC59_CARHZ          RSLNDFKKENLRKREVLKNKRKKLEEE-----------LNLLAKNILILQNEKRVL----
E4SF58_CALK2          DTKKSKLKELDNEKKKLIILLEDLNQQ-----------VSEKESHLANIRSLVEDL----
SMC_RHOBA             DEVARNVSELEKRITDAQREVEIADAK-----------VCETRRVLERRREEIGS-----
D2QWB0_PIRSD          QQTQQAIIERTAAVQSSEASLAEARAN-----------LAQVRDQQTTHSQELAK-----
D5SU17_PLAL2          TVLHAEMNLASTHHAQTLEHLKSVQSQ-----------RFQLIGTQDSARERLSS-----
SMC_KORVE             GQLGLEFESANTRVNALSSEITDARGS-----------LQQKRQEEIEAKRHVDT-----
C1F1T5_ACIC5          GQLSMRFESITETLQRLEQEIGAARAE-----------IAQKRTEEMEARRKGDQ-----
Q01Y77_SOLUE          KQLSETVAQRQMELESVTGERKRTEEE-----------LVDRRRLAGELRREIDG-----
SMC_MYCPA             ETVQGRVGELDQGEVGLDEHHERTVAA-----------LRLADERVAELQAAERD-----
SMC_MYCTU             ETVQGRIGELDQGEVGLDEHHERTVAA-----------LRLADERVAELQSAERA-----
SMC_MYCLE             ETVQGRVGELDQSEVHLDEQHERAVAA-----------LRFANERVAELQSAERD-----
A4FMG9_SACEN          ADAEEESDGYDSDDAGLEDRRATSAEA-----------RDAARARVEELVRAERA-----
C8XH72_NAKMY          TRAQDTVGDLDSSEVGLDEAHEMATAE-----------LEVARTAAAELTDHLRH-----
D7GEI0_PROFC          LALEGRITGLGDGESDLDANYERAAHE-----------LAAAKETLAAGDQHREQ-----
Q2J6Z3_FRACC          SALEIELSRMESAREDLAEQHSAAVAV-----------HAAAAERLEVLRGEERS-----
A8L599_FRASN          SALDTELARIETARDEVAQRHSEAVAV-----------HEAASERLEALRDAERA-----
C9Z3S1_STRSW          EALKAEVDGLDADDSELAGRHEAAKRA-----------LAESESALTAAREATTA-----
D7CC86_STRBB          EQLQAEVDGLDAGDAELAERHEAAKRE-----------LSEAETAHRAAREALTA-----
B1VYX5_STRGG          EQLKAEVEGLDGADEELTARHEEAERA-----------LAADRAAHSAAREEATA-----
E4NHH3_KITSK          QHLSERGAEFTADEQEAEERHDRARAA-----------HRDAERAASTARDALAA-----
C7QGY1_CATAD          DELKAEVESLETDGGGLDDEVEQASQA-----------LSESEEKLTELRAAERE-----
A0LV82_ACIC1          QALESQIAGLDEGEVGLDADYERAAEA-----------LTAAEERLAALRERERE-----
A0JXV4_ARTS2          TALESQVAGVEDGEESLDADYEDASAS-----------LDAILADIEALKSAERE-----
A1R7H8_PAEAT          TALETQVAGVEDGEESLDADYENANEV-----------LDAVLAEIEELKASERE-----
A6W7T9_KINRD          AALETQVAGVEEGEEGLDAEHEAAAAQ-----------LETAEAAHEAARAELQA-----
D1BJA3_SANKS          EDLESEVMDVEQGQEGLDAAHEEAVEA-----------LEGALHALRELEAESRQ-----
C7NGM6_KYTSD          AELEGGMEEAESGEAGLDAAHEAAQEA-----------VEAAAAELEQARNRLNN-----
B2GFM7_KOCRD          SSLQEAAESSAARSEQAAERARDAEER-----------ADAARARSRAADGRRQQ-----
E1VVN2_GLUAR          IQISADLETHMGAEAQLNSAFESAENA-----------FSVLDTAQRNDNQRERE-----
A5CQQ2_CLAM3          ERGEAEGEADEQGGSELTRAYEDAQAD-----------VASEESAIEAVREELHA-----
Q6AE90_LEIXX          AAREADAAIADAGEDALDELYEIAQAD-----------VFEAEGEIERLREELHA-----
D1AB24_THECD          EAFDAQAAE----DPELAAEHEMAQRA-----------LTEAKAAAEAARAAEEE-----
D6Y659_THEBD          EAQALAEPEV---DERLLAELAAAEEE-----------VELARAAVEEARAAAAQAEAEV
D7BMZ9_ARCHD          NALEREAGGAP--DDSLETRSEAAAHA-----------LATAKAELDKARAELTA-----
D6ZIF1_MOBCV          SKVEAELPP-GVADGTLAAREEELATA-----------VATIQEKVAQLAQELGD-----
C7R311_JONDD          NKLSEPTDLPPAPDTPPDQLNQARAME-----------RTWAARSAELARELATA-----
D6ZV06_BIFLJ          DALRSEADSIADDDGAA---LDAARAT-----------LAECRERLNELADKQRE-----
Q7ZAJ9_COREF          RRAEQRHAEILAGRDPLDTAHTRARTE-----------ADMAEARLEELRGRRGE-----
Q8NNW5_CORGL          RLTDERKQGVDTDRAPLEEALKQAKHE-----------AEAAETRLEELRTKRSD-----
Q84F13_CORDP          KDCQTQAQEARSRIEPLSQSRDAALNE-----------SRAADSRLEQLREQQSD-----
Q4JUZ1_CORJK          TEAEEALRETEASGGDLEETRAQADRE-----------AAGAEERAEQLRAEQLQ-----
C4LJD3_CORK4          DSAQAALQDHDSQAGAILDRVSEAERD-----------VASADDRLRELRDTDRN-----
D6Z8M0_SEGRD          SGLRAEQEERDLAWQGAQLRADEASRT-----------ESLLVERAEAATAAAAG-----
C8WGU5_EGGLE          VSLAEAATQAGQALEALVEAEGAARAR-----------VGEALGARETARGALDE-----
C7MMZ7_CRYCD          QVADEAQVDAQAACEAARVSDETAREA-----------VGKALHERDKARGVVDQ-----
C7N560_SLAHD          DTHCQGIDAQAAEIEKLTEDSRKAALE-----------ADAADRAVKVARQERKD-----
E1QVK5_OLSUV          LERRARKEAVLGELEAMRAADAGAQAA-----------ITDCKRALSRERSREDD-----
C8W740_ATOPD          EDSGIKEAELTTALDKARQESEAFVAE-----------ISERASALEAAREAERT-----
SMC_RHOPA             TELAEAVEIAQELLAEQEGAVQEAEAA-----------QIAARQTLDGSRAPLVD-----
A7IGT2_XANP2          EGIRMEAEAARDALAEAEESSIEAEAA-----------HQAARRAMEELRPALSE-----
B8EMM7_METSB          APLLEELEAALEKAAAFEDEIAALEAA-----------HADARASEASARQRATE-----
B8IQU0_METNO          RAAFAEAEATAEAA---EEAAAAARES-----------LMAARDAEASGRPALAA-----
Q92RE8_RHIME          DEKREQVELAEAALEEAEAAVAAVEES-----------LAEARADEAAARLPVDQ-----
A7HQY9_PARL1          ALQSAELEEAAGKVANAERAALDAEEA-----------RRAAQEAEKASREPMQI-----
D8JUP9_HYPDA          DEVSERGHALSQEITDIEAQTVAAEEA-----------VKTTQAEARSRRDEAQR-----
E3I0B2_RHOVT          EDLREDVAMLEAQIETIEGDIIAAEEA-----------VAAARLREKDTRDAAGA-----
SMC_RHOS1             EEAAAAQEEAQERAEAAEEALVQADEA-----------RAEAQSREAEARAQRSA-----
Q2W040_MAGSA          TALEMELEETLEFLEESREQAESADRR-----------RVEALAARESARDAFQV-----
D3P3X3_AZOS1          SEAELAVELAEQRLEQARDAAEAAEQA-----------KAQAEPAQSRAREALSA-----
B6IR58_RHOCS          AEAEAEVAEAETRLELMREEAETAETAKAAAEARAEALRAEAQAVQSRAREAVQQ-----
Q2RPA2_RHORT          EEAIQTRDRTVAALEAARERVESGEAA-----------RTAAQAAVDLAQDSLRR-----
SMC_CAUVN             D-ARQRFANAEAALAAARAALEEAETA-----------RVKAAEQEAQARQLARS-----
B0T003_CAUSK          E-ARQRFANAEAGLAAARAALEDAEAV-----------RVKAAAAEAQSRDLARK-----
Q0AMJ6_MARMM          ETAETAAATAETSLANVRGALEQAEQA-----------RQSAAQTLEAAADCWRE-----
E0TC69_PARBH          APLKSALATAETALTAATTERERLRAD-----------LAEAEAAADALSDPRDQ-----
C6XRC2_HIRBI          TALAKQLELAEKALSDGQDLADKLDVE-----------ANTARKNEKESITPLNE-----
Q0C0X5_HYPNA          RQAKNAEAEAEAALNDAERTVELAEAE-----------ILRARDAEAAAQPPQEQ-----
Q1GQU3_SPHAL          AESLAAAEAAEAAIATAEQALYDAEAE-----------REATATELARVEAALAE-----
D4YX43_SPHJU          AEALAAQQQAGADRDAAEAAIRSAETS-----------RAEAAEARAVAEAALSS-----
Q2G9S3_NOVAD          AEAEAKRAEAAATLADAEAQRADLLRQ-----------REDLTTRRDAASNALAQ-----
D5BSU5_PUNMI          KVSSAGLVEAEANFANAQKALEKVEAT-----------LGDAQTLADTTKADERE-----
A5FVJ2_ACICJ          EAAERAVAAAETTYAEAQNRVQGAETR-----------RTEAHAAAIRARSAATE-----
C5B6I7_METEA          AEENAASRGAEAEAASEALEAAEAETG-------------RLREAEEEARTAVAE-----
Q937L3_DEIRD          QDAETRYRTQAEQREAAQARATHLRAE-----------LARVSAGLAPLRRERER-----
Q1J060_DEIGD          TQAEADYAAWAARRSDAQAQERHLTGE-----------LARLHASVAPLRRERER-----
L0A7J5_DEIPD          EAGEQGFEQLASGREAARSRLRDARSE-----------LQALSSARGPLQRERTR-----
D7BH70_MEISD          QQAEI-------AEKALRAELNQRVEQ-----------ESKLSAEARALRAEVER-----
SMC_THASP             AEREARLEALQDELEVHQQELAAAQPR-----------LPDAQAALKAALEHERA-----
A1K715_AZOSB          AEREARMEMLQEALEERQHDLSALQSR-----------LPDAQGALKSALDHERA-----
C7RKG8_ACCPU          ADKQEQVHGLRERIGELQEIQQAQQQD-----------LPRLEQNRRAVLAEVQH-----
Q3SJI0_THIDA          ATKQLEVDELAQTLAEAQAKLKDAETA-----------LPELDAARARHTRELEA-----
SMC_DELAS             NNLQSQLQEARELAEMADAVLNELQDS-----------VPQLDEDRRTRQQAVNA-----
D6CTE6_THIA3          ADLQRQQETLTDTLDTTRAQREQLEDT-----------LPELQQARQQAQQSQQA-----
SMC_BORPD             EQLAGDRAAGEDQLEEAQQELAALEAR-----------VPEADAERSRAQAAAQQ-----
SMC_BURP1             EELRMQLAEHEAMLAEAQARLADAQEA-----------LPRLDAQRRAAHERVQA-----
A4SYV7_POLAQ          QMAIDRHAMAQRKVEEAKQRAGETQQR-----------VPAADEARNAAQQKIQS-----
D5CRW3_SIDLE          EQSQQQLAEMQAEYEMQQQQLAELQER-----------LPLADADRRQQRDAVQE-----
D9SGR3_GALCS          QQFERELAELSLLQAEHDARQSSLQTQ-----------LTASDSQRQQLRSTLQQ-----
Q2YBB9_NITMU          SELTREAEATAHDLKQKQEEFAQTENL-----------LLDAEEVKREFARNVQA-----
Q0AE88_NITEC          DELQMESAELAALLEQRQCLLGEQETQ-----------IHSMQQERDAIRQVIQS-----
D7DI79_METV0          AEKEQQLAKAEAEIASLEKHAAEVLQN-----------EQALNLSLKASRDNHLV-----
C1D4R7_LARHH          AAAVAASEAAASALLAARQQAAEQEAA-----------LSALDQAREQHEQQRAT-----
Q7NR76_CHRVO          DAARQAVDKAKAALDAVRARLVADEAK-----------QADLAAEREKIDQQLAA-----
A1KSF4_NEIMF          AAAQEAAALLQSRQEHYEEQIIAAEEA-----------LHAAREAFQTASNRFQS-----
A1WY82_HALHL          SELEAEEEQLSAELEDLQQRRDAAAEE-----------LETRAAERDQVAQELEA-----
Q0AAV4_ALKEH          GDLEAEETELAEELAGMDEAQADVAER-----------LESDRAQATELADKLEA-----
SMC_XANOR             EQIELRHETQKTSLDGLTEQVEARKHA-----------LGGLQEQQRASQGELAE-----
B8GTL2_THISH          QQLGTQAAEAAQAAEQLQGSLTETLDA-----------IQGARESSRERTAQLDE-----
Q3JAH9_NITOC          EELREEQFILEQELARQQKALADCVAQ-----------AAEYREQEKQLSRKLHG-----
D3RSW0_ALLVD          EELSERESVLDERIEALEDERDAVLES-----------LAGHETALRALADTLDQ-----
B3PGR0_CELJU          GQLTEQLAELDLVADEKREQVELIGEQ-----------LDQQRNRVQQLQGELDS-----
A6V7X5_PSEA7          LELNEQVAIAELALEELQLQEQGQAER-----------LEQLRRELQQLAAEQNL-----
Q0VR03_ALCBS          RELEEQVEQYRGQSEENELRSESLQEE-----------INQLRRANGDRGRQLDE-----
C7RBE2_KANKD          VEIAKELSLAEEQSERLEEEVSNAVEQ-----------INQIRQQQREHNQKLEV-----
Q2SD45_HAHCH          EILRERMQELEMHADQQALTHQEMRAR-----------EQSEQERKESLSARIND-----
E4PL89_MARAH          EELLEQQETLELKREEAAERIASVQDE-----------LYEARQQQRDAEQALSE-----
E1V8E9_HALED          SEVAERLAELEEHLASSEEKRAAWQES-----------RDAARERVRDAEEAREL-----
D3SAL9_THISK          ERLQRERDALAERLEELRHEREQQQEQ-----------LNQLTEARREARDALHE-----
SMC_METCA             QAHRLEVAGIEAEREETVGAVEALARE-----------AERQRDRLRFARERLNP-----
SMC_COXBU             APLSSQSELLNAELSDSQSKLQSLAET-----------IASRRDANQTTREELQT-----
Q5WTI1_LEGPL          IELQEKHSQLKETQEFDEEQLRQANET-----------QSDLQNQLQNTEQQLHA-----
Q12L80_SHEDO          LQLSQALSDNAKALSQQTLLSAEHEHS-----------MQAQEQALNDKLAHHQQ-----
Q080K7_SHEFN          HNSTAELANVEQQLNDKQLQHSQLELS-----------LLEQQQAVTEASDAYQT-----
A4Y804_SHEPC          TPLTQDLTLLDEAIAAQIDVNYQLEAQ-----------VSLSTQGLDEARVSVGL-----
D4ZIY3_SHEVD          QDNLGRLTQWQIDAMEQGEINDELDQK-----------LTDLLQSQVNLKAKQEA-----
B0TKB4_SHEHH          QDITEQVSELSGVIEQEQEVLDELNFL-----------LEAKQQTEQTLFAEQDT-----
A3QFJ7_SHELP          ALQHAQCERLAERLDELKGEIELGAAT-----------QSQRQEQARQTQAQVEA-----
A1S5R5_SHEAM          PPSEQILVPLTVRFDNAKAAESQVKAA-----------LVECEQALAKCRGEQ-------
Q5QUJ9_IDILO          DENEQALVELKRQLEQEETRYQHSKQQ-----------LQALQQGFKEQQQQHRQ-----
E1SMV2_FERBD          AQVQEQHDEAQTALEQAELAWHEAQQA-----------REQAEAQRENCRQTLAQ-----
F2GBA5_ALTMD          ALVVGQSEEISAQIDEDSDKIISISEL-----------ENEQESLVQAQQSKLRT-----
Q15UZ3_PSEA6          DEAKTAQELIQEQYDEAQLQYQLRNEA-----------LHQAQLDWRKFSDAQTK-----
Q3IKC0_PSET1          ASQKQQRQVLTQELATKQTAHSKGQML-----------LLEQSSQLNNAEQQYQQ-----
A4SKA4_AERS4          -SLQPGLDALASELECSRARHAELEQQ-----------WQASVARHEECKLQQSQ-----
D0KWM8_HALNC          QDAETRMGALEQSHSAGEVVLAEQQTV-----------LAELSDRAAAMQKEAQT-----
A0A2W1K6W8_ACIFR      QALAARCGTTETVLAEAASELRAHREA-----------LETLQNRIAVLRNARDD-----
A0A0J1A050_ACIBA      GELEQLQQQLCREISTLEAEIEQYVQR-----------IEQAQQAHQVNKNQQQT-----
B3E294_GEOLS          TKVEAEWRHCTLEHQAATTELARLTEQ-----------ERVLKAQLPELEQLVQN-----
A1AU91_PELPD          SQLKGEIASGEEEQEELQMELSSLRQR-----------EDELKSRLPKLEEAWQK-----
B9M6F0_GEODF          LKLENSCKKIKEVTQQDVEEMNALVLR-----------EGELKSLLSSTETALHD-----
Q39WG2_GEOMG          TELEKAVAGLGDQKTELQERLPLLTRR-----------ETELRERLADLDREIAS-----
B5EFS9_GEOBB          DALKAEREQLAREKELLDEELTLAGSR-----------EAELKQAQEAGDKLLQQ-----
Q3A212_PELCD          ASCEQSLQRFATQRDELDQTLEQSREQ-----------ALVARRQLEENERLLLE-----
A9FIZ2_SORC5          SSLTRNVAELAEGKRISADERSRLDVE-----------MKSLREQAVSSDRTVEH-----
D0LY52_HALO1          QGLERQLAGLRQTRLDLGSQSEGLEHR-----------REHLEESVQQCETQVDE-----
Q1D2R5_MYXXD          GDVAKRVEDTRHLAAELAERKGQEEDA-----------LTRTRAAFTENEIEVIA-----
B4UDF6_ANASK          ARHVEKLGHTRQLKLRLDEQRGAQEEL-----------LERTRAEFIQNEAKLIT-----
Q6MNS9_BDEBA          KKVITELDKERQMQLDLASDVDSFEAN-----------KKILQDSVATKKAEVDS-----
A9A0M3_DESOH          EQIRNEMAGSTDTIEQMEERIRVVSGK-----------LDDRQKALTETIRRVHT-----
B8FHS3_DESAL          ADAEENLEGILEEAESVKGELVYIEQA-----------LEEKRAELGDQLRKVQT-----
E1QL74_DESB2          AQAVQRIKELTADLAAAQARADALQQR-----------QKSQQDGLRALRRDEDD-----
B3EFQ6_CHLL2          KQLESEISRQASLLEQASDDERRLKNR-----------IEELGTAIEMQKEELLSL----
A1BDT4_CHLPD          REISEKINARSELVNESRKSDENIKNQ-----------IKILRQSIETQKEKLLGF----
A4SG64_CHLPM          EESTRELRQKQEQLTHQREKETLLHKE-----------REKLAAELEQLKERLLSL----
SMC_CHLTE             RRTSEAIEEKKIALDELKKEEERLVAL-----------KASITEQSEKKKEELLSL----
Q3ATI3_CHLCH          EETTQALQQISTQLAHSQAEEERLAEQ-----------QQALQQQIEQQKEALLRH----
B4S519_PROA2          KGLHDKQARLSKEIDETRKEIGSMQAQ-----------KLDIARQIERNKEKLLEY----
B3EM83_CHLPB          EKLNERIEKQKTVISSVNKEFLSLKKL-----------QQDLGEQLEAKKELLLKL----
B3QRZ4_CHLT3          LENGSLLERLMFQHKQAESELEAAKTR-----------RAEFRSAIDAAKERLLQL----
D0MFL5_RHOM4          EETLRKRKTARQTCERLRKEIEALEAR-----------RQALRQEIAARNEALHRR----
Q2S457_SALRD          DEAEADRAAAQEALEEARSARAEAATE-----------RDERRAALEAAQDELREL----
C7PLU2_CHIPD          VILHETLQDQKADLEDMIAFQEETKGK-----------ILATQGEIEGLRDRLVDE----
E4TVF1_MARTH          EELSKILKEKNEYLSNLKHKEDHLNQQ-----------IEDHKNTIELIREELTQS----
B2KBE7_ELUMP          ENISEKITEKHASLEGVKNQLNEAEEK-----------TRSLSRSRIVLNDQLSAS----
B1H0P2_ENDTX          AEIDAELTTADKSRWLFESENEKINKT-----------VSENEEKIKTLENSLLQY----
E4TEW8_CALNY          ADLKIKKDIFFNEQMVIQDSYTREKEI-----------VNKIDEELKSLSDKLSA-----
D3PDY1_DEFDS          ENQKSDLERLYEDINIVKDEYEKLNKA-----------IAKLAEDIKENEKKLSD-----
D4H2V6_DENA2          EDQSSDVDRLTLELETIAETLEHYSDE-----------HSELRDEISVIETELSD-----
D6YSC9_WADCW          EWKHQEIAEGADHIAELKERFSLFESQ-----------IEETAALIKQTQHQLNHV----
Q04TU9_LEPBJ          --------EAIDTENRRRELKEFLLSK-----------MSEYSQKIETLRSDLELS----
E1R6H6_SEDSS          REITDDIVTQLDSKLKETGYSRQERAD-----------MEEEILNTIESLSIQLKG----
Q73ML2_TREDE          KSITEDIVTELDKNLRSAGYSSANRLE-----------AEKDLDGALNRLKVLITG----
A0A0H3BKB7_TREPS      RDVAEDIAAELDTRLSAAGYSARNRAE-----------AERTLVAGVQRLRTFVEG----
E0RSK7_SPITD          ANLTEEIVKELDEGLKRSNFSAKERVT-----------LSHALRESLDHLLARIRH----
D5EMY0_CORAD          GEIQRTLSKRRQEQEGAESAVEASREE-----------SKAILNQFRALQERIQEQ----
B1ZZB8_OPITP          AEHETKVEAALAEKSRTNNAAAAAQQA-----------ITDLTREFRDAQRKLQEV----
SMC_DESHY             AQVQEQLKAQEELQTDIRLQTERAHQE-----------TAQLREQSKAGQRELQEL----
A4J682_DESRM          DAAQKRVEELNQKKLQLAEEQQKSEVK-----------LEKLRDELMRVQSKLLAV----
Q67PF3_SYMTH          AEVAADKARLVQERETLLAELADLTAR-----------RQAADEELRDLEARRAAL----
B0TGW8_HELMI          DRLRREAAARERQRADKQAERDADAAE-----------MAQWRGQFNELEHRLSQT----
Q2RJX0_MOOTA          RAGEEQLGEIEANLKALEGKKASLETE-----------LPLQEADLAAREKHLAGL----
SMC_BACSU             AACETEFARIEQEIHSQVGAYRDMQTK-----------YEQKKRQYEKNESALYQA----
C5D8T7_GEOSW          AKLDQKRQQMEKTLQEKETLLQQKTNE-----------VAAMKADLEKKESMLYQA----
D5DQR5_BACMQ          EAAIKRLAQFRQELQQAVQVYKQQGEK-----------LESLRQAYRKQESTLYQA----
B7IUK7_BACC2          TKLVENYEQVKEKVAGILSNIQKTEAA-----------LGKCKTQYSENETKLYQA----
Q9KA07_BACHD          EQERMQFEAKEKQLHRLVDEYRNQQRK-----------VEQVTRVYEQKEKQLYEA----
Q5WFM8_BACSK          AERAQVLKAAEQSFAEAKMTHHRHLSE-----------EETVKNRYYKREAKLYEA----
Q7ZAM6_OCEIH          EDAEKTLNAIDAELKAKENELMNVKVE-----------LQSERGNFEDAQSKLYQG----
D6XTT7_BACIE          ESLKDAFDHAAAETEKCLSLYREKENE-----------EGEKRQSLTDNEQQFREI----
Q81ZN4_ENTFL          ETLEKEQKVAKQGLQEQLEEYTALKAT-----------LEAKRERLAQRQNDMYQA----
A0A0E0UX46_LISMM      ETTKTHLTKIQSELTEQMEIYREVQQT-----------LAKQEAIFGTQERALYKH----
B1HQH6_LYSSC          EQLVAVHTTTTNDLQEKLDQYDALQIQ-----------LKNVNSTFTEKQDMLYKA----
C6D303_PAESJ          AELEKQLEATLDAISKARTKYIDQAEK-----------AKELGQISEDATAALRKW----
C0ZFN9_BREBN          SQLQDQLEKIVSTIQETGVRYKELVEG-----------MREGQARLETARRELRHW----
C8WWA4_ALIAD          QERAQRAEEIRRELDELERQLAALEAE-----------REQAASDEAQAVSAWHRL----
D5WPA2_KYRT2          EEVQRQKEAVANRVKSLEEAEGDRVAQ-----------ERQLRGRMDQAENGWRRD----
C4L5Z7_EXISA          LTTREQYEVVQSRFEQLSKKETELRDE-----------ETSIREKRTRAESSYYDL----
B1YIN0_EXIS2          IRLAEQVEELRNRLETLRQEEKTQQDQ-----------HRQQQDTLRQMEQSIIDL----
D3R1B0_MAGIU          DGAKERVAQATINVEAAVAKEKEAAVD-----------LAEAKETLAKTETAWQDL----
D2RLB2_ACIFV          QEEKDRLETLEDRKNQLEEQALQLNRD-----------LEQSVRAYREKEAGLNQN----
D1BLY1_VEIPT          QVARSEFEALGQKFNALSAQRQALVDD-----------AKDAVMKAREERKELQKL----
A5UQ60_ROSS1          VQADAHVTALEQELNDAARRVELTTGD-----------VEQRRRQRAAAAETLEAL----
B8G556_CHLAD          TDAQTALAHAEQMYQESSAAVQAARQE-----------LDRLRAARTAIDEQRATC----
A9B100_HERA2          EQAQQLYQQAEAEFNQTQANEEAAQKS-----------LLEARNLRREQEEAVAYA----
D1C6T1_SPHTD          AAATKARDEARERLAELAAERERLEAA-----------LSAAAAARDEAERAMKAV----
D7CMX2_SYNLT          SRTREKLNEARARLDHWQRKKTDTEKA-----------HDRALTSAKEREQDLARL----
Q0AYV7_SYNWW          LQCQEEIRALQAEIGQKQSFIAELSRE-----------KDELAKVLQNLNDSYREL----
SMC_LACPL             DVHNREQRDLENQVSQQQATLTAQQAQ-----------VKTNAERIDEQQQRWLDA----
Q03RT7_LACBA          TEIQAKATAHKAQLNEAEQALDAEAGQ-----------YQQHQKQYQALQHNWQAA----
B2GD41_LACF3          TQQATVAQTAEQTAQEVVQRYNQEQAS-----------QAKLQQEYEQTSRRWYQA----
A5VKP1_LACRD          DRYQQAVAITKESLQNVSEKLKAAQDH-----------REKLNYGYQTKQRDWYAA----
Q03FW9_PEDPA          ENLEHQLLTLKDANNVQQERITKLTKQ-----------RDRLQAQYEKERQQWLDG----
A0A249N2C3_LACRH      NTLLNQQQQLQTKVDQQQAAAQEAKDK-----------LTQIQKVRTDQQRTYQDE----
Q38XR7_LACSS          AAKEAQVAQLATDYAALETQLSQLQQQ-----------ISATQKQYQTEQNNWFQA----
Q1WU99_LACS1          DELKTTLNNKDNEYQEIVTTLKELKIK-----------EVELSKKDSELKNNRNKA----
Q04GL1_OENOB          NKIE-NSESASKDSKDLEEQSAHFSKQ-----------LNQKKAELSALEKQHSDL----
Q03VW6_LEUMM          NKKVPNSDHNDVNITELEKNVADLKKD-----------IGNAAKIYKSTEQNWYKV----
A0A0U5K8Z4_LACDE      EGLRLKEQKLRAENDQLQAELKEASDQ-----------LGKLAAEQQVAQKQLQAD----
E4SKB3_LACAR          EKLRAEGKTLTEKRKSEKIKLAEVGDQ-----------NSDLTNKVNQLRQTVANE----
Q74IP9_LACJO          TQLKKQGQDLVLKRKQLNETIATLDRK-----------IAEESKLKDQSEQAYLKV----
A0A0T8KIP4_STREE      SQQKDELETAKVQVQKLLADYQAIAKE-----------QEEQKTSYQAQQSQLFDR----
A4VVL7_STRSY          DKSRKSLEEADHVLRQLLESYQTKKTE-----------LDQVQTAYQAEQGRLFDL----
C0MCR5_STRS7          QTALLAYQASQSRLEQLLADYQELAKT-----------VEALEQDYHQGQTRLFDL----
A2RLZ7_LACLM          SEAQENLNTVKKEIETLLAKFEEGNQA-----------EKKQAELERLAQNKMYDY----
B9EBB4_MACCJ          QSLNEQINSMEQMVDNKRLSYTERQQH-----------ITKQKQLYFRESENLKQA----
SMC_MYCHR             ESLKIQINASKQREIELDQQLTRLNAK-----------ANSLKLQENDINKEIGVL----
E0TKT8_MYCHH          ESLKIQINASKQREIELDQQLTRLNAK-----------ANSLKLQENDINKEIGVL----
Q4A770_MYCH7          SLISAQKDNFAKLISQNKLKKLEIEEK-----------LNTFRTQKSEIERNLYSL----
C5J708_MYCCR          VQIEERIKNTNSQILTINDQKTRQQSQ-----------YKIYNDKRIEIESTIRRL----
A5IYM7_MYCAP          EKSAQRVAYYNREYDLINKRISDNSEI-----------LDAHDKELNFINIRLTKK----
D5E4P4_MYCCM          EQTSHKISYFKDEEEILKNKSNHYSKE-----------VNELNENINELTIQINDK----
Q6KHN4_MYCMO          EALNSKIMHLNSLETKLTKDISEKKEV-----------QSNLELEIGKLRVESTNT----
Q98PK8_MYCPU          QIIKSRINFYTKQTEELSQIVSDKKNE-----------VQELEKTISTKRIEQNKI----
D1J8Q8_MYCHP          NALNTNILGYKTFLETKKKESEQLSQS-----------ASIRSTKINDIKRELSFK----
Q4A588_MYCS5          KEIKSKLDFLLNKTQKTKFELDDLNSE-----------KSQLESQALMLETQLREV----
SMC_MYCGE             LVDQTQLDGFENQLSNSKTTITDLEKL-----------INEQKSLVDQIKLQIEKN----
SMC_MYCPN             RVDQAQLESLQAQVLKTTSEITLLTNE-----------LSTVQTELDTTKLNLNQN----
Q7NBU0_MYCGA          KSSEEQLKKYFELISTWEEELKEKDVD-----------KTDLANELENLKKSLATF----
Q8EVS6_MYCPE          IVKEKELSTVNSILERNKSEVSEFTEK-----------LDNLKYESKLLEKEILDL----
Q9PR04_UREPA          KTTEIELNNNKKNINEKKDQLKDIQKQ-----------KLELESLKTKQKNNLDTI----
Q6F1N4_MESFL          DEKSISLNSEKDLIISLERQELDLKKR-----------YDEVNDQFRTFHMQSQEI----
Q6MTD2_MYCMS          DEKQISIKSEKNKLTKAENSLLELKDK-----------YDYYSNKYNEIYREIETI----
E3GP81_9FIRM          SDTLLEAEQNERTRARLAAETESLRNQ-----------TEEAEKKAQGLKNDYSVL----
SMC_HALOH             DKLRTYLKSVDNKIEEKRSVLTDLKEE-----------ELNLQARLEEAKKRFNRT----
E4RL35_HALHG          ELLTSKLEELKTDLKNKTEVIAEHKKD-----------ISREKEELEQGKEKLITL----
D9QRN7_ACEAZ          DELTAEISAIEDDLETEEEAVTAKKEQ-----------EEELETRLQKLQDEYNQL----
A8MHB7_ALKOO          NDLKQDLSELEKHNQRIVANIAEQNHH-----------KEHLMNQLNKASNEMNTL----
A6TRT3_ALKMQ          VTLKEKKTSVSEKIRFINKNIIEKHEL-----------LENTLRKSKQLSIEVEAA----
A3DDY2_HUNT2          EELSESIYKTNELIKNIKDLLQELTEK-----------RKDLGIKLEEEKKKQNNV----
D5X8N2_THEPJ          ESLNISIRETEDELSSAETKIKDIAAK-----------INENSVKIQDVTREFNNL----
D9R048_CLOSW          AALQKEADEIDAGIAEGQKAQAFSEGK-----------AEELEGEVKRLNKNLNDK----
C4Z0E6_EUBE2          NDIGARLEAAQKNALEIAERIATNNDK-----------VTAIKNENADLNAQHDKI----
C4Z924_AGARV          DEANKKLNAVNEEIAGLKEKESALLAK-----------AREWRDKSRENARLMEDA----
E0RV40_BUTPB          KKLRDEFDAITATISEMNKKQKETEQE-----------VVRIREGMNLKDTELRKT----
A9KLR0_LACP7          EELKSNAAHIMEQIDTVTAENQNLVKQ-----------IEELQKKIDQGVAVSNQK----
D9S347_THEOJ          EGINGKLTGLKGNLSDLNKKLEHLHKV-----------LEGQNGEYRNTGKLLQEK----
B2A2N3_NATTJ          KQIKEQQITKQSRLDELVTKITSEKQR-----------IDGLESEKQQLTDRINDL----
A8F8R1_PSELT          GALLEKMKNAGDKESQLAQELQLIRER-----------LKELSSEKRATADQLDNV----
A5IN04_THEP1          KEISKRVEEFDEKERKLTEELNTVRER-----------LEEVEKEIRKITSEIDVK----
C5CIS4_KOSOT          EELAAQGKESTEKQKELEENIALSKER-----------RDTLENQLEELKEKIAQS----
A7HMD4_FERNB          SDLEKHLLDIVEKENELVKELESIKSS-----------IEEYRKKKEEKSLLLEKL----
B7IHN5_THEAB          SELSQNSEKYDKKTKELLEEIEQLKQE-----------MQSIAGQREFLKENLEKI----
SMC_THEEB             LEL---QDALTTAAAAIKQQEQQLQTLAQQ--------LATAQQQLSRTEETYQRL----
Q2JHS4_SYNJB          GSH---LALTAELEHTCRQSEAQVQTLAQE--------LAQLQASLELDRATHERL----
SMC_SYNP6             ETE---TEQAEGDRAALSQAEAAVVTAADQ--------LVRLEEELQIQQETRDRL----
B0C9C4_ACAM1          TET---QVQLETAEAEVLQRQEQVQDCAGA--------IAEIDHDINTQQETQNRL----
Q115J3_TRIEI          EGY---GKHYEQVKESKETARYQVESLTKQ--------LEAVEQDLKVQQDTQTRL----
B2J925_NOSP7          AQK---QTDCNQVETEFNASSEPIQNLAQN--------LSATEQELQIQQETQKRL----
E0UKI1_GLOV7          TSQ---ETEMTRLCEQLPLIQAEIQTLAQQ--------LTLTEHDRTIQQDTQKRL----
B7K4Q6_RIPO1          NSQ---HQELNTLSHQATTSTQDIQTLAEK--------LAATEQANSILQETQDRL----
B0JSN6_MICAN          STK---TEESQEILQKINQSDPDIQNLAQK--------LTIAEQNRVISQDTQKRL----
SMC_SYNY3             EEK---QFAQGQFNFQGEALTSQIQTLASD--------LAQLEQERSLLQETQTRL----
Q84EC7_SYNP2          SQQ---ETELATAQTEITCQQETIQTLATQ--------FAQLEESRKLDQETGDRL----
D3EQ04_ATETH          DLQ---NQELEKLSIFYT---ENIQVITDK--------LNIERQEYNIIKETQSRL----
SMC_GLOVI             AQL---ATEAKVAQERLAAARTRLEQTRAD--------LEAERAQILADRTTQRRL----
A5GQT1_SYNR3          GTA---AEQLKELQGTQQELLQLIAKHKQR--------VQELAEALSLQQRTRIRL----
A9B9B9_PROM4          KKL---QNELNLLDNEWKLLVDQIDQLKHF--------VDSTSEDLSIQERTRFRL----
A2BNJ6_PROMS          QKL---FQGNQRKKETSDTKNKNLASNSAE--------IHSLKNEIDLLIKTKSRL----
Q46EX0_METBF          ATS---DSDTLSVRYELEKLSENLESLIRD--------RDDIESSHFRIKEDIKKL----
D7EAF5_METEZ          ESS---DSDTRSVQHEIDKLNEKIESLNKD--------LDDLESNRSQLKEILNEH----
D1YW78_METPS          EEA---RVESKNLEKDVAELQRRSQALTAD--------INDMEGARSRTRAEQHGI----
A0B8B9_METTP          SAA---STESERLEREVESIASEAMDLDKR--------REELESRRLSLRRELAEL----
D4GT30_HALVD          PEL---KATVSDLHSELDTAEKNEAKIDGV--------IEDLQAEKADLNDELSEV----
A7IAD8_METB6          ADK---QAQLAENERTVADLTGRKKELDRN--------LSEIESTLFAQRSSLERL----
A3CWK7_METMJ          TNK---QEQVAEYSSCMADCEEQKRQIERA--------LSEAESTLFARRSALDRL----
B8GG37_METPE          TGK---GGQQQEWTEASRVIGEEKRAIERR--------LSDSERGLLSRRSSLDGV----
E1RII6_METP4          ADK---SSLCVEYRSELKKLEDQKKTIDAG--------LSKAEVELFENRSALEKI----
Q2FLH3_METHJ          REK---DEDIAGLTTALSRLTEEKKEHDRM--------MAALDTALYTKREEHDRL----
A2SS75_METLZ          SEK---QAEIDSLEHDLLDARKNKGILDKQ--------IGETERAMLGARKALEPL----
D3RYW2_FERPA          EAL---KRDVEREERELEILKKQLSSELKS--------RNEIDKRIFSIRRELADL----
O28714_ARCFU          KEF---ETEKKAKQEEVWKQEEELMSAKKM--------LSSADKKLFDIRAKISDV----
D2RFP2_ARCPA          SRI---FDEIAEDERNLAILKNEMDKLKLK--------LFEIDGEIFKLRDEIAKI----
SMC_THEAC             EDL---DLKIRTSEWKAKETSEDMGKYSRK--------YYDLKAKYDQINDRISDL----
Q97AI9_THEVO          EDI---GLKVKADEWKLSQNAEDLSKYRDR--------YYKLKSEYDEIQEKISKL----
SMC_METVO             AEF-SDLEDTKKLYKELEDIAVELEFSKKK--------LQEKITERNDSQSKLDNL----
A6UQ42_METVS          EEMKSKTEDTKLLYKELEDVAVELEFSKKQ--------HLKLENDKKEYQLTLDKN----
A6UVP1_META3          NSINKNSEDTKELYKELEDVGVELQYSKQR--------LKKLDDEKKELQRSRDLY----
SMC_METJA             ETV--EDVDTKPLYLELENLNVEIEFSKRG--------IKELEEKKKELQAKLDEL----
C9RFQ3_METVM          EST--EEVDTKSLYIELENIKVEIEFSKRK--------INEIEEKKKNFQNKLDEL----
D5VT24_METIM          KFE---KIDTKDLYIELENLSIEISFLEKE--------LRELKEKERKVKDEISKL----
D3SQ87_THEAH          ESL---KEGSKDSVLQKENFIQMLQKEEQM--------VILKKRELADLEDHLRKR----
D3DG53_HYDTT          EKL---KSQMGENILKMENYRKMQKEEEVS--------LRKKKQELESLEERLRRI----
SMC_AQUAE             EEK---IKEIKEKEQEIKRLKAIKKKEEEE--------LRNLTQELNIYEKRLSEV----
B4U7R1_HYDS0          QAL---EQK-DFVEEKLKTFQKNIEEARLS--------IEAIQQTIAKYTSSLTET----
C0QSN8_PERMH          ETL---RKSSSNIKSFTESQERKLKSLKSE--------LSRLKLRKETLEKKLKEN----
B2V736_SULSY          ENI---EKTIENIKSNTKDSQKEVLNITSE--------INRLKIRKDVLEKRLKEN----
SMC_PYRFU             NEF---KAVVEDKRAEISEIEGKLSTIQAK--------RIKVEKEIEAKSNELEKV----
C5A612_THEGJ          AKL---KSEIDEKRSELSNIDGKMARIEAR--------IRKAEKELEEKNAKLKKI----
D1CC09_THET1          KHLIDRIQGTERERLRLLEKIKDVKQK-----------IGTTKREHQELQQRYSNL----
D3TAQ9_ACIB4          KDAEWRISQFKNENKDVEKKKKALESR-----------YYELRNEETKLSKELKKK----
SMC_HALMS             ADERDAVHTAQELSEKLTEVESELKSE-----------IEELISANKELDAKLKEK----
Q6L0R1_PICTO          NDLKWRIKNSEIEMNDIENSMKTANKN-----------YELLRTETYNISENIKNN----
C1A7M6_GEMAT          LAARDQVETSRLAAQEALDDLEGARLA-----------AATARIADAESRSALASA----
C9RN51_FIBSS          AEIQAGIEDTNREIENLEEQRATREER-----------LESERAELTEAQQKLQGLK---
D1B5Z0_THEAS          DLAEEGAQRANSLHRQALAEFQAGAER-----------LQSLKRQLAKVRSSVDEL----
                                                                                  

SMC_FUSNN             -------------------------------EYQEKTSSGKLEALVRMDENNEGFFKGVK
E3H7H1_ILYPC          -------------------------------DYNLKMNKTKLDNLVKLDENNEGFYKGVK
D1AK68_SEBTE          -------------------------------NYKNTNLSTKKRAIENIIENNETFGRSIK
SMC_CLOK1             -------------------------------NALYNTLEANYKMLVNFHKHYEGYNRTVK
D8GS00_CLOLD          -------------------------------NKTYNKLEANYAVLLNLQQHYEGYNRSVK
Q97IA1_CLOAB          -------------------------------NSKSNKLEANKNMLINLEKQYEGYNRSVK
A0Q0Y7_CLONN          -------------------------------STIYSRMEAHCNALINLENKHEGFNKSVK
Q895M7_CLOTE          -------------------------------NINFNKLMGNYQFLSNLEREYEGYNKSVK
Q0SSA4_CLOPS          -------------------------------LSKVNKVEANKEMLKKLENQYEGYNLSVK
A6LSM4_CLOB8          -------------------------------SGTLTKLDANRSMLENLEKHYEGYNRSVK
D9SLC7_CLOC7          -------------------------------TNEKTKGETNLSFLNKLEEQYEGYTKSVK
D7APA8_THEM3          -------------------------------KEQIERKRSRLSILEEMDKNYEGYSGTVR
Q8R9W7_CALS4          -------------------------------GEELEKKKSRLFILEDMERNYEGYSDTVK
D9TN88_THETC          -------------------------------LNEYNSNLSRLKVLREMDRDYEGYSYSIK
C9YKI7_CLODR          -------------------------------KYNLNGYNSKLNVYIDMENHYEGFNRGVK
E3PS49_ACESD          -------------------------------NIDISECSSKVGLLKKMEADNEGLSKGVK
B0S1M4_FINM2          -------------------------------KEESITNKNKYLFLKNTIDNHEGYNFTVQ
Q3AC59_CARHZ          -------------------------------EKKYNENITRLQILTKLEESYEGYGKDVK
E4SF58_CALK2          -------------------------------SKQLIKKQEKLSILKMMEESYEGYSKTIK
SMC_RHOBA             ------------------------------LKIRLQGITERARVLDELQQKQEGVSGGVR
D2QWB0_PIRSD          ------------------------------VRQRSMELSQRVALLEELERNLEGVGAGVK
D5SU17_PLAL2          ------------------------------LREQRSAAMARKSVLEDLESREEGLGIGVR
SMC_KORVE             ------------------------------LRAEYATLLGKKGSLESVINEHGYSTESVK
C1F1T5_ACIC5          ------------------------------LRSERATLVGRKNSIESLIRDHSYSTETVR
Q01Y77_SOLUE          ------------------------------LKTEVSQIRARKESLEQVLAHRTYTTESVK
SMC_MYCPA             ------------------------------AERKVASLRARIDALAVGLERKDG-TAWLT
SMC_MYCTU             ------------------------------AERQVASLRARIDALAVGLQRKDG-AAWLA
SMC_MYCLE             ------------------------------AERQVVSLRARIDALTMGLERKDG-AAWLA
A4FMG9_SACEN          ------------------------------TEREIASWKARVEALSMGLRRKDGAGALLA
C8XH72_NAKMY          ------------------------------AQSTASSLQARVDALALGLDRRDGTADLLA
D7GEI0_PROFC          ------------------------------VERNVATLSARIEALELGLVRADGAAALAG
Q2J6Z3_FRACC          ------------------------------AERDRASWAARCDALHLSLSPADGAAALLR
A8L599_FRASN          ------------------------------AERDRASWQARRDALELSLEPADGASALLR
C9Z3S1_STRSW          ------------------------------AERRRAATQARHEALALGLRRKDGTGALLA
D7CC86_STRBB          ------------------------------AERERAATAARHDALALGLRRKDGTGALLG
B1VYX5_STRGG          ------------------------------AERRRAAVAARHEALALGLRRKDGTGALLG
E4NHH3_KITSK          ------------------------------AEQERAALTARHDALALGLRRKDGSGALLG
C7QGY1_CATAD          ------------------------------AQKEHAGFAARKEALELGLNRKDGAGALLA
A0LV82_ACIC1          ------------------------------LERARASLAARVDALALSATRKDGAAALLD
A0JXV4_ARTS2          ------------------------------GERERDSLLARRDALQLGLNRRDGSGRV--
A1R7H8_PAEAT          ------------------------------AVRERDALTARRDALQLGLNRKDGSG----
A6W7T9_KINRD          ------------------------------AERERATWAARKEALEIGLDRKDGAGALLA
D1BJA3_SANKS          ------------------------------AAQDHSTWSARSETLDLSLTRKDGAGAVLG
C7NGM6_KYTSD          ------------------------------AGQKAQRLTARVEGLSVALQRRDGSATLVA
B2GFM7_KOCRD          ------------------------------TASELHTHTVRLDTLRQSLRQPDGSASVAD
E1VVN2_GLUAR          ------------------------------LSVRVSGLSARLEALKLNSKPNDQSAKLLE
A5CQQ2_CLAM3          ------------------------------KERERDALAAREQALASALDQRDGSSDLVA
Q6AE90_LEIXX          ------------------------------LERERDALAARTSALSLALGQKDGSAALVA
D1AB24_THECD          ---------PRRQLKAARAAVAAARAADQAAQKEVTALQARIEALELTLGSAVDGGEVLL
D6Y659_THEBD          DRVKAGLAAPQEALAAAKAAVAAAVAADQESQRKVAALQARREALELSLNQPTDGAATLL
D7BMZ9_ARCHD          --------------------------------AQANTITWRTKAETLQLSLAPEDATAWV
D6ZIF1_MOBCV          ------------------------------AREEAAIWEAKREVLAKTLQPQDAAGAVAK
C7R311_JONDD          -------------------------------TSNLSAAQARVDILTAQLRDVPTHLSDHH
D6ZV06_BIFLJ          ------------------------------IQSKIISLKSKADALADTLGSRNASGSLER
Q7ZAJ9_COREF          ------------------------------LEREVSRLESRIDTLDHNRPRSSA----EQ
Q8NNW5_CORGL          ------------------------------LEKEVSRLQSRIETLNQNRPRSDA----AD
Q84F13_CORDP          ------------------------------IDKSISRLESKIETLESHRMTRNAVKQWEK
Q4JUZ1_CORJK          ------------------------------LERDIATAEATIAAWQDRLTPTDGAAVVVR
C4LJD3_CORK4          ------------------------------YERSISALQSRIDTLEATVRPTNGVAWLRT
D6Z8M0_SEGRD          ------------------------------LKGTTAALAARIEALESTVAPADGAAWLFA
C8WGU5_EGGLE          ------------------------------ARDAASLLASEIKGLEEIERASAAAGPARA
C7MMZ7_CRYCD          ------------------------------ARNDRDSAQARFKGLEELERARTQENPLRA
C7N560_SLAHD          ------------------------------ARDALQSLQGEIRALKQVVRSMQTKSEASE
E1QVK5_OLSUV          ------------------------------ARSRLSSAQATLSALEAVDLEAENSSALTA
C8W740_ATOPD          ------------------------------ARQELSSSEATLEALRALDVEVQKGSPLAE
SMC_RHOPA             ------------------------------AEKKVQRLETEAKTISK----ILNGET---
A7IGT2_XANP2          ------------------------------AQSRFGRLDAEARTLAK----LLQS-T---
B8EMM7_METSB          ------------------------------ADRKAQRLGAEAQTLSK----LLNARS---
B8IQU0_METNO          ------------------------------AEREAARLDTEARTLAK----LVAPAA---
Q92RE8_RHIME          ------------------------------ARARLNGIETEARTIRR----MLEAAG---
A7HQY9_PARL1          ------------------------------ADRAAGDLAAEAKTLAD----LLAVGE---
D8JUP9_HYPDA          ------------------------------VRLAANAFSTERETIAK----LLAVAD---
E3I0B2_RHOVT          ------------------------------ARLRAKSLETEVATLIK----LLKPSD---
SMC_RHOS1             ------------------------------AEGEANALRAEVAALAR----LVDR-E---
Q2W040_MAGSA          ------------------------------ASAARSRLQAEADGLRQ----VLAQGK---
D3P3X3_AZOS1          ------------------------------ADSAHARLRAEERALAE----LLEAGA---
B6IR58_RHOCS          ------------------------------ADSVRAKLKAEADGLAA----LLKIRS---
Q2RPA2_RHORT          ------------------------------AEGRLTGLRAEARALEA----TLARAAP--
SMC_CAUVN             ------------------------------VEDQLGRLRTEARGLAQ----LTAPRS---
B0T003_CAUSK          ------------------------------VEDQLGRLRTEARGLAQ----LTAPRA---
Q0AMJ6_MARMM          ------------------------------ASAQRETLERELRALER----LLAGSQ---
E0TC69_PARBH          ------------------------------ARAATNALQAEVDTLTR----ILKQSE---
C6XRC2_HIRBI          ------------------------------AEKNIRSIEAQIAGLQR----LVGKKQS--
Q0C0X5_HYPNA          ------------------------------VSHNVRALEAEIAGLEN----LLQRADA--
Q1GQU3_SPHAL          ------------------------------ARAALAALDGEATTLER------ALAAA--
D4YX43_SPHJU          ------------------------------ARATLAALDSEAAALRR------AVDSG--
Q2G9S3_NOVAD          ------------------------------ARADLAGVEREADALARDKAAREKAAAA--
D5BSU5_PUNMI          ------------------------------TEAQITRIQAEIDALEY----LLADNG---
A5FVJ2_ACICJ          ------------------------------ADAAAARLKAETDALKA----LLAQKF---
C5B6I7_METEA          ------------------------------TADVLARLRGEAEGVAL------ALAAL--
Q937L3_DEIRD          ------------------------------LETALNSYARYGEGARN-----ALRQEH--
Q1J060_DEIGD          ------------------------------LEQTLNAYARYGEGARN-----ALRMNH--
L0A7J5_DEIPD          ------------------------------LDSLLASFARYGEGARN-----ALKSGV--
D7BH70_MEISD          ------------------------------LEAFLQSGADLTEGPRR-----VKEARL--
SMC_THASP             ------------------------------VQRRLTELRARRDALMQLQARVQSQGK---
A1K715_AZOSB          ------------------------------VQRRLTELRARREALVQLQAKVQSQGK---
C7RKG8_ACCPU          ------------------------------AQKERAEANARRMALQQLQQRLQTNGK---
Q3SJI0_THIDA          ------------------------------ARKALHQAEAELAALKKLQESLKADEK---
SMC_DELAS             ------------------------------EAARHADLSARLEALKALQEKVKTDGK---
D6CTE6_THIA3          ------------------------------AAAQLAATSARLAALKALQERVLTEGK---
SMC_BORPD             ------------------------------DAQNLARLEARLAALVKLQEDVQKQGA---
SMC_BURP1             ------------------------------ESAQIHQLEARLAALKQLQENVQTQGK---
A4SYV7_POLAQ          ------------------------------ANQDLAQTEAKLTALTALQASVQAQGK---
D5CRW3_SIDLE          ------------------------------LSRQLAQAEARLNALQQLQTQLDNDKN---
D9SGR3_GALCS          ------------------------------RQLQAAQTQARVQALQSLQQ--DNAPD---
Q2YBB9_NITMU          ------------------------------LEQQVVQAEARLSALQRLQGRLESSEG---
Q0AE88_NITEC          ------------------------------LQRDLAQANARRDVLQHLQNQIEDNQE---
D7DI79_METV0          ------------------------------QQRELNLLEAEIGSLNKIQQTMRNGNNEAA
C1D4R7_LARHH          ------------------------------LRDELARHEAEASALQRQIDTALARAGLA-
Q7NR76_CHRVO          ------------------------------KRTELARAEAEAAALAALLQREAADEQLA-
A1KSF4_NEIMF          ------------------------------LKQQHITLQAQQQALSQILSQ---QQEAA-
A1WY82_HALHL          ------------------------------AREAVSGTRARLTSLETLQ-ESALGRRGDE
Q0AAV4_ALKEH          ------------------------------LRGELHQQRARLASLETLQ-QSALGEDGGP
SMC_XANOR             ------------------------------VRKQAQAARGRLSSLETLQ-QAALGQEQGA
B8GTL2_THISH          ------------------------------LRRRIQTQAGRLSSLEALQ-QAALGKGEQS
Q3JAH9_NITOC          ------------------------------KQRERHHLQGRLASLQALQ-QAALGRSDGG
D3RSW0_ALLVD          ------------------------------VRTRLREAKGRLASLTALQ-ESALADTDVE
B3PGR0_CELJU          ------------------------------SRGKLQTMRGRHASLEALQ-QAALGEKNKA
A6V7X5_PSEA7          ------------------------------AQGELQRLNGRIASLEALQ-QAALDP-GQG
Q0VR03_ALCBS          ------------------------------AREKLQSLKGRRSSLEALQ-KAAMGD-DGA
C7RBE2_KANKD          ------------------------------SRKELRGLESRKISLEALQ-SAALGGQSEE
Q2SD45_HAHCH          ------------------------------ARTCEQTLKGEQASLLALQ-KHDSQASRQE
E4PL89_MARAH          ------------------------------ERQRVQSLRASLESQQSLL-DEQMGAGDDV
E1V8E9_HALED          ------------------------------DRQRRSTLQGELASLEALI-QAALADHDEH
D3SAL9_THISK          ------------------------------AEREAREVAGRLAGLEHFAGEDDPAETRER
SMC_METCA             ------------------------------ARAGLHAVQGKVASLETLQ-RHAMGRDRSA
SMC_COXBU             ------------------------------QRRELQALEARAASLEALQ-KAALGESDGK
Q5WTI1_LEGPL          ------------------------------LQDEFHRLNTELAALKAAQ----IAAKKEN
Q12L80_SHEDO          ------------------------------LTTTLTSAKARHQVIEEWLAG---------
Q080K7_SHEFN          ------------------------------LKQTVTRHHSRLQFIDELLAD---------
A4Y804_SHEPC          ------------------------------IQQKLTATQARFDLVEQWLSK---------
D4ZIY3_SHEVD          ------------------------------LSQSLAEERGRLALITKLLLD---------
B0TKB4_SHEHH          ------------------------------LKVKLADEQGRLSVVSQLLPT---------
A3QFJ7_SHELP          ------------------------------LSQSLAEERGRLAVVKRILP----------
A1S5R5_SHEAM          -----------------------------------SEAQGRYSVLSRLLDDN--------
Q5QUJ9_IDILO          ------------------------------NQQQQDKAQAQLTAIEQLLEGKQNNDSRSE
E1SMV2_FERBD          ------------------------------LNAEQVRLEAQMASLGTLLKAR-------E
F2GBA5_ALTMD          ------------------------------VQGELQTAQSTKSALEALQQDAMSSEDIVL
Q15UZ3_PSEA6          ------------------------------VQGELQTIEAQIKALQGVQNLARGHEDYQQ
Q3IKC0_PSET1          ------------------------------LSQQANELKASIAGLSSTLGLD--------
A4SKA4_AERS4          ------------------------------QSGLLRELEARLTTLDQILGEQ--------
D0KWM8_HALNC          ------------------------------LRQNADALQAERRGLERALAAHQTSKD---
A0A2W1K6W8_ACIFR      ------------------------------TRAKAQEYGARQKALEGLLQRLQKPQA---
A0A0J1A050_ACIBA      ------------------------------LKTEIQVLLSEQKNLSQLVAKQSPKQN---
B3E294_GEOLS          ------------------------------RRDALSQNRSRLTSLQELEAQFAGYGQGVR
A1AU91_PELPD          ------------------------------GRDELNRASSRLHSLQELEAQFAGYDRGVR
B9M6F0_GEODF          ------------------------------KRNQFTAKSSRLKSLQELEAQFAGYGQGIR
Q39WG2_GEOMG          ------------------------------RRDELSRKSSRLHSLQELEAQFAGYGQGVR
B5EFS9_GEOBB          ------------------------------LRDQLSSASSRLKSLQELEAQFAGYGQGVK
Q3A212_PELCD          ------------------------------GQGRLGECRSRLQSLEQMERNLEGYGAGVK
A9FIZ2_SORC5          ------------------------------AKNELGQRRNRLRALEELHARLEGVGAGVK
D0LY52_HALO1          ------------------------------LRGELHRRRSRLQSLVEIQDKYEGFARGTR
Q1D2R5_MYXXD          ------------------------------LREELSDKRSRLSTLEDIQKNYDGFDRGVR
B4UDF6_ANASK          ------------------------------LREELAEKRSRLQSLLEIVRNYEGYGRGVR
Q6MNS9_BDEBA          ------------------------------FKDSLNEVASRLYGLENLQNNFEGFQEGVK
A9A0M3_DESOH          ------------------------------LDMERNRIKSRHSAIKKMDDNFEWYKDGVQ
B8FHS3_DESAL          ------------------------------LDMERSKSKSQLSALKRMEGNMEWFQKGVR
E1QL74_DESB2          ------------------------------QAKAHQALSAGVEALELSLGSLNWAAESVR
B3EFQ6_CHLL2          -------------------------------RAERASVDNRISLADAVLENFEGLPEGIE
A1BDT4_CHLPD          -------------------------------RSERDQLRNQIMLANAVLDNFEGLPEGIA
A4SG64_CHLPM          -------------------------------RSSHNQLHNQILFANSILENFEGMPEGIG
SMC_CHLTE             -------------------------------KSEHNHLNNRIALCNSILEKFEGLPEGVA
Q3ATI3_CHLCH          -------------------------------RSTRDALNNRIALANALLDTFEGMPEGIA
B4S519_PROA2          -------------------------------RAEKDRLHNRIILANSILDNYEGLPEGIA
B3EM83_CHLPB          -------------------------------RSRRDQLRNRILLANSILDDYEGLPEGIS
B3QRZ4_CHLT3          -------------------------------RSDLNARQHRIAFLKSLLESYEGLPEGIA
D0MFL5_RHOM4          -------------------------------ERRLEAVQAEARLLEQVLTAYEDFPEAVP
Q2S457_SALRD          -------------------------------ERRRDAAEAEVELLEGLVGSYDEVSDAVQ
C7PLU2_CHIPD          -------------------------------NRTLDQKKNEYDLLKSLVDSLEGYPESIK
E4TVF1_MARTH          -------------------------------SRKLDARENEYNLTKSLVDNLEGFPEAIK
B2KBE7_ELUMP          -------------------------------KAQAAALNARLEMIQS-QGKNDPYWVGAK
B1H0P2_ENDTX          -------------------------------KETLVSDEARIATLKE-FDQQDPVRSSIR
E4TEW8_CALNY          -------------------------------LKVTKSTREQQLKLIEAEVKKQSYGEELS
D3PDY1_DEFDS          -------------------------------KKLLKESYEKEIKLILNQIDNYTFGENNS
D4H2V6_DENA2          -------------------------------KQIEVKSINSRIKMLTQSLDAESASDDIK
D6YSC9_WADCW          -------------------------------SQERAEIKARQNALLRLREEMDGFSKGAK
Q04TU9_LEPBJ          -------------------------------EKSKIRSVLGALDLGELRFKLEEF-----
E1R6H6_SEDSS          -------------------------------KQSLVEDALKLD-----------------
Q73ML2_TREDE          -------------------------------KKAIFSDFASIE-----------------
A0A0H3BKB7_TREPS      -------------------------------RARIVSDFLVVD-----------------
E0RSK7_SPITD          -------------------------------RREILQDFKRLG-----------------
D5EMY0_CORAD          -------------------------------DRGIARKTAQLNVLEGLQAKFEGFGEGAK
B1ZZB8_OPITP          -------------------------------DRQLAQRTARLRLLQQLQERWEGFGEGAK
SMC_DESHY             -------------------------------NRDLEKKSARYHALKNLEDSLEGYQRGVR
A4J682_DESRM          -------------------------------KEEMVAKHSRLKVLEENLNSHTGFIKPVR
Q67PF3_SYMTH          -------------------------------REEMQAASSRLRTIEELISGFEGYQRGPR
B0TGW8_HELMI          -------------------------------MRRWQEVSARRKAIEAMEKTYEGFASGVR
Q2RJX0_MOOTA          -------------------------------KEQQRLLVARLKVLRQAQADYEGFGEGVR
SMC_BACSU             -------------------------------YQYVQQARSKKDMLETMQGDFSGFYQGVK
C5D8T7_GEOSW          -------------------------------YQYLQQTKSRKEMLEEMQQDYAGFFQGVK
D5DQR5_BACMQ          -------------------------------YQYVQQTKSRKEMLEEMQEDYEGYFHGVK
B7IUK7_BACC2          -------------------------------YQFVQQARSRKEMLEEMQEDYSGFYQGVR
Q9KA07_BACHD          -------------------------------YQLIQRLTSRKDVLEEMQADFSGFFQGVK
Q5WFM8_BACSK          -------------------------------YGLLQKITSRREVLQEMEAEYAGFFQGVK
Q7ZAM6_OCEIH          -------------------------------YQYIEKLKSKKEMLEEMKEDYQGFFHGVK
D6XTT7_BACIE          -------------------------------EKEHQRKRSRRDVLKDMEEDYAGFFHGVK
Q81ZN4_ENTFL          -------------------------------MNQVQQAKARQKSLQEIQENYAGFYQGVK
A0A0E0UX46_LISMM      -------------------------------YETVQQMKSRKETLEELADDYAGFFQGVR
B1HQH6_LYSSC          -------------------------------YQHQQQLKARKDTLAELEADFSGFFQGVK
C6D303_PAESJ          -------------------------------EQKLDAQVSRRDTMKEMQDALDGFMHGVR
C0ZFN9_BREBN          -------------------------------EQKREAAKSRFDLLKEMQSEFAGFQQGVK
C8WWA4_ALIAD          -------------------------------QADVQGLSSRLELLRDLEAGYDGYAHGVR
D5WPA2_KYRT2          -------------------------------REQLAALVSRWEVMKDLEESYGGYGRGVK
C4L5Z7_EXISA          -------------------------------ERRRQKTEDRIEMLERMKQSYEGYFHAVK
B1YIN0_EXIS2          -------------------------------HRRRDKTEDRIEFLESVKADYSGYFGAVK
D3R1B0_MAGIU          -------------------------------TNREQQATFRLKTLSELEKNYDGYQASVQ
D2RLB2_ACIFV          -------------------------------RRTLNQKKARLQVLSAMEREHEGFSKGVR
D1BLY1_VEIPT          -------------------------------RTQEQRAKGRLELLAQWEEQHEGYLEGTK
A5UQ60_ROSS1          -------------------------------RRQQMELEARLETLRRLHRSYAGTFAGVR
B8G556_CHLAD          -------------------------------RHTVAEREARLEALTRLARSHAGAFAGVK
A9B100_HERA2          -------------------------------RREADALHSRLDALRRTAAAGAGMFTGVR
D1C6T1_SPHTD          -------------------------------ERRLVERTTRLEALTRLRDSGAGLYAGTR
D7CMX2_SYNLT          -------------------------------QAELYKAEQELNLYFDEERDGRTYPEAVR
Q0AYV7_SYNWW          -------------------------------NQRSIEINNQLLAIKDLQRNLTGYSPAVK
SMC_LACPL             -------------------------------AGLMQREKSRLEALQAVQERYTNFYAGVR
Q03RT7_LACBA          -------------------------------LEVYQRAQTKVANQQASSAEYGGFYQGVR
B2GD41_LACF3          -------------------------------LGDVSSAEGRIKSYQSMVADYTGYYHGVQ
A5VKP1_LACRD          -------------------------------LGDVRSLKSRINAYQSMADEYSGYYRGVQ
Q03FW9_PEDPA          -------------------------------SNVAHRAESKLEALLNLKNEYTGFYQGVR
A0A249N2C3_LACRH      -------------------------------MATYQRARARYETLSELNEDYAGFYNGVR
Q38XR7_LACSS          -------------------------------SGILQKAKAKQASLAELNDDYAGFYQGVK
Q1WU99_LACS1          -------------------------------WDIYQRVQTKLETLKSISDSYTGYYQGAR
Q04GL1_OENOB          -------------------------------LASYNQIRIRSESLQNA-NANLDLFVGVR
Q03VW6_LEUMM          -------------------------------LDELNKARSHRDALNSL-DEYAGFYQGVR
A0A0U5K8Z4_LACDE      -------------------------------LTNLQRLTAHRDALVNIQKRHDGYYAGVK
E4SKB3_LACAR          -------------------------------RGKLEKIEARHEALVNIQKRHEGYYYGVR
Q74IP9_LACJO          -------------------------------KNDLQQLSAQVKGLKKIRNRHEGYYYGVK
A0A0T8KIP4_STREE      -------------------------------LDSLKNKQARAQSLENILRNHSNFYAGVK
A4VVL7_STRSY          -------------------------------LDQLKGKQARQSSLEAILKNHSNFYAGVK
C0MCR5_STRS7          -------------------------------LDQKKAKEARKASLVSIQKNHSQFYAGVR
A2RLZ7_LACLM          -------------------------------LQELNQHKARLTSLQNIRESHSNLFAGVR
B9EBB4_MACCJ          -------------------------------DRFISTLESKVHRLKTMQEEYQGYYQGVR
SMC_MYCHR             -------------------------------LEKKSAAAANINILKQQFENKSFLSKGIK
E0TKT8_MYCHH          -------------------------------LEKKSAAAANINILKQQFENKSFLSKGIK
Q4A770_MYCH7          -------------------------------NSEKIISQTRISELKKSLESMSFLPKGTK
C5J708_MYCCR          -------------------------------ISERSKNEAQILQLQKVLETKAFLSKGTK
A5IYM7_MYCAP          -------------------------------ENDIFKIQTHLNLLKQQKEGNTLLYKGTK
D5E4P4_MYCCM          -------------------------------KTKKVKLETKLQILEDQKENKTNLFKGTK
Q6KHN4_MYCMO          -------------------------------QAKYNKTKTQIEILLDYQKNKTNLFKGTK
Q98PK8_MYCPU          -------------------------------SNKLNETKVKINILLEHKKNKTNMFKGTK
D1J8Q8_MYCHP          -------------------------------KEELNKIKSKLDVIEEIKSKKTNLAKGTH
Q4A588_MYCS5          -------------------------------KNAVSNAKAGLDFAKREKESNSSLQKGVR
SMC_MYCGE             -------------------------------TADLIYQRSLKTIIELQ-TNELKK-TNNA
SMC_MYCPN             -------------------------------SAALVYQQAQQEFLKAQ-NEEWVK-TNPA
Q7NBU0_MYCGA          -------------------------------QVKRYEANLQVQFYQNQKINQFAQ-DAGV
Q8EVS6_MYCPE          -------------------------------SKTVTKQESDLEHLSVLLKSKPNF-GGGA
Q9PR04_UREPA          -------------------------------IWEIASKNLKKEMLEEQFKRQTEN-ERGV
Q6F1N4_MESFL          -------------------------------ESEKNKLQYRLEELEHKQNTNNLNPMSGA
Q6MTD2_MYCMS          -------------------------------RITISRISIQIEAIEHNKKAALQSYQDEV
E3GP81_9FIRM          -------------------------------ENNYKVNLSQRDYLKSVQKNYSDYFPSIR
SMC_HALOH             -------------------------------RNKLNEKNSHLSILHEMEDSLEGYYRGVK
E4RL35_HALHG          -------------------------------KEDFQHCSSRLQLMEEMQQSYEGYYNGVR
D9QRN7_ACEAZ          -------------------------------DSKRNNYQSKLDVLENMQQKYQGYYRGVK
A8MHB7_ALKOO          -------------------------------QNHLRNKEARRTVIEDMEREHEGYNKSVK
A6TRT3_ALKMQ          -------------------------------KNSINYKTSRKNILMEMEREHEGFHKSVK
A3DDY2_HUNT2          -------------------------------RSQIQIMTSRQKMLIDMERNLEGYNRTVR
D5X8N2_THEPJ          -------------------------------TEEKQKLASKLKALEEMEQDYEGYHKGVR
D9R048_CLOSW          -------------------------------QQEYHTSYTKLESLRNIAERYEGYGGSIR
C4Z0E6_EUBE2          -------------------------------VQNYHREKSRLESLINITERYDGYGNSIR
C4Z924_AGARV          -------------------------------STEYHKSVSRLESLKNIAERYDGYGNSIK
E0RV40_BUTPB          -------------------------------TEKYQQEKSRLEALANLTERYEGYGGSVK
A9KLR0_LACP7          -------------------------------NQSYLSMNAKLDSLKNLTERYDGYGNSIR
D9S347_THEOJ          -------------------------------IILLNELKSRYRALEEINQNYEGYQLGVK
B2A2N3_NATTJ          -------------------------------NQRLQGYKSRYEALKEFYNS-DSFSRGVR
A8F8R1_PSELT          -------------------------------RRMLRSLDEEESRIKYRIQTYEGYTRSVR
A5IN04_THEP1          -------------------------------ERRLREILFEKEMIERDMREYKGFSRAVR
C5CIS4_KOSOT          -------------------------------MEELRRSQIERNTLERQQLEYQGFSRAVR
A7HMD4_FERNB          -------------------------------VKREKEVKAEIDVIKRQISEYQGFGHSIR
B7IHN5_THEAB          -------------------------------VHRKKEIQSEIFVIQKQLNEYQGFSNAIK
SMC_THEEB             -------------------------------EREQRQKQRELDQLEARQQAVQE-----T
Q2JHS4_SYNJB          -------------------------------TVELHAKQRQLDKWETRRQVLQE-----S
SMC_SYNP6             -------------------------------LKEQRDKQRQLDRQESLRQAMQE-----T
B0C9C4_ACAM1          -------------------------------LREQQEKQRQLDKLEAQEQAQQE-----V
Q115J3_TRIEI          -------------------------------LQEQRDRQRKLDKLEAQQQAIQE-----A
B2J925_NOSP7          -------------------------------LFEQREKQRQLDKIEAQTQAQQE-----V
E0UKI1_GLOV7          -------------------------------LKEQRDKQRELDKLEATQQAQQE-----A
B7K4Q6_RIPO1          -------------------------------IKEHREKQRQLDRLEASQQAQQE-----A
B0JSN6_MICAN          -------------------------------LKEQRDKQRELDKLEATKQAQQE-----A
SMC_SYNY3             -------------------------------LKEQQEKQRQLDKLEAASQAQQE-----V
Q84EC7_SYNP2          -------------------------------QREQRDKQRQLDQLEARSQAQQE-----A
D3EQ04_ATETH          -------------------------------DKEYREKQRQLDRLEASRQAKQE-----V
SMC_GLOVI             -------------------------------EKERTEKARELDRLETQRQVWRE-----A
A5GQT1_SYNR3          -------------------------------EQEQQQLERDIARHDSRRETLQE-----S
A9B9B9_PROM4          -------------------------------EKDQARMEKEIARLESRRETLNE-----S
A2BNJ6_PROMS          -------------------------------NNEQLRLEKDLSRFESRKEALNE-----S
Q46EX0_METBF          -------------------------------ENRLHGLQQEYTITETRVRASEQGRGYSR
D7EAF5_METEZ          -------------------------------EEELRKHQQEYAQVEARVRAAEENSKYSK
D1YW78_METPS          -------------------------------EEKLRKLQEEFAKAEARVRAYEDLDGYSE
A0B8B9_METTP          -------------------------------DRSLQRLQSEYARVEAQVRAAEERSGYSR
D4GT30_HALVD          -------------------------------TDELQTKQSEYARLEARAGKDGDNS-WPR
A7IAD8_METB6          -------------------------------RGEIRDAEQDAFRLEAAQQAR--------
A3CWK7_METMJ          -------------------------------KKEIRENEQNLMRLEAQQQAH--------
B8GG37_METPE          -------------------------------RKELKAREQELMRYEAQQQVQ--------
E1RII6_METP4          -------------------------------RNEIRGLERDLMRLEAQQQAS--------
Q2FLH3_METHJ          -------------------------------IRQIRDLKVEIGRKEAQQQAQ--------
A2SS75_METLZ          -------------------------------REEIARLTKKQMQIEAQQQAS--------
D3RYW2_FERPA          -------------------------------EEKIKEKEIELTKIRTEISSRE--AFFGK
O28714_ARCFU          -------------------------------EDELKKAELELAKVKATLSTL---RTYSK
D2RFP2_ARCPA          -------------------------------DKEIREKEIELAKVSAIQKPR--------
SMC_THEAC             -------------------------------KSEISEKEASAKIASSRVPEYVR------
Q97AI9_THEVO          -------------------------------SSQISAAEATARASVPRQIDRAS------
SMC_METVO             -------------------------------HSEYVKENARIKTLKDMENFSL-------
A6UQ42_METVS          -------------------------------HAEYIKENARIKTVKDMEDFSL-------
A6UVP1_META3          -------------------------------YSEYAKENAKIKALKEMKKFNV-------
SMC_METJA             -------------------------------HAEYVKENARIKALKEMEELSM-------
C9RFQ3_METVM          -------------------------------HAEYIKENARIKAIKEMEELSI-------
D5VT24_METIM          -------------------------------NSEYLKEKAKIKAL---EEINL-------
D3SQ87_THEAH          -------------------------------REERENLLKEIAVLESKIRDL--------
D3DG53_HYDTT          -------------------------------RKEREELIKEKAMLEAKLMSS--------
SMC_AQUAE             -------------------------------RKKLEEVLKEKGAIEREVRSF--------
B4U7R1_HYDS0          -------------------------------KKEIEQIISEKARIESQLRYN--------
C0QSN8_PERMH          -------------------------------REKREKNFQRLAEVLAQLSQM--------
B2V736_SULSY          -------------------------------REKLEKNFQELAKVLAQLSNI--------
SMC_PYRFU             -------------------------------SKELESSERELIAAEAQREVRG-------
C5A612_THEGJ          -------------------------------DPELAKAREELIKAEAQREARG-------
D1CC09_THET1          -------------------------------SLQLREVQSREKILDDISKSAADMQPGVR
D3TAQ9_ACIB4          -------------------------------DNEVKELSIEYEKIKARMESSQDALSRAV
SMC_HALMS             -------------------------------SKSLITKESKLSSLQEIAAAMDGVREGAV
Q6L0R1_PICTO          -------------------------------NSKIKSLERELRNLNYRPVVSEALKEIYT
C1A7M6_GEMAT          -------------------------------VELRTELEARMNALAALERERVGLAPSSA
C9RN51_FIBSS          --------------------------------NEEARLQSRIDVLQSVMNEGSDANRYLK
D1B5Z0_THEAS          --------------------------------EETLELQVLPKPVQGIVSAARLGKVR--
                                                                                  

SMC_FUSNN             EVLNSGIS---------------------------------------------------G
E3H7H1_ILYPC          EILNAGIE---------------------------------------------------G
D1AK68_SEBTE          LILNKKID---------------------------------------------------G
SMC_CLOK1             ALMENIKNHKLDV--------------------------------------------PAQ
D8GS00_CLOLD          SLMKDIKDKAVRV--------------------------------------------PEN
Q97IA1_CLOAB          NLMQHVTKGFVDV--------------------------------------------KPE
A0Q0Y7_CLONN          NLMKHVEEEKIQN--------------------------------------------AKG
Q895M7_CLOTE          NLMKAIQRGHIKN--------------------------------------------ALN
Q0SSA4_CLOPS          KIMASVDAGRVKI--------------------------------------------NKN
A6LSM4_CLOB8          SLMESIHRERITA---------------------------------------------AN
D9SLC7_CLOC7          NLMSHIKENRIDN--------------------------------------------LQG
D7APA8_THEM3          NLLKLSENI-PSF--------------------------------------------KEN
Q8R9W7_CALS4          KLFKVAD--------------------------------------------------KRG
D9TN88_THETC          NLMKYVETD-NKV--------------------------------------------KQN
C9YKI7_CLODR          EVLKNKN--------------------------------------------------LKG
E3PS49_ACESD          EVILNRN--------------------------------------------------LNG
B0S1M4_FINM2          NFFKKINSK---L--------------------------------------------HEK
Q3AC59_CARHZ          NLFEAKKSGLLPN--------------------------------------------PDN
E4SF58_CALK2          EIFKRVKN----L--------------------------------------------PIC
SMC_RHOBA             EVL---RMSNAELKK--------------------------------------------D
D2QWB0_PIRSD          ALLAEARFATEGPLT--------------------------------------------K
D5SU17_PLAL2          EILHRARTTRQAPWD--------------------------------------------S
SMC_KORVE             RLFQSG--GLREGN---------------------------------------------T
C1F1T5_ACIC5          KLFRAN--TLGEGL---------------------------------------------K
Q01Y77_SOLUE          RLFASLEKGKADDL---------------------------------------------K
SMC_MYCPA             ENHS-----------------------------------------------------GAG
SMC_MYCTU             HNRS-----------------------------------------------------GAG
SMC_MYCLE             RNYS-----------------------------------------------------DTG
A4FMG9_SACEN          AGDR-----------------------------------------------------VPG
C8XH72_NAKMY          AGAD-----------------------------------------------------APG
D7GEI0_PROFC          AG-------------------------------------------------------VPG
Q2J6Z3_FRACC          AATGAQTGQTASNTAEDSA---------------------------------PALDPTLE
A8L599_FRASN          AAAGETTPADAGTGAAGDGGNSAGEGAGGGGRKRRPGRGGRNDPRQAVPAQLPPLEPSVQ
C9Z3S1_STRSW          AKDR-----------------------------------------------------LAG
D7CC86_STRBB          SADR-----------------------------------------------------LTG
B1VYX5_STRGG          DRDR-----------------------------------------------------PAG
E4NHH3_KITSK          R---------------------------------------------------------PG
C7QGY1_CATAD          ATDR-----------------------------------------------------LSG
A0LV82_ACIC1          AA-------------------------------------------------------VPG
A0JXV4_ARTS2          ADSG-----------------------------------------------------LPG
A1R7H8_PAEAT          SLLT-----------------------------------------------------AEG
A6W7T9_KINRD          AGSA-----------------------------------------------------LSG
D1BJA3_SANKS          AGT------------------------------------------------------LDG
C7NGM6_KYTSD          EGAP------------------------------------------------------AG
B2GFM7_KOCRD          VVP---------------------------------------------------------
E1VVN2_GLUAR          STSA-------------------------------------------------------Q
A5CQQ2_CLAM3          AGLP-------------------------------------------------------G
Q6AE90_LEIXX          ARPT-------------------------------------------------------G
D1AB24_THECD          AGDL------------------------------------------------------EG
D6Y659_THEBD          GAGL------------------------------------------------------PG
D7BMZ9_ARCHD          IETQ------------------------------------------------------PG
D6ZIF1_MOBCV          AELS-------------------------------------------------------G
C7R311_JONDD          D-----------------------------------------------------------
D6ZV06_BIFLJ          DTDV-------------------------------------------------------A
Q7ZAJ9_COREF          VLD---------------------------------------------------------
Q8NNW5_CORGL          VVD---------------------------------------------------------
Q84F13_CORDP          LQS---------------------------------------------------------
Q4JUZ1_CORJK          AADKEG-----------------------------------------------------I
C4LJD3_CORK4          NSSVE-------------------------------------------------------
D6Z8M0_SEGRD          HASAK-------------------------------------------------------
C8WGU5_EGGLE          WLMD-------------------------------------------------HAVDLDV
C7MMZ7_CRYCD          WGAN-------------------------------------------------AAAQPSG
C7N560_SLAHD          LMSR-------------------------------------------------QGFELDG
E1QVK5_OLSUV          LLAK-------------------------------------------------EGS--GY
C8W740_ATOPD          KLVS-------------------------------------------------DTATASL
SMC_RHOPA             ----------------------------------------------------------KN
A7IGT2_XANP2          ----------------------------------------------------------DH
B8EMM7_METSB          ----------------------------------------------------------GD
B8IQU0_METNO          ----------------------------------------------------------GT
Q92RE8_RHIME          ----------------------------------------------------------GS
A7HQY9_PARL1          ----------------------------------------------------------SD
D8JUP9_HYPDA          ----------------------------------------------------------EG
E3I0B2_RHOVT          ----------------------------------------------------------AG
SMC_RHOS1             ----------------------------------------------------------AQ
Q2W040_MAGSA          ----------------------------------------------------------GG
D3P3X3_AZOS1          ----------------------------------------------------------GG
B6IR58_RHOCS          ----------------------------------------------------------GD
Q2RPA2_RHORT          ----------------------------------------------------------KG
SMC_CAUVN             ----------------------------------------------------------KS
B0T003_CAUSK          ----------------------------------------------------------KS
Q0AMJ6_MARMM          ----------------------------------------------------------AE
E0TC69_PARBH          ----------------------------------------------------------PE
C6XRC2_HIRBI          ----------------------------------------------------------SQ
Q0C0X5_HYPNA          ----------------------------------------------------------AT
Q1GQU3_SPHAL          ----------------------------------------------------------QS
D4YX43_SPHJU          ----------------------------------------------------------TG
Q2G9S3_NOVAD          ----------------------------------------------------------KG
D5BSU5_PUNMI          ----------------------------------------------------------EN
A5FVJ2_ACICJ          ----------------------------------------------------------GR
C5B6I7_METEA          ----------------------------------------------------------GS
Q937L3_DEIRD          ----------------------------------------------------------PG
Q1J060_DEIGD          ----------------------------------------------------------PG
L0A7J5_DEIPD          ----------------------------------------------------------PG
D7BH70_MEISD          ----------------------------------------------------------EG
SMC_THASP             LGDWLERHGLDQL-----------------------------------------------
A1K715_AZOSB          LGDWLRRHGLAEL-----------------------------------------------
C7RKG8_ACCPU          LDEWLRRHGLQHG-----------------------------------------------
Q3SJI0_THIDA          LGAWLGAHGLGDA-----------------------------------------------
SMC_DELAS             LQPWLAKHGLDGM-----------------------------------------------
D6CTE6_THIA3          LRPWLAKHGLDGL-----------------------------------------------
SMC_BORPD             LEPWLAKHELAGL-----------------------------------------------
SMC_BURP1             IQPWLDKHELGAL-----------------------------------------------
A4SYV7_POLAQ          IGPWLESKGLKES-----------------------------------------------
D5CRW3_SIDLE          LKAWLNRHQLDNA-----------------------------------------------
D9SGR3_GALCS          LQDWLGRHGLDAL-----------------------------------------------
Q2YBB9_NITMU          LNTWFARHRLDSL-----------------------------------------------
Q0AE88_NITEC          LNAWMTRNQLDVL-----------------------------------------------
D7DI79_METV0          LSSWLKNAGLDNN-----------------------------------------------
C1D4R7_LARHH          --DWLAREGLADA-----------------------------------------------
Q7NR76_CHRVO          --GWLETHGLADA-----------------------------------------------
A1KSF4_NEIMF          --DFWQATDHAAA-----------------------------------------------
A1WY82_HALHL          RHAWLERRGWAGA-----------------------------------------------
Q0AAV4_ALKEH          LEDWLSAREWQQR-----------------------------------------------
SMC_XANOR             AVAWLKSRGLDSA-----------------------------------------------
B8GTL2_THISH          VVQWLAGQGLADA-----------------------------------------------
Q3JAH9_NITOC          ADAWLAQQNLADS-----------------------------------------------
D3RSW0_ALLVD          RRDWLASRGLAGA-----------------------------------------------
B3PGR0_CELJU          VKEWLVQQGFTAN-----------------------------------------------
A6V7X5_PSEA7          ALEWLREQGLEQR-----------------------------------------------
Q0VR03_ALCBS          VSDWLTRHELDDE-----------------------------------------------
C7RBE2_KANKD          SVSWLKQQGLDSK-----------------------------------------------
Q2SD45_HAHCH          ALEWLALHEIDAA-----------------------------------------------
E4PL89_MARAH          LQSWLSQNALSDM-----------------------------------------------
E1V8E9_HALED          LDTHLAEHGLEGA-----------------------------------------------
D3SAL9_THISK          REAWAREQGLDLS-----------------------------------------------
SMC_METCA             AAAVLEAWQLSAA-----------------------------------------------
SMC_COXBU             ISEWLSSQQLKEN-----------------------------------------------
Q5WTI1_LEGPL          RPNKDGIAEWSDK-----------------------------------------------
Q12L80_SHEDO          ------EQESDGS-----------------------------------------------
Q080K7_SHEFN          ------HTQDDG------------------------------------------------
A4Y804_SHEPC          ------QEQLSDK-----------------------------------------------
D4ZIY3_SHEVD          ------DENQSGA-----------------------------------------------
B0TKB4_SHEHH          ------DKD-GEC-----------------------------------------------
A3QFJ7_SHELP          ------QEDALQG-----------------------------------------------
A1S5R5_SHEAM          ----AVNDAGSAR-----------------------------------------------
Q5QUJ9_IDILO          K---WLQQNYPDS-----------------------------------------------
E1SMV2_FERBD          T---RLPAPFDHL-----------------------------------------------
F2GBA5_ALTMD          E---GVEKLWQQF-----------------------------------------------
Q15UZ3_PSEA6          Y---LLEKGIDSQ-----------------------------------------------
Q3IKC0_PSET1          -------NESEHH-----------------------------------------------
A4SKA4_AERS4          ----------MVG-----------------------------------------------
D0KWM8_HALNC          --DAPRAERLIQR-----------------------------------------------
A0A2W1K6W8_ACIFR      --QNDPAGSRLVD-----------------------------------------------
A0A0J1A050_ACIBA      ------QDTLRLM-----------------------------------------------
B3E294_GEOLS          LLMTESPLRSR-------------------------------------------------
A1AU91_PELPD          VLMQTPELRPR-------------------------------------------------
B9M6F0_GEODF          TLLSNDDFKSK-------------------------------------------------
Q39WG2_GEOMG          NLLLADTFRGR-------------------------------------------------
B5EFS9_GEOBB          NLLLADSFKGA-------------------------------------------------
Q3A212_PELCD          LLLQDTQLRAR-------------------------------------------------
A9FIZ2_SORC5          NLLKTKDPALL-------------------------------------------------
D0LY52_HALO1          AMMQAVQKPAPERQNL-----------------------------------------LAN
Q1D2R5_MYXXD          AVMTRAGV-QAREQG---------------------------------------------
B4UDF6_ANASK          SLMTRAGQDEPRDHG---------------------------------------------
Q6MNS9_BDEBA          QVMLWQKTRTQEMMADGS---------------------------------------VVS
A9A0M3_DESOH          ALMRNAAGRAAEDG----------------------------------------------
B8FHS3_DESAL          EVVAWDQEANKEDSR---------------------------------------------
E1QL74_DESB2          QVVAAAQAGQLPVA----------------------------------------------
B3EFQ6_CHLL2          FLEKQKS--------------------------------------------------SEA
A1BDT4_CHLPD          FLEKQNK--------------------------------------------------PKS
A4SG64_CHLPM          FLEKHKD--------------------------------------------------GRP
SMC_CHLTE             FLEKQRA--------------------------------------------------GKP
Q3ATI3_CHLCH          FLEKERQKNGGLEGH-------------------------------------EGHGGNNS
B4S519_PROA2          YLETNPE--------------------------------------------------TKR
B3EM83_CHLPB          WLENGKQ--------------------------------------------------GKT
B3QRZ4_CHLT3          HLEKSAA--------------------------------------------------PRY
D0MFL5_RHOM4          FLARTSG-------------------------------------------------WTEA
Q2S457_SALRD          FLAAEEL-------------------------------------------------FDD-
C7PLU2_CHIPD          FLKKNTE--------------------------------------------------WNN
E4TVF1_MARTH          FLKKSSK--------------------------------------------------WGK
B2KBE7_ELUMP          LIEEAGI---------------------------------------------------PG
B1H0P2_ENDTX          AVLSLG----------------------------------------------------NV
E4TEW8_CALNY          -RYFDEN---------------------------------------------ELSLLLDY
D3PDY1_DEFDS          VDFLKEF---------------------------------------------QQGLLIDF
D4H2V6_DENA2          -QILEAT---------------------------------------------GGTLLLPK
D6YSC9_WADCW          RIIREAG---------------------------------------------QVGSFLYK
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          AILGNKL---------------------------------------------EDVVAKDS
B1ZZB8_OPITP          AVLQGRL---------------------------------------------DGALAGAK
SMC_DESHY             ELMLAKKKNQP---------------------------------------------SCGD
A4J682_DESRM          ELLRAVTNNNS---------------------------------------------RALG
Q67PF3_SYMTH          TVLQGREKGAP---------------------------------------------WAAD
B0TGW8_HELMI          EVLAQVKAGNP---------------------------------------------QLQG
Q2RJX0_MOOTA          AILQARSRGEA---------------------------------------------ACAG
SMC_BACSU             EVLKAKE-------------------------------------------------RLGG
C5D8T7_GEOSW          EILKARA-------------------------------------------------QFPG
D5DQR5_BACMQ          EVLKARDE------------------------------------------------KLAG
B7IUK7_BACC2          EVLKAREN------------------------------------------------RLQG
Q9KA07_BACHD          EVLKARHS------------------------------------------------TLKG
Q5WFM8_BACSK          EILKQRGS------------------------------------------------SLSG
Q7ZAM6_OCEIH          SILKAREDK-----------------------------------------------KLQG
D6XTT7_BACIE          DILKQRDG------------------------------------------------NFHG
Q81ZN4_ENTFL          AVLRH--KN-----------------------------------------------QLTG
A0A0E0UX46_LISMM      EVLKA--KK-----------------------------------------------EIPG
B1HQH6_LYSSC          EVLLARDKG-----------------------------------------------ELQG
C6D303_PAESJ          EVLKASRKSSGSG-------------------------------------------GISG
C0ZFN9_BREBN          EILKARER------------------------------------------------GFKG
C8WWA4_ALIAD          MVLQQARRG-----------------------------------------------ALKG
D5WPA2_KYRT2          TVLTAAKAG-----------------------------------------------KLSG
C4L5Z7_EXISA          FVLK--DRS-------------------------------------------------PG
B1YIN0_EXIS2          TVLKQRDRI-------------------------------------------------AG
D3R1B0_MAGIU          SLLSPRGIAPD---------------------------------------------QRRG
D2RLB2_ACIFV          TVLNARAA------------------------------------------------FRPK
D1BLY1_VEIPT          NILNGKGS------------------------------------------------WREQ
A5UQ60_ROSS1          AAMQWAESQ-----------------------------------------------HRSG
B8G556_CHLAD          AALEWAERN-----------------------------------------------GRTG
A9B100_HERA2          AALQWAEKQ-----------------------------------------------H-QQ
D1C6T1_SPHTD          AVLDAARAG-----------------------------------------------HLQG
D7CMX2_SYNLT          AVMRAARDKQY---------------------------------------------GLNG
Q0AYV7_SYNWW          SIIKQARSG-----------------------------------------------RLQG
SMC_LACPL             MVL--QHR-----------------------------------------------QQFSG
Q03RT7_LACBA          AIL--KQR-----------------------------------------------QHFHG
B2GD41_LACF3          QVL--RKR-----------------------------------------------QAYPG
A5VKP1_LACRD          EVL--RQR-----------------------------------------------QQFPG
Q03FW9_PEDPA          AVL--QQK-----------------------------------------------AQFRG
A0A249N2C3_LACRH      VVL--KHK-----------------------------------------------ASLPG
Q38XR7_LACSS          AVL--KQK-----------------------------------------------QQLPG
Q1WU99_LACS1          EVL--KER-----------------------------------------------KNISG
Q04GL1_OENOB          NLL--ANR-----------------------------------------------QSFPG
Q03VW6_LEUMM          ALM--KPQT---------------------------------------------LEKFSG
A0A0U5K8Z4_LACDE      QVL--NQP-----------------------------------------------DRFPG
E4SKB3_LACAR          NVL--NNM-----------------------------------------------NAFPG
Q74IP9_LACJO          YVL--NHQ-----------------------------------------------SDFHG
A0A0T8KIP4_STREE      SVL--QEK-----------------------------------------------DRLGG
A4VVL7_STRSY          AVL--QAA-----------------------------------------------PSLGG
C0MCR5_STRS7          AVL--QAA-----------------------------------------------GKLDG
A2RLZ7_LACLM          AVM--QNA-----------------------------------------------SQIGG
B9EBB4_MACCJ          LLL--KNK-----------------------------------------------EKLDG
SMC_MYCHR             TIK--DNS----------------------------------------------FLF-DG
E0TKT8_MYCHH          TIK--DNS----------------------------------------------FLF-DG
Q4A770_MYCH7          III--ENS----------------------------------------------FLF-PG
C5J708_MYCCR          TII--DNS----------------------------------------------FLF-SG
A5IYM7_MYCAP          TIL--ENK----------------------------------------------AIFGKG
D5E4P4_MYCCM          TIV--ENK----------------------------------------------SLF-KG
Q6KHN4_MYCMO          TIL--ENA----------------------------------------------SVF-DG
Q98PK8_MYCPU          TIV--EHK----------------------------------------------NIF-KG
D1J8Q8_MYCHP          NIV--ENS----------------------------------------------HLF-RG
Q4A588_MYCS5          TIV--QNR----------------------------------------------NIF-NG
SMC_MYCGE             NIL--VKN----------------------------------------------ANALTG
SMC_MYCPN             HVL--VKN----------------------------------------------VKALTG
Q7NBU0_MYCGA          RTV--LNN----------------------------------------------KDAIGG
Q8EVS6_MYCPE          KAI--LDN----------------------------------------------KQALTG
Q9PR04_UREPA          KTI--IDS----------------------------------------------QKALVG
Q6F1N4_MESFL          KAI--IDN----------------------------------------------AKRLSG
Q6MTD2_MYCMS          SAI--LNN----------------------------------------------QKQIGG
E3GP81_9FIRM          TIMNSREHL---------------------------------------------GDMINK
SMC_HALOH             NILKARS-------------------------------------------------KLTG
E4RL35_HALHG          SVLENKE-------------------------------------------------LFPD
D9QRN7_ACEAZ          NVLQYHQDNP----------------------------------------------EFAQ
A8MHB7_ALKOO          NILVACNKDKE---------------------------------------------LGKG
A6TRT3_ALKMQ          NALGICKKHSE---------------------------------------------LDQG
A3DDY2_HUNT2          VILQACRESHE---------------------------------------------FGKG
D5X8N2_THEPJ          EILKAGKQKK-----------------------------------------------LAG
D9R048_CLOSW          RVMEVRDR-------------------------------------------------IHG
C4Z0E6_EUBE2          KIMELKDS-------------------------------------------------NSG
C4Z924_AGARV          RVMEQKAK-------------------------------------------------NPG
E0RV40_BUTPB          KVMERKDD-------------------------------------------------TKG
A9KLR0_LACP7          RIMEQKDQ-------------------------------------------------EPG
D9S347_THEOJ          NLLSHLRSGKI---------------------------------------------NVSG
B2A2N3_NATTJ          EVLKLKENNPQ---------------------------------------------SWSG
A8F8R1_PSELT          AIFAKKAEA-----------------------------------------------PFDG
A5IN04_THEP1          AVFEEKER-------------------------------------------------FPG
C5CIS4_KOSOT          EIFSRSDD-------------------------------------------------FDG
A7HMD4_FERNB          KIFENKDI-------------------------------------------------FDG
B7IHN5_THEAB          RIFEQKDQ-------------------------------------------------FPG
SMC_THEEB             QGGFAARLILSAD--------------------------------------------LPG
Q2JHS4_SYNJB          QGSRATQAILSAR--------------------------------------------LPG
SMC_SYNP6             QGTAAARLILDTG--------------------------------------------LPG
B0C9C4_ACAM1          QGTHATHIIRKAK--------------------------------------------LAG
Q115J3_TRIEI          TGTYATKMLQQSG--------------------------------------------ISG
B2J925_NOSP7          QGTQASKVILQSG--------------------------------------------MPG
E0UKI1_GLOV7          QGTYATQVILQSD--------------------------------------------LPG
B7K4Q6_RIPO1          QGTYATQLILSSD--------------------------------------------LPG
B0JSN6_MICAN          QGTYATQILLQSD--------------------------------------------LPG
SMC_SYNY3             QGTYATKVILQSD--------------------------------------------LPG
Q84EC7_SYNP2          QGTYATKVILNAN--------------------------------------------LPG
D3EQ04_ATETH          QGTYASQFILNSK--------------------------------------------LSG
SMC_GLOVI             EGSRATQEVLGSG--------------------------------------------IQG
A5GQT1_SYNR3          RGTGALRLLLEAG--------------------------------------------LDG
A9B9B9_PROM4          RGTGALRLLLQSG--------------------------------------------LEG
A2BNJ6_PROMS          RGSYALRILLEAG--------------------------------------------LEG
Q46EX0_METBF          AVEMIIGAARQED--------------------------------------------LFG
D7EAF5_METEZ          AVDTVISAKNNKE--------------------------------------------LQG
D1YW78_METPS          AVGTIIGARNSHE--------------------------------------------LPG
A0B8B9_METTP          AVEAVRSAMKRGI--------------------------------------------LQG
D4GT30_HALVD          AVTTILNAG------------------------------------------------ISG
A7IAD8_METB6          GESGGKAIEAVKA--------------------------------------------IEG
A3CWK7_METMJ          GDAGGKAMDVVLG--------------------------------------------MEG
B8GG37_METPE          GDAGGRALEAVLG--------------------------------------------MDG
E1RII6_METP4          GGPGGNALDAVLG--------------------------------------------MDG
Q2FLH3_METHJ          GRYN-RAMEAVLG--------------------------------------------MDG
A2SS75_METLZ          GASD-RTISAILG--------------------------------------------MDG
D3RYW2_FERPA          AVELILEAKEKRA--------------------------------------------LPG
O28714_ARCFU          PVEILLDARNRRE--------------------------------------------LPG
D2RFP2_ARCPA          AVEVVLKAKEEGK--------------------------------------------LEG
SMC_THEAC             -----NVKMLEES--------------------------------------------VEG
Q97AI9_THEVO          -----QVEEIKKN--------------------------------------------ISG
SMC_METVO             --DRAVKGVLDAK--------------------------------------------LPG
A6UQ42_METVS          --DRAVKNVIDAK--------------------------------------------LPG
A6UVP1_META3          --NSTIQNILDAK--------------------------------------------LPG
SMC_METJA             --DRAIREILNAN--------------------------------------------LPG
C9RFQ3_METVM          --DRTIKEILNAK--------------------------------------------LPG
D5VT24_METIM          --DKAIKEVL--K--------------------------------------------LPG
D3SQ87_THEAH          --ELT--HLPFED--------------------------------------------IRG
D3DG53_HYDTT          --EGD--TLPFEG--------------------------------------------IEG
SMC_AQUAE             --SDV--SDVFKD--------------------------------------------IKG
B4U7R1_HYDS0          --EDD--TYIFQN--------------------------------------------IKG
C0QSN8_PERMH          --REDRVITLIKD--------------------------------------------ING
B2V736_SULSY          --REDKTSLLFKN--------------------------------------------IEG
SMC_PYRFU             --NRAAEELKRSG--------------------------------------------IGG
C5A612_THEGJ          --NRAVEFLKKSK--------------------------------------------IPG
D1CC09_THET1          EIMRASASGV-----------------------------------------------LGG
D3TAQ9_ACIB4          MAVLAARDRGE----------------------------------------------LRG
SMC_HALMS             EFLETVDS---------------------------------------------------D
Q6L0R1_PICTO          LKDV-----------------------------------------------------LKG
C1A7M6_GEMAT          KLLKERER-----------------------------------------------FGEGA
C9RN51_FIBSS          ENK-------------------------------------------------------AN
D1B5Z0_THEAS          -----------------------------------------------------------A
                                                                                  

SMC_FUSNN             IDGVLISLINF-DEKYEKAVEAAIPGNLQDIIVEDKEVAKKCIAFLT-EKKLGRTSFLAL
E3H7H1_ILYPC          VEGAFISLVNI-PERYERAIEAAIPGNLQDIIVKDSKTAKKCINFLK-EKRAGRASFLAF
D1AK68_SEBTE          VLGAFANLITI-PEEYHYAVQILSGSNFQDIVTDNDGTAKKCIEILK-NEKIGRASFLPL
SMC_CLOK1             SCFLVGEIISL-QKKFETCIEISLGNSISSVITNNEIIAKIIIKYLK-DNKMGRATFLPI
D8GS00_CLOLD          SCFLLGEVIEL-PKEYETCIEVALGSAISNIITEDEITAKALIKHLK-NKNMGRATFLPL
Q97IA1_CLOAB          SSFVLGEVIKV-KKEFETAVEISLGAAISDIITLDDNIAKKLINYLK-SKNLGRATFLPL
A0Q0Y7_CLONN          NVHILGEIIEV-DKIYEIAIEIALGSSISNVITENEFIAKNLIGYLK-NNNMGRATFLPL
Q895M7_CLOTE          NSFVVGEVINV-KKEYELCMEIALGGAISNIITRDENIAKELINYLK-INKLGRATFLPL
Q0SSA4_CLOPS          KCKVLGEVVET-KAGYETSIEVALGGSISNIITEDEEVAKVLINHLR-ENKLGRATFLPL
A6LSM4_CLOB8          DTKVLGEIFTV-GKKYEVAIEIALGAAISNVITKNEEIAKVLIGYLK-KNSLGRATFLPL
D9SLC7_CLOC7          EVNVLGEVISV-NRKYETAIEIAVGSGISNIISSTEKDAKKLIMHLK-NNNLGRATFLPL
D7APA8_THEM3          IIGVVGELLEV-ENTYSTAIEVALGSNVQNIVIKSSDKVAELIERLK-KENLGRATFLPL
Q8R9W7_CALS4          IVGVVGELIEV-EESYRQAIEVALGSNIQNVVVENSQKAAELIEILK-KHNLGRLTFLPL
D9TN88_THETC          VLGVVGELIKV-KSEYSLAIEIALGSAIQDVITKTTDDAKDLISILK-KNNFGRATFLPL
C9YKI7_CLODR          VHGALGQIINV-PEKYEKSIEAALGAYMQNIITDNEFSAKSAINYLK-QNNLGRVTFLPL
E3PS49_ACESD          ICGAVANLITV-KPGYEKALEAALGSQMQNIIIKSSNDAKKCIEFLK-EKKLGRVTFLPI
B0S1M4_FINM2          VIGTLGDLISV-DKKYEKSVDAIMSSAFQNIIVRNENDGKELINFLK-VNKIGRLTFLPL
Q3AC59_CARHZ          IIGTVGEFLEV-DERYRLAVETALGAGIKNVIVKSSRDLEGIIRYLK-LKNLGRITFLAL
E4SF58_CALK2          LYGTVGSLISV-KREYLKAIETALSSSLQHLVVKNEDDAKRIIEIAK-NEKLGKVTIIPI
SMC_RHOBA             LVGIVADCFSV-DRQVAPLIDAALGPRSQYVIVRGG--SVSDAISRG-DIKIGTRVGIIR
D2QWB0_PIRSD          IRGVVADVIQS-AVEHAAAIDLALGDAAQLGVVEGEITDVQEVLEAA-ATPSSRLTMIAT
D5SU17_PLAL2          VVGSLSDLLDV-DLNDAALVEVALGSRAHIIVLREY-QPLLDYLGRS-QAQLSSRVQFLA
SMC_KORVE             PAGVLADFLEV-EDKYEHVVEDFLRDELNYVVVKSWGAADEGLRLLK-GDVDGRATFLVH
C1F1T5_ACIC5          PVGTLADFLEV-QDQYENVVDEFLRDELNYVVVKSWDAANEGMRVLK-TDVDGRATFLVH
Q01Y77_SOLUE          PMGVLADYVEV-DAQFEKPAEEFLHEELEYVVVENWQQAERGLDFIR-AELDGRATFLVH
SMC_MYCPA             ILGPMAKLVKV-RSGYEAAVAAVLGSAADALAAD--GLGAARSALGA-LKQADGGRAALV
SMC_MYCTU             LFGSIAQLVKV-RSGYEAALAAALGPAADALAVD--GLTAAGSAVSA-LKQADGGRAVLV
SMC_MYCLE             LLGSIAKLVKV-RPGYEAALAAVLGPAADALAVD--SLGAARSALTA-LKEADAGRATLV
A4FMG9_SACEN          LLGSVAALLTV-EPGAEAALAAALGAVADAVAVS--GVGDAVAALEL-LRSDDAGQAGIL
C8XH72_NAKMY          LLGGVADAIGV-TPGHETAIAAALGAVADAVAVR--SVSDAAAALDL-LRSNDSGRAGIL
D7GEI0_PROFC          VLGALSGLLTV-ESGWEIAVAAVLGPAAEALAVR--DPAAAREALET-LHRDDLGRAGLV
Q2J6Z3_FRACC          VIGRLAGVLSV-TAGAEAAIAAALGPAADALLVG--TSGDAMAAFAW-LRETDAGRAALV
A8L599_FRASN          VIGRLASFVTV-APGAQAAIAAALGPAADALLVG--TPADALAALRW-LRTADAGRAALV
C9Z3S1_STRSW          VLGPAAELLTV-ATGHEVALAAAFGAAADAIAVT--SPASAAEAIRL-LRKQDAGRAALL
D7CC86_STRBB          LLGPAAELLTV-APGFEVPVAAALGAAADAIAVE--DPRTAAEAIRL-LRKQDAGRAALL
B1VYX5_STRGG          LLGPAAELLTI-EPGYEIAVAAALGAAADAVAVT--DPATAADAIRL-LRERDAGRAAML
E4NHH3_KITSK          VLGPVAELLTV-ATGFELAVAAALGAAAEAVAVT--DPAAAADALDR-LRAEDAGRAALL
C7QGY1_CATAD          LLGSVAAILTV-ESGAEAAVAAALGTAADAVAVT--SVDSAVNAIRL-LKADDAGQATVI
A0LV82_ACIC1          TVGAVARTLRI-EAGYEAALAAVLGDVANGVAVT--SVDAALAGMRR-LKEEDAGRTSLL
A0JXV4_ARTS2          IMGPLASMLSV-ESGYEAAIAAALGNCSDAVVVR--DARTAVEALEL-LKADDAGLASLL
A1R7H8_PAEAT          VLGSLAALITI-EPGYEAAIAAALGSASDALVVA--DTDSAVAALRL-LKDDDAGRAALL
A6W7T9_KINRD          VLGSVAALLSV-ENGYEQAVAAALGTAADAVVVT--GPADAGRAIAH-LKDEDAGRAGML
D1BJA3_SANKS          VVGSVAALLTV-ETGYADAVVAALGPLADAVAVE--SVGAAVEVLRY-LRTEDAGRASIV
C7NGM6_KYTSD          VLGDLTDHLQV-EAGHEAALAVALGPVATALVVQ--SRGAATAALEH-LAAREAGQATLV
B2GFM7_KOCRD          VLGDVPRSVRV-APGWERAVAAALGPWSDALAVA--SHTGAARILAH-LADAGSGRVHLL
E1VVN2_GLUAR          LMGRLGELLTV-RAGYEQAVASILRDNAEALVAE--NTSTALNLVAQ-LHSEQASAIFLH
A5CQQ2_CLAM3          IRGLLAEHVHV-QPGYEAAVAAALGSLADAVLAE--THDDAVAALRR-AVDDDLGRVEVV
Q6AE90_LEIXX          VRGLAAEHIRV-RPGYEAAVAAALGTLADAVLAD--TRDAAFEAVAL-AAADDFGRVEVI
D1AB24_THECD          VLGTLASLLTV-EAGYENAVAAVLGDAAQAIAVG--SLEAARAALEL-LRSRRAGRAAMV
D6Y659_THEBD          VLGPVAGLLTV-APGAEAAIAAVL--AVDGVAVA--SLHAAVAAMEH-LRESGGGGSALL
D7BMZ9_ARCHD          IRGLVRDSIRI-EPGWEAGIETAMAGIADGAIID--DIDLAIDAIRN-ARERGAGHVEFL
D6ZIF1_MOBCV          INAALLETILV-ESGWEDAIGAVFGQWSKALLTA--GVESAADALRF-VRQQSAGQVHLL
C7R311_JONDD          VHGTLVEFLDP-TAAHAPQMMVVLGSLLDALVVA--TEKGAYELAQA-DDNGQLHLIHLP
D6ZV06_BIFLJ          SLGRLTDFIHV-AEGWEEAVAHALDQYASAIVVP--EAGNMLHALER-AREDKLGKAVVL
Q7ZAJ9_COREF          -YPLLAQLVRP-QDGVDKALAASLGAHAEA-----LAGVVTGEVVDK-LLDARVSRTVLV
Q8NNW5_CORGL          -YPQLATLIRP-QRNVDKALAAALGAHAEA-----LAGEAAEGLVEK-LIDAGVARTIIV
Q84F13_CORDP          -FYGVDRYIIP-QRGMEKAIAAALGPVAEA-----LVGETTTAELQA-LDIESLARHIVI
Q4JUZ1_CORJK          ATRRLAEQLHI-HDGWGAAAAAVLGDAASSG----IVAPLSDALISA-LTDAREGRAVLL
C4LJD3_CORK4          -WGSFVDSVTV-ERGWEAALSSTLGEAAEAITAPGDTSESVGEALES-LVAADAGRAWIM
D6Z8M0_SEGRD          PTGVLAERLAP-TAGYERALSAALGAFAEAVVMD--SSEAALAAAAA-LGEAGEGQAALV
C8WGU5_EGGLE          NLAPIAHVVRA-SAGFEALVERLLGADVSALLVD-DAARANAVAAAL-AARDEQGEVVLV
C7MMZ7_CRYCD          PARILEAIRVS-DSQMEPLVSQVLADDVWALVAR-DESEAFNLIDRA-LAADTVGSISVA
C7N560_SLAHD          DAKSLASLMRV-RDGLEPLVERLLGDDVASLFVH-DADTARNLVSDV-NAAGLNGEASVL
E1QVK5_OLSUV          VSGRVADLLEA-PPELEGVVEALLGDDLSALVTP-DADAVAALAERA-SRERVVGRATVV
C8W740_ATOPD          VSGRLADYLEV-QPKFEALVEQLLGEDLSALVVD-KRQNIHVLFERV-QELSEDGKATLV
SMC_RHOPA             LWPPIIDGITV-AKGYEKAIGAVLGDDLDAP-VDPSAPMRWTDVG----VQPEDPALPEG
A7IGT2_XANP2          RFPPVADLVSV-AKGYETALGAALGDDLDLP-VDAAAPARWAGAL----SDPADPALPDG
B8EMM7_METSB          FWPAVTEEITV-ARGFEAALGAALGDDLDAS-TNPSAPAHWAET-----DRRGDPALPEG
B8IQU0_METNO          RFPSLLDALSV-APGYEAALAAALGDDLDAA-LDPAAPAHWAGAP----DGPGDPALPAG
Q92RE8_RHIME          TYPAVVEEMKV-ERGFEAALGAALGDDLDSP-LEQAAPTHWRMPG----DDAEDPALPAG
A7HQY9_PARL1          LWPPVIDAVSV-EHGYETALGAALGDDLAVP-EDAAAPIHWGSLP----AFETTPALPDG
D8JUP9_HYPDA          AYPPAVDQIRV-SPGYETALGAALGDDLEAP-LATEASVHWRHLD----VPAEEHALPAE
E3I0B2_RHOVT          RFKPIVDQISV-SAGYEVALGAALGDDLDVT-ADQTSPTRWTLVS----DAGGDPALPYG
SMC_RHOS1             AGSQLLDRIQV-EPGFEAALGAALSDDLRAPEVAADAPSGWAALP----DYDETAPLPAG
Q2W040_MAGSA          DHRPVLDDVSA-RTGFEPALAAALGEDLSAP-LDPSAPLHWEDLG----PLDHPPALPDG
D3P3X3_AZOS1          LFPPLVDAVAV-APGYEGALAAALGDALTAP-LDMAAPVHWRMLP----AYEAAAPLPAG
B6IR58_RHOCS          LFPPVIDTVTV-APGYEQALAAALGEDLTAP-LDEAAPVHWRTLP----ALPDSAPLPPG
Q2RPA2_RHORT          RTLPVVEALSV-RPGGEKALASALGDDLDAG-SAEEDAVRWVALP----ALAADP--PDA
SMC_CAUVN             GHAPALDSVSP-DKGYGAALAAALGDDLDAA-LDPKAPSYWG------GAEAPAPVWPEG
B0T003_CAUSK          GFSPALDAVTP-EKGYGAALAAALGDDLEAA-LDSRAPSFWAILSEK-SGEASSVTWPDG
Q0AMJ6_MARMM          SLSPAIEAVRA-RPGYEHALAAALGDDLEAS-LDASAARHWA------QTTCHAEALPGG
E0TC69_PARBH          GVSLA-DRISV-APGVETAFAAALPEALALG-DDPEADRYWSALG---AMPADLPSLPAG
C6XRC2_HIRBI          S-APILDETHP-NAGLERALAAALGDDLNAS-MNQADSQYWSDSQ-----AQHLSPMPDG
Q0C0X5_HYPNA          SAPPVVERIRT-RDGYEKAVAAALGDDISAS-TDKAAALYWGGAS-----VTSLS-LPAG
Q1GQU3_SPHAL          DDDRILDRLRA-QPGYEAALAAALGDDLDAG-TDPAAARSWTGAA----AARDDPALPAG
D4YX43_SPHJU          NRSRALDRLKA-APGYERALAAALGDDLEAP-IAAEGKRRWTGAA----ALASDPPLPEG
Q2G9S3_NOVAD          LGKAAIAGTRA-AAGYERALAAVLGRDAAAP-VGAAPA-DAEGRF----WTGAEAPEPLA
D5BSU5_PUNMI          QDTPIVDQLSV-KDDMETALAAYLADELTAP-ADTGTHSYWRDGM-----AHSDLTPPEG
A5FVJ2_ACICJ          DPDPVLDRIKV-PAGLETALGAALGAELSAG-EQASAARHWR--------SLPAIASDAA
C5B6I7_METEA          DPDAVASRIDV-DSGYEKALAGALGPDLAVG-TDPASPAVWTGAA------VRGPGHPEG
Q937L3_DEIRD          IVGSVADVLSV-PAEYETAITAALGRRLEQVVVHTGQDARDIIEELK-RAGGRATFLPLD
Q1J060_DEIGD          IVGSVADLLSV-PAEYEAAVTAALGRRLEQVVVHSGEDARGIIEELK-RVGGRATFLPLD
L0A7J5_DEIPD          IVGAVADLLEV-PGDFETAVSAALGRRLEQVVVERAEVAREIIEHLK-RVGGRATFLPLD
D7BH70_MEISD          IIGVVADLLDV-PEGLELAVEVALAARLQWVLTEDDRSAQAAIKLLK-QKGGRATFLPLT
SMC_THASP             -PPLWKQLQ-V-AAGWDEAVQAVLRERLAALTSPDPALALAAARTVL-DETPPESLAIAL
A1K715_AZOSB          -PPLWRVLR-V-AEGWESAVEAVLRERLAALMTA-PADADNAALSLL-DEAPPESLALAL
C7RKG8_ACCPU          -APLWKSLH-V-DAGWEDAVEAVLRERLGALVAT------QADPAWS-KDRPGSKLTLLL
Q3SJI0_THIDA          -PRLWEKLR-V-APGWEAAVEAVLRERLQAVAAD-------AAAAWF-DDVPPARLTLWA
SMC_DELAS             -QGLWSRIA-I-EPGWENALEAALRERLGALEVGRLDMVRGFLGSGG-HDAPPARLAFFS
D6CTE6_THIA3          -SQLWSRLQ-V-ENGLETALEAVLRERLSALELRQLDMAAGFAA-----DAPPAKLAFYS
SMC_BORPD             -GRLWQKLH-I-EPGWENALEAVLRERMAALEVRNLDWSRAFAE-----DAPPARLAFYQ
SMC_BURP1             -PRLWKKLH-V-EAGWETALEAVLRERLAALEVSNLDWVKAFAT-----DAPPAKLAFYA
A4SYV7_POLAQ          -KRLWQELK-V-ESGWEAALESVLRERLAAVTAKSVQETLALAN-----DAPPSRLAILL
D5CRW3_SIDLE          -PRLWQSIS-I-EPGWEDALEAVLRERINALALPRLEDAAGWND------VPPAKLAVYA
D9SGR3_GALCS          -PPLWQGIQ-I-EPGWETALEAVLGERLNAL--PALSELICQID------TPPSRLALFE
Q2YBB9_NITMU          -PRLWQGIQ-I-EKGWEDALEAVLRERLNGTRVGQLEVALEWAN------PPPGKCALFE
Q0AE88_NITEC          -PRLWLQIS-V-ESDWETALEAVLRERIQAVAVDRLEQVLDWEVG-Q-GKRPSAKWSVCE
D7DI79_METV0          -ARIWQKVS-I-KAGWETALESALGARLNALTTAEISENNGLPAS-----RPPSALSLAI
C1D4R7_LARHH          -PDLLAVLQ-V-EPGWQAALEAALGTATVRQA--------GRLPG----SVPPAPVVLVD
Q7NR76_CHRVO          -PQLWQSLQ-V-DARWQQALEAALGERLSARA--------AALPG----EPPPAALAVVD
A1KSF4_NEIMF          -PQLWQHIT-A-PAEWQHALSVILAERLHARAVP-----QGFVPP----EPLPQGQAAWL
A1WY82_HALHL          -PRLAETVR-V-DEGWQRAVEAILGDALQGVCIEPHSLPSEG--APD-GGPLTLVGDA--
Q0AAV4_ALKEH          -PRLAQQLV-V-TPGWERAVETVLAEGLQAVCVRPEELEGAARELPE-QGDLTLVSAG--
SMC_XANOR             -ARVGERIS-V-QSGWENAVEGALGQLIEGVLVDAPEQLVDALGELG-DGRIALVSSA--
B8GTL2_THISH          -PRLAEQLS-V-EAGWERAVEAVLGQYLEAVCVEDLDGVAGVLDSLS-HGDLLVLDTQA-
Q3JAH9_NITOC          -LRLAEGLE-V-EPGWEQAVERALGIHMEAVCVAGWERLADGLLNLE-AGSLILFDTAV-
D3RSW0_ALLVD          -ARLVEQLK-V-EPGWERAVEIRLGQALRAVTVDALETAVADANELP-PGLVLLETAGD-
B3PGR0_CELJU          -ARLAETIS-V-AEGWDKALETVLGNALQAVCVDGIDASAGLLGELT-QGELVLFDTR--
A6V7X5_PSEA7          -PRLAEGLR-V-EPGWELAVETVLGADLQAVLLDGFDGLD--LGGFG-KGELRLLSPA--
Q0VR03_ALCBS          -PRLADQLQ-V-AEGWEKALEAVLGDSIQAVAVSGFEQLNDWLDDLS-HGRLALVSP---
C7RBE2_KANKD          -SRLAQNIS-V-DSGWELAAETVLGEYLEAVVVDDNHEYANTLTELA-SGKLILISG---
Q2SD45_HAHCH          -PTLGERLS-V-AVQWEPALEAVLGA-RLSARVVGREFLERLQYAPP-KG-VALVCE---
E4PL89_MARAH          -PRVASQLQ-I-TDGWEFAVEQVIGRFTQGLCLPDIDQLSSAMKEAP-KG-LALVEA---
E1V8E9_HALED          -ARLGERLD-V-TPGWEDVVSWVLAPWLKARMASP-DDGARVLASEL-ATELGLLSAE--
D3SAL9_THISK          -RPLVQQLE-V-DEGWDTAVELALGAWLEAAVLDAPEATR----DWP-DAALRLVSAE--
SMC_METCA             -DRLGEKIE-V-APGWENAVETVLGAHLEAVCVDSLAPYLANLQAQE-PAEFLALCEYR-
SMC_COXBU             -PRLGQKLV-V-NPGWEIAVETVLSGFFDAVCVDAALPFLTDLTTVS-EGRVTLVEKK--
Q5WTI1_LEGPL          -PRLMDVLK-V-EPQWQSSCEIVLGDDLIAYVLDDFAELWSRWQFCE-DHKENVVTMR--
Q12L80_SHEDO          -QLLWQHIK-V-TPGWELAVELALQPVLQANVLQ-------GESKAG-FIHSAEYESN--
Q080K7_SHEFN          -QQLWQVIE-V-VPGWEKAVDKVLQGLSQLPVLGLGQTSSLSVSPPT-VGFEPQHQVT--
A4Y804_SHEPC          -PQLWQSIR-V-ENGWETAAELALSGLLTLPVGVLNNEVGFQNLAQE-SACTYIQDEH--
D4ZIY3_SHEVD          -KALWQLIN-V-QPGWEKAVELIFDGLLKMPAGVEK---------GE-FGFEGLISQE--
B0TKB4_SHEHH          -QELWQVID-V-TPGWESAVDILLSGLLSAPVLSAADSQSNDSNLSQ-FGFE-TASTQ--
A3QFJ7_SHELP          -RALWQAIQ-V-TPGWEAAVDLLLDGLLTQKVSDKHSGMETE---NE-SGFELSRSQK--
A1S5R5_SHEAM          -TKLWQRLD-V-AAGWEKTAELLLGHLLEQPLFEDTAFG--EDAFDG-RGFRYQEKGD--
Q5QUJ9_IDILO          -LKVRELLQ-A-ESGWEMAVEQLAYDWLDAVVLEQTPEELKAVSGVK-LVWPVSGQEPEN
E1SMV2_FERBD          -PRAWQQWQ-V-DEGWASALEQVLSRPMQAVVGADEAQLPQGAMRMT-AETARVPEAAHP
F2GBA5_ALTMD          -SSGAALAPCV-ESILQHVKDPVVAKSHGIYDLLSQIESVPSGVKVF-TGEAFVTNAKPG
Q15UZ3_PSEA6          -PWQAALT--V-NSGWEKAVEAVTDQWKNALIVNNIDDIGVFEEAQC-QGIALVVNNNND
Q3IKC0_PSET1          -NTLFNQLK-V-KDGFEHCIEQALKSLEHLNVSEQSANNSVWHIAST-KSNQANVKNS--
A4SKA4_AERS4          -ATLADRLQ-V-APEWAQALDKVLGRWLTAQPSDECNLAQNGLWIGP-SRPAVAGTLA--
D0KWM8_HALNC          -LAKAHADAWW-GHALGAGIEAACVDDLDALMVAWRADQIPATGWWV-APDSQRSEPKS-
A0A2W1K6W8_ACIFR      -QMRVQP-------GWERALEEVLGERLNALVMEGNNMVTQGSMLWV-STVMPAELPSD-
A0A0J1A050_ACIBA      -QALELTEQ---GKPHAQIIEKFLAKWLQAHIVETEQPFQEGIARQL-KPSEQSSKFKG-
B3E294_GEOLS          FGGLLADNLLV-PEEYEVAVEAVLAERLQTILCGSEQELISSIQYLR-QHSAGRAQLTFP
A1AU91_PELPD          FSGMLADSVTA-PQELEAALEAALADRLQCVLCSDEQDALVALEFLK-KGNAGRAGLALP
B9M6F0_GEODF          FNGMVADMVET-GEAFEAAVEVALGERLQWLVCDQESDALSAVAHLR-QVSGGRCSFVLQ
Q39WG2_GEOMG          FAGVIADFVET-EPEFETALEAVLAERLQYVVCPQESDAFEALAYLS-ESGGGRCSLVAG
B5EFS9_GEOBB          SLTMLADAIEV-EEEFEVALESVLGERLQYLLCGSPDLALDAVRHLK-GNSGGRCSFITA
Q3A212_PELCD          MIGMVADLLEV-PEAYEVALEAVLGDRLQALVTRHPEDALRALELLR-D-GGGRGALVLP
A9FIZ2_SORC5          --GLVADRIEA-PAELTAAFAGLLGDRLQCAVVSDVERGIALLADLS-KNNRGRASVIAA
D0LY52_HALO1          IRGLVADVVRA-PAQFEAAVEAALGDRLGGILVSDADSGAEAVRFLK-DTSAGRSAFVPC
Q1D2R5_MYXXD          IFGLVADVINV-TPRYERAVEAALGERLQHVIVESRDKGVELVDYLK-GHAEGRGSFLPV
B4UDF6_ANASK          IFGLVADVVSA-PEEYENAIEAVLGERLQYVIVESHSQGVEAIDYLK-TAAEGRASLIPM
Q6MNS9_BDEBA          HFQPVSEVVEV-PAEYEVAMEAALGSRLQMLLSSDANIAVDAVSHLK-ENKSGRSSFMAA
A9A0M3_DESOH          ILGIAADMVRP-QPGYETATEAVLGEALQYICVETHDQGARLVESLR-TDQAGRSGFIPL
B8FHS3_DESAL          ILGVLADVVKP-EPGYEEAVEAALGEALQFVIVKDKQTALDAMEHLA-EAKKGRAGFMPV
E1QL74_DESB2          LLGLVVQRVEA-KPGHEELLALALGPWLQALIVQGAAEAEALTHWAA-REGLGALRVVAL
B3EFQ6_CHLL2          DQGCLADMISL-DPAYRKAVHAALGEALSYYVCRSITEAKQSMQQLR-LSKKGKLHFLVL
A1BDT4_CHLPD          GIGCLSDLVSL-DRKHRKAVNAALGELLGYYICRTLDDAKQSIAALS-RSDKGKVHFLVL
A4SG64_CHLPM          GIGCLSDHLSL-DDSARKAVNAALGESMNYYVCRTLEEAHRGIAALR-SSAKGKVSFLVL
SMC_CHLTE             GLGCLSDLISV-RENDKKAINAALGESLGYYLCRNLEEARLAVSSLA-KADKGKVHFLIL
Q3ATI3_CHLCH          TSRCLADMIEV-DERYRAALGSALGDHLNCYLCPTLSDAHHSIALLQ-KAQKGKLLFLVQ
B4S519_PROA2          GYGCLSDLISL-DSVHRKAVNAALGESLGYYVCATTQEARAGIECLT-RADKGKISFLVL
B3EM83_CHLPB          GHGCLSDLLSL-EDVHRKAINAVLGESLGYYVCSSLPEAKTGIRSLA-EAGKGKVTFLVL
B3QRZ4_CHLT3          GLGCLSDMIAT-DEKFKLAVNAALGEALAYYICPTEQDALAAISELR-KAGKGKVSFVAL
D0MFL5_RHOM4          PLQTVADLLGI-APELQPALDTALGERAAWIVVATEEEARQALRLLR-EAEKGRATFIVL
Q2S457_SALRD          -LYTVADVLGC-DDDVRVALDAALGALASCVVVPTVDDARAAVARLR-DAEKGQTSFLVL
C7PLU2_CHIPD          AAPILSDIFFC-KEEYRTCVENLLEPYLNYYVVNNAAEAIQAIRLLD-TNKKGKANFFIL
E4TVF1_MARTH          NAPLLSDVLTC-SEDYRITIENFLEPYMNYYIVETEAQAFEAVNLLS-DASKGKAHFFIL
B2KBE7_ELUMP          VKGTLRKNIKF-SSSDNLIIEEAFGKFLDSVICDTLQTADLALEKLK-AANNARCKFIIL
B1H0P2_ENDTX          ARGPVSSLIDV-NDDKIGLIASALGEKLNYLVCETSERVERAIKFLE-DNGLCRLSFIVA
E4TEW8_CALNY          -------KIDD-NIKKFFGDVVVFKTSNRKGVLDKLKGIKTDLKFVF-EEELDYLNGRVS
D3PDY1_DEFDS          I-----KGIDE-ELLLEFSDVIVFDDVKKEEILEFLSKKDISIKFTF-KSNIENIEKWLI
D4H2V6_DENA2          --------LTE-ELTRELGDLIIIPENVKTDIAEILRDVKQSVRFVY-ENDVDALIDY--
D6YSC9_WADCW          KVRGLYEDFPT-EGCDRKAISVVMKRYTETLVVESLEDFKAVAAFAE-ENNVRGFSLLCL
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          VSIISKELKVQ-PAYTKAIETLLGPAMEALFVGKSDKALNVIGKLNS-DQLGRACLQI-D
B1ZZB8_OPITP          VSPITHGLAVK-PEFGKAVEAILGAAAEAISVSDLETAQRILAQLEQ-EQIGSAVLRVNE
SMC_DESHY             LCGTLADLLQV-EERYEVAVEVALGAGIQNIVTETERGAKEAVHYLK-SHNLGRATFLPL
A4J682_DESRM          ICGAVADLIKV-PKGFETAMEAALGGALQNIVTETSQQAKEAIDYLK-RQNLGRATFLPL
Q67PF3_SYMTH          VLGAVAEVVRT-EPRYERAIEVALGSAVQNLITATDAGAKAAIEHLK-RTGGGRATFLPL
B0TGW8_HELMI          IIGVFSDLIEV-PPGLETAIDVALGGGMQNIVAEDDQAARGAIEHLK-RTRKGRATFLPL
Q2RJX0_MOOTA          VLGVVVEKIEV-PGELTRAIEVALGGAAQQVLVRTASEAERVIQFLK-SRRHGRATILPL
SMC_BACSU             IRGAVLELIST-EQKYETAIEIALGASAQHVVTDDEQSARKAIQYLK-QNSFGRATFLPL
C5D8T7_GEOSW          IHGAIVELIQV-PDRYETAMEIALGGAMQHIVVENEEVARKAIHYLK-AHAYGRATFLPM
D5DQR5_BACMQ          IKGAIAELINV-PKEYETALEIALGGAAQHIVVQDEQSARQAIGFLK-QNGYGRATFLPL
B7IUK7_BACC2          IEGAVAELLTV-PKEYEVAMEIALGAAMQHIVVQTEEHARNAIAFLK-QNKHGRATFLPQ
Q9KA07_BACHD          IVGAVAELVTV-PKPYETAIEIALGGGAQHIVVESEQAARQAIQYLK-QQRFGRATFLPL
Q5WFM8_BACSK          IVGAAAELISV-PKKFEAAIELVLGAQAQHVVVDDEAAAREAISFLK-QRRLGRATFLPL
Q7ZAM6_OCEIH          IEGAVIELMEV-PKEYVTAMETVLGGQAQHIVVTDDQAARKSIGWLK-QTNNGRATFLPL
D6XTT7_BACIE          LIGAVAEVISF-NERYKTAVETALGGALQHVITDTADDARSAINYLK-TNRKGRATFLPL
Q81ZN4_ENTFL          IVGAVAELIEV-PKEYTLAIETALGGAAQHIVVENEKDGRAGITFLK-QQHSGRATFLPL
A0A0E0UX46_LISMM      ILGALVELVEI-PAKYQQAMETALGASAQNVVVEDDRVAREAISFLK-KTKSGRATFLPL
B1HQH6_LYSSC          IEGAVAELIQV-EGKYSQAIETALGAASQHIVTTNERHAQQAIHWLK-QKRAGRATFLPK
C6D303_PAESJ          VHGAVAELVRV-PERIETAVETALGGALQHIVMEDEKSARSAISFLK-QRQLGRATFLPL
C0ZFN9_BREBN          IHGAVAELVVV-PQQYETAMEVALGGALQNVVVDNEASGRAAIAHLK-QHNAGRATFLPL
C8WWA4_ALIAD          VCGSVAELIRV-DRTYELAVETALGGALQNVVVETEQDAMDAIRLLK-ARQGGRATFIPL
D5WPA2_KYRT2          VLGAVAEVIRV-PEGLDSAVEAALGPALQYVVVLDEEAGRRAIEYLK-RVKEGRITCIPL
C4L5Z7_EXISA          VLGAVAELIRV-RPSYEAAIETALGQTQQHVVVQDESVGRREIDKLR-KANAGRATFLPM
B1YIN0_EXIS2          IHGAVAELITV-PARFEAAIETALGGAMQNVVVDTDVTGRKLIQELR-RLNAGRATFMPL
D3R1B0_MAGIU          IYGAVAELITV-PAHLEIAIETALGGALQNIVVAQENDAARLINYLK-THHMGRATFLPL
D2RLB2_ACIFV          ICGVVAELFSV-EDAYVTALETALGGALQNIITQDARAAQDAIAYLK-KVQGGRATFLPL
D1BLY1_VEIPT          ITGAVGDLFTV-EEKYTTAIETALGGSVNHVVTTTARAAAEGVNYLK-SIQGGRVTFLPM
A5UQ60_ROSS1          FAL-VATVVRV-PAELETAIEVALGSRLHNIVVNRWEDAEDAIEALK-RSGEGRATFLPL
B8G556_CHLAD          FTL-VQQIIRV-PPTLETAIEVALGARLQHIVVEQWRDAEDAIAELR-RSGVGRATFLPL
A9B100_HERA2          FAV-VASVIEV-PAELETALEVALGARLQNIIVPNWEAAEAAIAELK-RTDAGRATFLPL
D1C6T1_SPHTD          IIGTLASLLIV-PPELEAAMEAALGGHLQDIVVERWRDAERAIEHLK-RTQAGRATFQPL
D7CMX2_SYNLT          ILGVVGDLIEV-PPGLEAAVETALGRSIQDIVVRSEKDARRAIEFLK-EKKLGRATFLPL
Q0AYV7_SYNWW          IMGVLGEILEV-PAGMELAIDVAAGNGLQNIVVASEKEVREAIDYLK-VQELGRATFLPL
SMC_LACPL             VAGAVSELLTV-PDQYTKAVEVALGGQLQNIVCDTQQTAKTVVNFLK-QNHAGRATFLPI
Q03RT7_LACBA          LLGAVSELLDV-PQRYTTAVEYALGGQLQQVVVDDETTAKAAVGYLR-DHRAGRATFLPL
B2GD41_LACF3          LFGAVSELLEV-PSQYTTAIETVLGGQLQQLVVDSQATGKRIIQDLI-QSQGGRVTILPL
A5VKP1_LACRD          LAGAVSELFDV-PAKYTQAIETVLGSQLQQLVVDRQATAKAIINFLI-KTRAGRVTILPL
Q03FW9_PEDPA          IVGPVSEVMNV-PAEYTVAIETALGNQVQNVVVDTDQTAKSIIEYLK-KNRLGRVTFLPK
A0A249N2C3_LACRH      VIGAVAELLEV-PSAYQQAFDLALGSNLQAIVTRDEAAAQRAISLLK-QQRAGRATFLPA
Q38XR7_LACSS          LLGAVAELMTV-PNDYQQAIELALGAQLQQIVTTDEKTAQQAIDYLK-RNRLGRATFLPN
Q1WU99_LACS1          IIGSVAEEFVI-PKEYAQAMEVALGGHLQDIIVTDENVAKKVIQHLT-YNRLGRATFLPQ
Q04GL1_OENOB          LFGTVAELIKV-DAQYALAIETALGAGLQNIVVDSQSTAKKAIEFLT-SRRLGRVTFLPI
Q03VW6_LEUMM          IKGVIAELMTV-PSRYALAIETVLGGVLQQVVVDNTSTAKQVISYLT-KNRAGRVTILPM
A0A0U5K8Z4_LACDE      IIGAVGELLTF-PADLEAAMTTALGGNVQSLVAKDRMAAKDAIQQLK-VRRLGRATFLPL
E4SKB3_LACAR          VIGAVGELISF-PVELEAAMTTALGGGVQDLITDSRISARNAINQLK-RNRAGRATFLPL
Q74IP9_LACJO          IVGVIGELISF-PAELEAALSTALGGGVQDLVTIDQSSARDAINLLK-QTRTGRATFLPL
A0A0T8KIP4_STREE      IIGAVSEHLTF-DVYYQTALEIALGASSQHIIVEDEESATKAIDFLK-RNRVGRATFLPL
A4VVL7_STRSY          IIGAVSEQLTF-DTRYQTALEIALGGASQNVIVEDEATAKRAIAFLK-EKRQGRATFLPL
C0MCR5_STRS7          ILGAVSEHLTF-DSQYQTALEIALGASSQHIIVADEAAAKRAIAFLK-ANRQGRATFLPL
A2RLZ7_LACLM          VIGVVSDLLTF-DPKYTTAIDIALGGGSQNVVTEDENAAKRAIAFLR-EKRLGRATFLPL
B9EBB4_MACCJ          IHHTVLDTIAV-DPRYNDALDSALGGVLQHIIVEDAQAARKAIEFLK-SKQAGRATFLPL
SMC_MYCHR             YIGLASELFKV-ESEFSLAIETVLGAALNQIVMKTSEDVLQAIDFLK-KNLSGKATFIPL
E0TKT8_MYCHH          YIGLASELFKV-ESEFSLAIETVLGAALNQIVMKTSEDVLQAIDFLK-KNLSGKATFIPL
Q4A770_MYCH7          YCGLVSDLIKI-FPKYTGAIEAALGPTLKQIVVEQPETAVSAINFLK-KNYAGSATFIPL
C5J708_MYCCR          FCGLVTDLIKY-DSQYANAVEAAIGPALKQIVVEKPEDAVEAVNFLK-KNMSGTATFIPL
A5IYM7_MYCAP          LKGTVADLIKV-NKEYSRAIEAVLANALQHLVVDKPEVAVKAVEFLK-QNNGGRATFIPL
D5E4P4_MYCCM          YHGIVADLIKV-NPEYVTAIETVLSNATQHIVVEDSEVAVKAVNFLK-SNNSGRATFIPL
Q6KHN4_MYCMO          LVGTVTQLIEV-DNEYVPAIEAVLQNALQHLVVTKSEVAVKAIEFLK-KNNSGRATFIPL
Q98PK8_MYCPU          YHGLVSEVLKV-DQEYIPAIDAVLNNALQHIVVEDAQIAVTAVNFLK-KNDGGRATFIPL
D1J8Q8_MYCHP          YKALVSELIEV-NEKYALAIETILSSAMQHIVVDKPETAVEAINFLK-SNNGGRATFIPL
Q4A588_MYCS5          YVGLVSELFKI-KNEYIHAIDTILSPSMQNIVVKDDKTAKEAVRFLK-NNSAGRAVFMPL
SMC_MYCGE             ILNTLGTFLKF-DKQYEKAILKALGKSIGYLVVNNNNAAIQAIDFLV-KNEIGKVTFLPL
SMC_MYCPN             LLNTLNTFLKF-EKQYEKALLKALGKSIGYLVVNNNLAALKAIDFLL-TNQIGQVTFLPI
Q7NBU0_MYCGA          VHGIVQDFIKV-EPEYELAISTALNKAAKNIIVDSNQDAINAVNFLK-ANKAGRATFLPL
Q8EVS6_MYCPE          VLGSVLDFVKC-DPIHEKAITTALGKNSQNIVVNTSRDVKRAIDFLI-NNTAGVATFMPV
Q9PR04_UREPA          VYGTVAQNIST-KTEHELAISTALAKGINNIIVKNNQAAENCINFLK-KNNAGVATFLPI
Q6F1N4_MESFL          VVGTVGSLIDV-KEEHQIAISLITGNHLQSVVFKTSDDAKKGIEFLK-NQRLGRVNALPI
Q6MTD2_MYCMS          VVGVLKSLINV-KEEYQIAISVTASGHMNSLVMKTDQDVKKAIEFLKKNNNLGRVTFLPL
E3GP81_9FIRM          VYGPVGELLSI-PDRFTMAVDVALGAKSQNIVVEDVTTANQCINILK-KQRAGRATFLPL
SMC_HALOH             IIGVVADQIEV-DKKYELAIETALGGRLQNIIVKDDKSARECVDYLK-ETKGGQATFLPV
E4RL35_HALHG          LIDVVAEIISV-ESEYEKALETALGAKSQNIIVENDSTAKKAVNYLK-KQNKGRATFLPL
D9QRN7_ACEAZ          LYGVVAELLEV-PKEFEIAIETALGSRLQNVVVATEEDAKEAINYLK-REKAGRATFLPL
A8MHB7_ALKOO          VFGAIADLIQV-PKGYEVALETALGPALQYIVSKEENDGKRLIQYLK-KYNLGRITVLPL
A6TRT3_ALKMQ          IYGVVADLLQV-PKGYEIAIEVALGSAIQNIVSRNEYDAKKLIEYMK-KYNLGRVTILPL
A3DDY2_HUNT2          IHGALAQLFTV-DKRYETAIEMALGGALQNIVTTSEEDAKRVIEYLK-KNNLGRATFLPI
D5X8N2_THEPJ          ICGVVAELLNV-PKKYEIAVEVALGGALQFIVTRTDNDAKAAINFLR-KCNAGRATFLPL
D9R048_CLOSW          IHGVVADLISV-PKKYEVAIETALGGSIQNIVTDSETTAKQLIEYLK-KNRYGRATFLPL
C4Z0E6_EUBE2          ILGVIADIVKV-ERKYETAIETALGGTIQNIVTDKESTAKELIAYLK-QNKLGRATFLPL
C4Z924_AGARV          LLGVVSDLIQV-DKRYEIAIETALSGNIQNIVTEDEATAKKMIGFLK-ANHFGRATFLPL
E0RV40_BUTPB          IIGVVADIIKT-EPKYETAIEVALGGNIQNIVTDDEETAKKMIKYLK-DTKAGRATFLPL
A9KLR0_LACP7          IVGVVADIIKV-DKNYETAIETALGGNIQNIVTDNENTAKRLIDYLK-QGKHGRATFLPL
D9S347_THEOJ          IYGTVADIIDT-DRKLETAIEAALGGALQNVVCDTEQNAKEAIEYLK-RNNLGRVTFLPL
B2A2N3_NATTJ          VIGTVSQLISV-EKHYLKAIETALGQAQQNIVTANDAEAKKVLEHLK-KYKLGRATCLPL
A8F8R1_PSELT          IYDVVGNLINF-PPDYTKAIEVLLGGAVQHVVVDNAETAKKVIEWLS-SEKIGRATFLPL
A5IN04_THEP1          LVDVVSNLIEV-DEKYSLAVSVLLGGMAQNIVVRNVDTAKAIVEFLK-RNEAGRVTILPL
C5CIS4_KOSOT          LIDVVANLVEI-PKTFETAVSVLLGSRMQDVVVESSITAKRIVAFLK-QHKIGRLTLLPL
A7HMD4_FERNB          LIDVVANLIDF-DKSLSTAYEVLLGGAVQNVVVKTAEDGKKIIEFLK-AGEYGRATFIPL
B7IHN5_THEAB          IIDVVANIIET-DEKYVEAIEALLGGRLQHIVVESAEVAKKILNFAK-NNKIGRVTIIPL
SMC_THEEB             VLGLVAQLGQV-EPRYQLALEIAAGARLGNIVVADDSVAAAAIALLK-REQAGRATFLPL
Q2JHS4_SYNJB          VLGLVAQLGQV-DPQYQLALEVAAGNRLHFVVVEDDTVAVSAVNFLK-REKAGRATFLPL
SMC_SYNP6             VHGLVAQLGRV-EPRYQLALEVAAGGRLGYLVVDDDGVASAGIELLK-QKKAGRITFLPL
B0C9C4_ACAM1          VHGLVAQLGQV-DSHYQTALEVAAGGRLGCLVVDDDAVASAGIELLK-RERGGRATFLPL
Q115J3_TRIEI          ICGLVAQLGRV-EPKYQLALEIAAGGRLGNMVVENDGVAALGIEFLK-RHKAGRMTFLPL
B2J925_NOSP7          LCGLVVQLGKV-EPRHQLALEMAAGGRLGHIVVEDDGVAAAGIELLK-QKRAGRATFLPL
E0UKI1_GLOV7          VCGLVANLAEV-EPSYQLALEIAAGGRLGYLVVEDDSIASAGIALLK-QKRVGRATFLPL
B7K4Q6_RIPO1          VCGLVAQLGQV-NPRYQLALEIAAGARLTYIVVEDDSIAAAGIELLK-KAKAGRATFLPL
B0JSN6_MICAN          ICGLVAQLGEV-EERYQIALEIAAGGRLGHVVVQDDSVAAAGIALLK-QRRIGRATFLPL
SMC_SYNY3             VCGLVAQLGQV-EPQYQLALEIAAGGRLGFLVVEDDGVAAAGIEILK-QAKAGRATFLPL
Q84EC7_SYNP2          VHGLVAQLGQV-EKAYQQALEIAAGGRLGYLVVEDDETAATGIKLLK-NQRAGRATFLPL
D3EQ04_ATETH          ICGLVAELGQV-DPLHQLALEIAAGSRLGHVVVEDDAIAISGINMLK-KAKAGRATFLPL
SMC_GLOVI             VHGLISQLGRV-EAQYQGALEVAAGNRLNNVVVEDDAVAAQAIELLK-SRRAGRATFLPL
A5GQT1_SYNR3          IHGLVAQLAEV-DDRYRLALEVAAGGRLSQVVVDDDRIAARAIELLK-QRRAGRLTFLPL
A9B9B9_PROM4          IHGPVAQLAEV-DNIHRLAVEVAAGARIGQIVVDNDQIAARAIDLLK-TKKAGRLTFLPL
A2BNJ6_PROMS          IHGYVAQLGEV-SEKNRYALEIAAGNRLGQIVVDNDHIAAKAIEILK-KKKAGRLTFLPL
Q46EX0_METBF          INGTIAQLGRV-ERQYSTALEVAAGNRMQAIVVDTDADAAEAIEYLK-RRKGGRATFLPL
D7EAF5_METEZ          IYGTIAELGQA-DEKYSTALQIAAGGRMQAVVTENDEDASEAIEYLK-RYKAGRATFLPL
D1YW78_METPS          IYGTIAELGKV-DQEYATALEVAAGNRMQNIVVDNDEDAARCIYYLK-GQRKGTATFLPL
A0B8B9_METTP          LCGTIADLGEV-DRRYAAALEVAAGARLQSVIAESDEDAAVAIDYLK-RSQIGRATFLPL
D4GT30_HALVD          VHGAVGQLGSV-DGEYAKACETAAGGRLANVVVDDDGVGSSCIGHLK-SRKAGRATFLPI
A7IAD8_METB6          VHGTIMELGRA-PPEYATALNVAAGNKIQFVVCDTDQIATDAIRYLK-DERLGRVTFLPL
A3CWK7_METMJ          VHGTVAQLGRA-PPEYATALDVAAMGRLRWAIVDTDAVASDAIRYLK-ENRLGRVTFLPL
B8GG37_METPE          VYGTIARLGKV-PPEYMTALNVAAGGRLHNVVVEDDRVAAGAIRYLK-EEKAGRLTFLPL
E1RII6_METP4          VIGTVAQLGKA-PAEYAAALDIAAGGRLRNVVVENDAVAADAIRFLK-ERRLGRMTFLPL
Q2FLH3_METHJ          VYGTIGDLATC-KPEYANALTIAAGGKIHFVVVETDQIAADAIRYLQ-EHKLGRVTFLPL
A2SS75_METLZ          VFGTVSSLGKVIDSAYAVALNIAAGGRLNNVVVDSDQTAANVIRYLK-DERLGRLTLLPL
D3RYW2_FERPA          VYGTVSQLGEV-DQEFALALEVAAGNALSFIVVENEDDAVRAIKYLK-EIKGGRATFLPL
O28714_ARCFU          IFGTVAQLGEV-DEEYVAAIEAAAGNALQFVVVETEDDAVSAINFLK-AVRGGRATFIPL
D2RFP2_ARCPA          IYGTVSQLCSV-DEKYALALEIAGGNALNFIVVEDEDKAIRAVKYLK-DVDGGRASFIPL
SMC_THEAC             VIGLVRDLISY-GEKYVKAVESAGGGRLNAVVVKDDAVAKECIQILK-DRKISPMTFLPL
Q97AI9_THEVO          VVGQIRDLISY-GERYAIAVESAASARLNAVVVDTDVTAKRCIEYLR-EKKISPMTFLPL
SMC_METVO             VVDIAGNLAKTK-GEYKTAIEVAGGARLNHIVVKKMDDGSRAINYLK-QKRLGRATFLPM
A6UQ42_METVS          IIDIAGNLGKTD-AEYRVAVENAGGNRLNYIVVKRMDDGARAIQYLK-RNNLGRTTFLPL
A6UVP1_META3          VIDIAGNLGKTK-NEYKTAIEIAGGGRLNNIVVKRMDDGARAINYLK-KNNLGRATFLPL
SMC_METJA             IIDIVGNLGKTK-IEYKTAIEVAAGNRLNHIVVKRMDDAVRAIKYLK-ERKLGRATFLPL
C9RFQ3_METVM          VIDIVGNLGKTK-IEYKTAIEVSAGNRLNYLVVKRMEDAVRAIKYLK-ERKLGRATFLPM
D5VT24_METIM          VIDIVGNLGKTK-MKYKKAIEVAGGSRLKYVVTETTEDAIRAINYLK-SKNLGRITFLPL
D3SQ87_THEAH          VYGRVSDLIRVKDSLYIRAIEVAGGSRLSYVIVEDEDVAQECIRRLK-ELKGGRMSFIPL
D3DG53_HYDTT          VYGRGSELIRVKDHEYIKAVESAGGARLSYVVVEDENVAKACIERLK-EVKGGRMNFIPL
SMC_AQUAE             VYGSVSELIRVKNPEHITAIEVAGGGRLKFIVVEDEEVAKECIQLAK-RMNLGRFSFIPL
B4U7R1_HYDS0          VYGKVEDLISLKDEEYKTAIEAAAGARLSYVVVESEEIAKTCIELLK-KNSDKRVSFIPL
C0QSN8_PERMH          VYGQVADLIGIKDPELSKAIEVAGGGRLKNIVVEDDRVAQECIRVLK-ENKAGRATFIPL
B2V736_SULSY          VYGAVSEIISIKDPKVQTAIEVAGGGRLKNVVVENEDVAKKCLDILK-QEKAGRVTFIPL
SMC_PYRFU             IYGTLAELIKVKDEAYALAIEVALGNRADNVVVEDELVAEKAIKYLK-EHKLGRLTFLPL
C5A612_THEGJ          LYGTLGELITVRDRKYALAVEVALGGNYDNVVVEDDRVAEKAIKLLK-EKKLGRLTFLPL
D1CC09_THET1          ILGPVGNLISV-PAELETAIEAAIGTGLQNVITLTWQDAEKAIEWLK-MKKIGRVTFLPI
D3TAQ9_ACIB4          IYGTISELGNV-DDKYALAIEVAAGNRMMSIVCEDDESAAKAIEFLK-RHKLGRAIFLPL
SMC_HALMS             KYQLLGNLIQC-EEDHAKAVQNLLSDFMDTLVSTDEDVSAVIEWCKTNNDKALEFLAPNK
Q6L0R1_PICTO          IYGQVKDLIDY-RDDYSNAIIAGAGSRLYNIVVDSDLTAQRCIETLK-EKKLGRLTFLPV
C1A7M6_GEMAT          VLGPLTDFVTA-DGDAARLVERYLGATMHAIVVRDADAAAAVRRWHT-ETQPGPLLLLPL
C9RN51_FIBSS          LIGGLVSERIEATPEYASSVEAALGEILDSVVVNGDSAVNEIVDALK-SENVGKVLMSLV
D1B5Z0_THEAS          KPTVLMDAFRC-PKEISGAVEAFLGGRQFWLLVDTLEESGECIAFLK-SRSLGRATFLPL
                                                                                  

SMC_FUSNN             DTIKPNRREFK-------------------------------------------------
E3H7H1_ILYPC          DTIKTGREVKS-------------------------------------------------
D1AK68_SEBTE          ETIKTGRFIDKL------------------------------------------------
SMC_CLOK1             SIIKGRKISNLHK-----------------------------------------------
D8GS00_CLOLD          NIIKGKKISNSER-----------------------------------------------
Q97IA1_CLOAB          NIIKGRKLNISDA-----------------------------------------------
A0Q0Y7_CLONN          NIIKGKTISVPNK-----------------------------------------------
Q895M7_CLOTE          NIIKGNSIELSKD-----------------------------------------------
Q0SSA4_CLOPS          SIIRGKKLELSKN-----------------------------------------------
A6LSM4_CLOB8          NIIKGKKLELDRS-----------------------------------------------
D9SLC7_CLOC7          DTIRSNVISVDKN-----------------------------------------------
D7APA8_THEM3          DLIRGRILSQQESN----------------------------------------------
Q8R9W7_CALS4          DLVKGKKLEGEAA-----------------------------------------------
D9TN88_THETC          DNISYKSFDQSLD-----------------------------------------------
C9YKI7_CLODR          NIIKSNKVSLGNL-----------------------------------------------
E3PS49_ACESD          DSISGKVLSYSDD-----------------------------------------------
B0S1M4_FINM2          NKIKPRNLNYVND-----------------------------------------------
Q3AC59_CARHZ          DLLETESLKGDFSN----------------------------------------------
E4SF58_CALK2          DTVSVLSQKED-------------------------------------------------
SMC_RHOBA             LDELPNR-----------------------------------------------------
D2QWB0_PIRSD          GAHRRDE-----------------------------------------------------
D5SU17_PLAL2          IPETEGSDFRQPAWQGTRFI----------------------------------------
SMC_KORVE             PSDSQAK-----------------------------------------------------
C1F1T5_ACIC5          PEDSQAL-----------------------------------------------------
Q01Y77_SOLUE          PEPNGHP-----------------------------------------------------
SMC_MYCPA             LGDWPAD------------------------PPAPQPA----------------------
SMC_MYCTU             LSDWPA-------------------------PQAPQSAS-----------------GEML
SMC_MYCLE             LADWLA---------------------------DAGPAC-----------------VTGL
A4FMG9_SACEN          VGGSTV---------------------------EGDRSA-----------------WPAL
C8XH72_NAKMY          IQGARS---------------------------QPDRRS-----------------WPEL
D7GEI0_PROFC          IQGAPD-----------------------------AQPS-----------------SGPV
Q2J6Z3_FRACC          AAVTVAD------------------EPDACAGPDACAGP--------------DGSAAIV
A8L599_FRASN          PADRVDQPH----------------RADQTDEVDPADQA--------------DGADRAE
C9Z3S1_STRSW          L------------------------------AGAPDDP-------------AETPRREDA
D7CC86_STRBB          LGAPAAAAPAGAHGLGGPGGPGAAGASSAPGAAAPDAPGGPTAGQIGSVRLPHPAEGGAD
B1VYX5_STRGG          LGAELA------------------------DGAAAAPRHVPEQTFARETAESPAPAVLPA
E4NHH3_KITSK          I------------------------------ADAPARP---------------VPPTPAT
C7QGY1_CATAD          VG-----------------------------GDLSYAD---------------DGEWPQL
A0LV82_ACIC1          I------------------------------GGLPESG-----------------HAGTA
A0JXV4_ARTS2          LAVPA--------------------GQDAADPLSGGGAA---------------PSWRPL
A1R7H8_PAEAT          LAG----------------------GPPAEEDVRANAA---------------------L
A6W7T9_KINRD          L------------------------------TSAPGSGA---------------APAVDA
D1BJA3_SANKS          LGAPD--------------------QAPQTGTAVSAAPL---------------TPPADL
C7NGM6_KYTSD          LSAGSD-----------------------AGEPVPLSGAG-------------GPDGAAG
B2GFM7_KOCRD          VADAAE--------------------------------------------------ASGL
E1VVN2_GLUAR          TDIQAP--------------------------------------------------LNAM
A5CQQ2_CLAM3          VAGSAD-------------------------------------------------AQLAV
Q6AE90_LEIXX          VADAPA-------------------------------------------------VIVDL
D1AB24_THECD          VGGGPDE-------------------------------------------------HEPA
D6Y659_THEBD          IAGDATEARH---------------------------------------------PGEPP
D7BMZ9_ARCHD          VGTADGEGNEN----------------------TTAIIE----------------AAGVE
D6ZIF1_MOBCV          VADAAGT-----------------------LAGAQKPES---------------LEKAEL
C7R311_JONDD          PVTESSS------------------------------------------------TLATS
D6ZV06_BIFLJ          TASIAGDPATE-------------------PGTESEESS--------------AENTAAA
Q7ZAJ9_COREF          AA-----------------------------TDEQGAWRL----------------DAVL
Q8NNW5_CORGL          DG-----------------------------TQAGGAWRL----------------DANI
Q84F13_CORDP          TP-----------------------------GED-HDWRL----------------ATDL
Q4JUZ1_CORJK          DPEA-------------------------PEGETSATFRL----------------DTDV
C4LJD3_CORK4          GQ------------------------------SQESTWRL----------------DADL
D6Z8M0_SEGRD          FPPGQAHTKAG-----------------ERSAASPGRAEF----------------DGSL
C8WGU5_EGGLE          PRAGEARRACPAREAAAAGLGR--------------------------------------
C7MMZ7_CRYCD          YGAQVDTRAQSLSDAPSGAV----------------------------------------
C7N560_SLAHD          FPGAQGRHADGAR-----------------------------------------------
E1QVK5_OLSUV          SLSERASKEASGMPGRS-------------------------------------------
C8W740_ATOPD          TFSDVTSSLVAPAHTTP-------------------------------------------
SMC_RHOPA             VEA---------------------------------------------------------
A7IGT2_XANP2          AEP---------------------------------------------------------
B8EMM7_METSB          CEP---------------------------------------------------------
B8IQU0_METNO          AAP---------------------------------------------------------
Q92RE8_RHIME          ALP---------------------------------------------------------
A7HQY9_PARL1          ATP---------------------------------------------------------
D8JUP9_HYPDA          AEP---------------------------------------------------------
E3I0B2_RHOVT          AER---------------------------------------------------------
SMC_RHOS1             AEP---------------------------------------------------------
Q2W040_MAGSA          AEP---------------------------------------------------------
D3P3X3_AZOS1          AVP---------------------------------------------------------
B6IR58_RHOCS          AEP---------------------------------------------------------
Q2RPA2_RHORT          TTP---------------------------------------------------------
SMC_CAUVN             AEP---------------------------------------------------------
B0T003_CAUSK          ATP---------------------------------------------------------
Q0AMJ6_MARMM          CVP---------------------------------------------------------
E0TC69_PARBH          ATP---------------------------------------------------------
C6XRC2_HIRBI          ATP---------------------------------------------------------
Q0C0X5_HYPNA          AEP---------------------------------------------------------
Q1GQU3_SPHAL          TTP---------------------------------------------------------
D4YX43_SPHJU          CTA---------------------------------------------------------
Q2G9S3_NOVAD          DSL---------------------------------------------------------
D5BSU5_PUNMI          TLP---------------------------------------------------------
A5FVJ2_ACICJ          LPR---------------------------------------------------------
C5B6I7_METEA          SEP---------------------------------------------------------
Q937L3_DEIRD          LIR---------------------------------------------------------
Q1J060_DEIGD          LIR---------------------------------------------------------
L0A7J5_DEIPD          LLR---------------------------------------------------------
D7BH70_MEISD          LLR---------------------------------------------------------
SMC_THASP             PARSGAPAERANCAQGPLSPQGRV------------------------------------
A1K715_AZOSB          DAGAACPADLV-------------------------------------------------
C7RKG8_ACCPU          PLADGEARDGH-------------------------------------------------
Q3SJI0_THIDA          GHGGDAEPAPE-------------------------------------------------
SMC_DELAS             PPQGAPAPAA--------------------------------------------------
D6CTE6_THIA3          AAVQPPASEARA------------------------------------------------
SMC_BORPD             MPAAAPTPAA--------------------------------------------------
SMC_BURP1             PPAAGEPLAA--------------------------------------------------
A4SYV7_POLAQ          AEDITPAHTS--------------------------------------------------
D5CRW3_SIDLE          ADGSRPGNVAAQTGLT--------------------------------------------
D9SGR3_GALCS          PGSDSP---LEAGSWP--------------------------------------------
Q2YBB9_NITMU          PAEMKLQKTTKAGKIAG-------------------------------------------
Q0AE88_NITEC          LVEPDQSAGSHNLIRP--------------------------------------------
D7DI79_METV0          TSELAAANNAAAS-----------------------------------------------
C1D4R7_LARHH          RPAAAGALRPA-------------------------------------------------
Q7NR76_CHRVO          GKRAAAAGLPE-------------------------------------------------
A1KSF4_NEIMF          SDGLSGGIKKS-------------------------------------------------
A1WY82_HALHL          ------------------------------------------------------------
Q0AAV4_ALKEH          ------------------------------------------------------------
SMC_XANOR             ------------------------------------------------------------
B8GTL2_THISH          ------------------------------------------------------------
Q3JAH9_NITOC          ------------------------------------------------------------
D3RSW0_ALLVD          ------------------------------------------------------------
B3PGR0_CELJU          ------------------------------------------------------------
A6V7X5_PSEA7          ------------------------------------------------------------
Q0VR03_ALCBS          ------------------------------------------------------------
C7RBE2_KANKD          ------------------------------------------------------------
Q2SD45_HAHCH          ------------------------------------------------------------
E4PL89_MARAH          ------------------------------------------------------------
E1V8E9_HALED          ------------------------------------------------------------
D3SAL9_THISK          ------------------------------------------------------------
SMC_METCA             ------------------------------------------------------------
SMC_COXBU             ------------------------------------------------------------
Q5WTI1_LEGPL          ------------------------------------------------------------
Q12L80_SHEDO          ------------------------------------------------------------
Q080K7_SHEFN          ------------------------------------------------------------
A4Y804_SHEPC          ------------------------------------------------------------
D4ZIY3_SHEVD          ------------------------------------------------------------
B0TKB4_SHEHH          ------------------------------------------------------------
A3QFJ7_SHELP          ------------------------------------------------------------
A1S5R5_SHEAM          ------------------------------------------------------------
Q5QUJ9_IDILO          WS----------------------------------------------------------
E1SMV2_FERBD          WPR---------------------------------------------------------
F2GBA5_ALTMD          TLADALLREEGAPTPNRRV-----------------------------------------
Q15UZ3_PSEA6          QSGDLARKE---------------------------------------------------
Q3IKC0_PSET1          ------------------------------------------------------------
A4SKA4_AERS4          ------------------------------------------------------------
D0KWM8_HALNC          ------------------------------------------------------------
A0A2W1K6W8_ACIFR      ------------------------------------------------------------
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          AGNTPPRTTSEIIGA---------------------------------------------
A1AU91_PELPD          LAVEPS-PFVAVDQA---------------------------------------------
B9M6F0_GEODF          QPCKQQ-KPLLIPEA---------------------------------------------
Q39WG2_GEOMG          IPSMPG-SDAAPDGA---------------------------------------------
B5EFS9_GEOBB          PPW-HH-PGATPSGA---------------------------------------------
Q3A212_PELCD          DVAEFE---VTFGHG---------------------------------------------
A9FIZ2_SORC5          RPSFVAGATRRPPRG---------------------------------------------
D0LY52_HALO1          RDAGPAPADAPAAAENL-------------------------------------------
Q1D2R5_MYXXD          PALDTLPA--PLEPDFS-------------------------------------------
B4UDF6_ANASK          ARLREAGASDPTEADRA-------------------------------------------
Q6MNS9_BDEBA          DGQGLTFNRAEAPMG---------------------------------------------
A9A0M3_DESOH          SVLNQEIDISAITGN---------------------------------------------
B8FHS3_DESAL          SWVDAGFTPGSLN-----------------------------------------------
E1QL74_DESB2          DRLATRGVAAPAE-----------------------------------------------
B3EFQ6_CHLL2          DHIARISDNETPV-----------------------------------------------
A1BDT4_CHLPD          ELVQESVPKNRAV-----------------------------------------------
A4SG64_CHLPM          DLVPPPPPKSGPD-----------------------------------------------
SMC_CHLTE             DLIDGGAKIDYAE-----------------------------------------------
Q3ATI3_CHLCH          ELAASASLPTLPT-----------------------------------------------
B4S519_PROA2          ERLAAHDPEEVQM-----------------------------------------------
B3EM83_CHLPB          DMLKTPEMDASPA-----------------------------------------------
B3QRZ4_CHLT3          EKLQPTSGETQQENSPPESS----------------------------------------
D0MFL5_RHOM4          DGLTP-PNDPPEI-----------------------------------------------
Q2S457_SALRD          DRLPDAPPSVSAP-----------------------------------------------
C7PLU2_CHIPD          DQFHQQN-GHPAAP----------------------------------------------
E4TVF1_MARTH          DNFDKFKPSDSKLY----------------------------------------------
B2KBE7_ELUMP          SEVPETPATG--------------------------------------------------
B1H0P2_ENDTX          EKISDSYRKSDIGL----------------------------------------------
E4TEW8_CALNY          SFEFERIDENILRINGIYYK----------------------------------------
D3PDY1_DEFDS          ASNYEKLNENIFNFNHIYRK----------------------------------------
D4H2V6_DENA2          AENNIDAGENIVRNGFIHRK----------------------------------------
D6YSC9_WADCW          EMIPEVKKVSRE-HSLLDRM----------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          IDAAVGTPKVKLPESVVPAA----------------------------------------
B1ZZB8_OPITP          LRAERPELSAELPAGLTPAV----------------------------------------
SMC_DESHY             DVIQGGK--ATVAKEAAQ------------------------------------------
A4J682_DESRM          DSLRPTPP-GDWEKRALG------------------------------------------
Q67PF3_SYMTH          NTIRPQGYRPEEEREFRG------------------------------------------
B0TGW8_HELMI          KSLQVYGG---PGRDVLN------------------------------------------
Q2RJX0_MOOTA          AWLEPRRW-PNWAGWVLN------------------------------------------
SMC_BACSU             SVIRDRQLQSRDAETAAR------------------------------------------
C5D8T7_GEOSW          NVMQPKTISSEQLALIKD------------------------------------------
D5DQR5_BACMQ          TSVKDRYVPAQTISMLES------------------------------------------
B7IUK7_BACC2          AVIKSRSLSFEQLRIVNQ------------------------------------------
Q9KA07_BACHD          PVMKGRELPAASMQLIQE------------------------------------------
Q5WFM8_BACSK          TTVKARVVPEAVISAIAN------------------------------------------
Q7ZAM6_OCEIH          ASIQERFISNEWLAKIST------------------------------------------
D6XTT7_BACIE          DTIKPKSISDYDLGQIGQ------------------------------------------
Q81ZN4_ENTFL          TTIKPRSVSAMVQNRLAG------------------------------------------
A0A0E0UX46_LISMM      STIQPRELPAATKNALSN------------------------------------------
B1HQH6_LYSSC          TVMKSRKINLATIQLATE------------------------------------------
C6D303_PAESJ          DVIRGRHVPEHEKRMAES------------------------------------------
C0ZFN9_BREBN          DVIRPRTLQASDKRQLEE------------------------------------------
C8WWA4_ALIAD          DVVRSRRMEDGLVSRAAA------------------------------------------
D5WPA2_KYRT2          TVIRPRTMTEADRQTLSG------------------------------------------
C4L5Z7_EXISA          TTIKPRFVPSDVFDRLDS------------------------------------------
B1YIN0_EXIS2          SSIQRRELSASVQQSVSG------------------------------------------
D3R1B0_MAGIU          DALQAKTSDQEMLRRACD------------------------------------------
D2RLB2_ACIFV          DTLRPRAL-GTREKAALS------------------------------------------
D1BLY1_VEIPT          DSVKGKP----YDTPALH------------------------------------------
A5UQ60_ROSS1          DTIRPRNADGVRIRLHTAS-----------------------------------------
B8G556_CHLAD          DTLRRPQHDGRRPTFSTN------------------------------------------
A9B100_HERA2          DTLRTPRPS--RIPQGKG------------------------------------------
D1C6T1_SPHTD          DTVRGSSVRAPQLDHPGV------------------------------------------
D7CMX2_SYNLT          DLLRVSDLPRDKIRRAEK------------------------------------------
Q0AYV7_SYNWW          DVLKVKPLPGSVVEKILV------------------------------------------
SMC_LACPL             ERIT--------------------------------------------------------
Q03RT7_LACBA          STVR--------------------------------------------------------
B2GD41_LACF3          DNLR--------------------------------------------------------
A5VKP1_LACRD          DTLS--------------------------------------------------------
Q03FW9_PEDPA          NALS--------------------------------------------------------
A0A249N2C3_LACRH      AVMR--------------------------------------------------------
Q38XR7_LACSS          NVVK--------------------------------------------------------
Q1WU99_LACS1          KAVK--------------------------------------------------------
Q04GL1_OENOB          EVIK--------------------------------------------------------
Q03VW6_LEUMM          DTIK--------------------------------------------------------
A0A0U5K8Z4_LACDE      DALR--------------------------------------------------------
E4SKB3_LACAR          DGLR--------------------------------------------------------
Q74IP9_LACJO          DGLR--------------------------------------------------------
A0A0T8KIP4_STREE      TTIK--------------------------------------------------------
A4VVL7_STRSY          TTIK--------------------------------------------------------
C0MCR5_STRS7          TTIK--------------------------------------------------------
A2RLZ7_LACLM          TTIK--------------------------------------------------------
B9EBB4_MACCJ          NVIK--------------------------------------------------------
SMC_MYCHR             TSIK--------------------------------------------------------
E0TKT8_MYCHH          TSIK--------------------------------------------------------
Q4A770_MYCH7          STLK--------------------------------------------------------
C5J708_MYCCR          TSIK--------------------------------------------------------
A5IYM7_MYCAP          ASIH--------------------------------------------------------
D5E4P4_MYCCM          KSIQ--------------------------------------------------------
Q6KHN4_MYCMO          NKLQ--------------------------------------------------------
Q98PK8_MYCPU          KSIK--------------------------------------------------------
D1J8Q8_MYCHP          SSIK--------------------------------------------------------
Q4A588_MYCS5          SSLR--------------------------------------------------------
SMC_MYCGE             DDVAS-------------------------------------------------------
SMC_MYCPN             DDIAF-------------------------------------------------------
Q7NBU0_MYCGA          ANLK--------------------------------------------------------
Q8EVS6_MYCPE          YDMN--------------------------------------------------------
Q9PR04_UREPA          ENLQ--------------------------------------------------------
Q6F1N4_MESFL          DTLN--------------------------------------------------------
Q6MTD2_MYCMS          NTLT--------------------------------------------------------
E3GP81_9FIRM          DNLR--------------------------------------------------------
SMC_HALOH             NMVNG-RKVNFKNNQVKKVDGF--------------------------------------
E4RL35_HALHG          NMIDGSRLGDNYLNQLKNYPGF--------------------------------------
D9QRN7_ACEAZ          NLVDP-RSLRQREEEALEVKGA--------------------------------------
A8MHB7_ALKOO          TTIQGRTITKEEIGIIENFHD---------------------------------------
A6TRT3_ALKMQ          TAIKQRNITLEENRIIQQHED---------------------------------------
A3DDY2_HUNT2          SSVKGKYLDDSILNQLKDHEGF--------------------------------------
D5X8N2_THEPJ          NTVKAKELRSSD--KILKAKGC--------------------------------------
D9R048_CLOSW          TSIANR-DSFRQDRALAEPGV---------------------------------------
C4Z0E6_EUBE2          NAISGR-NTLEKEPCIKENGV---------------------------------------
C4Z924_AGARV          TSVRAN-RNTKNEAALGEKGV---------------------------------------
E0RV40_BUTPB          TSLDNP-QELKAKEALEEPGV---------------------------------------
A9KLR0_LACP7          TSIQGN-ISA-NEQVLREQGV---------------------------------------
D9S347_THEOJ          SSVKPRLLSPGEEWILSLPGC---------------------------------------
B2A2N3_NATTJ          DNLQPRYLNQKQRQIIRECEI---------------------------------------
A8F8R1_PSELT          DLIESHFSGMRDIERHPG------------------------------------------
A5IN04_THEP1          DLIDGSFNRISGLEKEKG------------------------------------------
C5CIS4_KOSOT          DMLKGNFKRFKAVENHPG------------------------------------------
A7HMD4_FERNB          DLIDSSFSEIKGVEKEEG------------------------------------------
B7IHN5_THEAB          DLISAKSSNINLPKNA--------------------------------------------
SMC_THEEB             NKMARPKP----------------------------------------------------
Q2JHS4_SYNJB          NKLQPTRP----------------------------------------------------
SMC_SYNP6             NRIRAGKQ-P--------------------------------------------------
B0C9C4_ACAM1          NKMRP----P--------------------------------------------------
Q115J3_TRIEI          NKIRYPAQKR--------------------------------------------------
B2J925_NOSP7          NKIHAPKFTQ--------------------------------------------------
E0UKI1_GLOV7          NKIQFSKPPD--------------------------------------------------
B7K4Q6_RIPO1          TKIKSPKIQD--------------------------------------------------
B0JSN6_MICAN          NKIRPPRPQD--------------------------------------------------
SMC_SYNY3             NKIRPPKGQN--------------------------------------------------
Q84EC7_SYNP2          NKIRAPKLHT--------------------------------------------------
D3EQ04_ATETH          TKIRSYSKQN--------------------------------------------------
SMC_GLOVI             NKLRSGR-----------------------------------------------------
A5GQT1_SYNR3          NKIRSSARGG-GAA----------------------------------------------
A9B9B9_PROM4          NKIKSSGDNSKLKS----------------------------------------------
A2BNJ6_PROMS          NRIKSQKKNYAISR----------------------------------------------
Q46EX0_METBF          NKLREPR-----------------------------------------------------
D7EAF5_METEZ          TKLEKRR-----------------------------------------------------
D1YW78_METPS          NKMRQRV-----------------------------------------------------
A0B8B9_METTP          NKM-EVG-----------------------------------------------------
D4GT30_HALVD          TKM-DNR-----------------------------------------------------
A7IAD8_METB6          NKL-KPP-----------------------------------------------------
A3CWK7_METMJ          NKL-RPP-----------------------------------------------------
B8GG37_METPE          TKL-KPV-----------------------------------------------------
E1RII6_METP4          NKL-RAP-----------------------------------------------------
Q2FLH3_METHJ          NKL-RPK-----------------------------------------------------
A2SS75_METLZ          NKM-KPQ-----------------------------------------------------
D3RYW2_FERPA          NKIRKNFGKI--------------------------------------------------
O28714_ARCFU          RRIKSF--KL--------------------------------------------------
D2RFP2_ARCPA          NRINIS---L--------------------------------------------------
SMC_THEAC             NKMRDPPAQR--------------------------------------------------
Q97AI9_THEVO          NKMRAMSNLS--------------------------------------------------
SMC_METVO             DRIKGMD--A--------------------------------------------------
A6UQ42_METVS          DRINGPD--A--------------------------------------------------
A6UVP1_META3          DRIRGYE--P--------------------------------------------------
SMC_METJA             DRIEGRE--A--------------------------------------------------
C9RFQ3_METVM          DRIEGRE--T--------------------------------------------------
D5VT24_METIM          DRIRGRK--I--------------------------------------------------
D3SQ87_THEAH          KRIRDVQLP---------------------------------------------------
D3DG53_HYDTT          SRIKVPSLP---------------------------------------------------
SMC_AQUAE             NRVRVEERPL--------------------------------------------------
B4U7R1_HYDS0          NRIKTQSLP---------------------------------------------------
C0QSN8_PERMH          NRIRVSHPA---------------------------------------------------
B2V736_SULSY          NKIKVQDNP---------------------------------------------------
SMC_PYRFU             NKIKP----K--------------------------------------------------
C5A612_THEGJ          NKIKP----R--------------------------------------------------
D1CC09_THET1          DTVTPLKASHIPN-----------------------------------------------
D3TAQ9_ACIB4          NKMLRGRPRGKAILASRD------------------------------------------
SMC_HALMS             NGDITSEETLERLRVATG------------------------------------------
Q6L0R1_PICTO          NKILKPRDHPKAIDLINS------------------------------------------
C1A7M6_GEMAT          DVVT--------------------------------------------------------
C9RN51_FIBSS          SSAAPAYDKPVNN-----------------------------------------------
D1B5Z0_THEAS          ERCVPR------------------------------------------------------
                                                                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          ------------------------------------------------------------
SMC_KORVE             ------------------------------------------------------------
C1F1T5_ACIC5          ------------------------------------------------------------
Q01Y77_SOLUE          ------------------------------------------------------------
SMC_MYCPA             PAGAL-------------------------------------------------------
SMC_MYCTU             PSGAQ-------------------------------------------------------
SMC_MYCLE             PDGAQ-------------------------------------------------------
A4FMG9_SACEN          DGSAR-------------------------------------------------------
C8XH72_NAKMY          PAGAH-------------------------------------------------------
D7GEI0_PROFC          PAGTR-------------------------------------------------------
Q2J6Z3_FRACC          PGAASADG----------------------------------------------------
A8L599_FRASN          AGGGSPQGRPADRKP---------------------------------------------
C9Z3S1_STRSW          GDGVTGHDGSADGRRP--LPASPPAR----------------------------------
D7CC86_STRBB          GQGARADAAAAAGGDPHVVPGARPAEPGEGTAYGPSAEADGGAASRDERRAAWAADSVAL
B1VYX5_STRGG          QGGAGAGSGARSGPDAEAHPADRAGTT---------------------------------
E4NHH3_KITSK          SAGAR-------------------------------------------------------
C7QGY1_CATAD          PGDAR-------------------------------------------------------
A0LV82_ACIC1          PPDGR-------------------------------------------------------
A0JXV4_ARTS2          PGGAR-------------------------------------------------------
A1R7H8_PAEAT          PAGSR-------------------------------------------------------
A6W7T9_KINRD          PPGAR-------------------------------------------------------
D1BJA3_SANKS          PDGAV-------------------------------------------------------
C7NGM6_KYTSD          PGGGQPGRGE--------------------------------------------------
B2GFM7_KOCRD          PELALPE-----------------------------------------------------
E1VVN2_GLUAR          PVIP--------------------------------------------------------
A5CQQ2_CLAM3          PSSDGP------------------------------------------------------
Q6AE90_LEIXX          SGVEGV------------------------------------------------------
D1AB24_THECD          VPGVR-------------------------------------------------------
D6Y659_THEBD          VAGAE-------------------------------------------------------
D7BMZ9_ARCHD          ASEAR-------------------------------------------------------
D6ZIF1_MOBCV          PAGAR-------------------------------------------------------
C7R311_JONDD          PHLSE-------------------------------------------------------
D6ZV06_BIFLJ          PQSGN-------------------------------------------------------
Q7ZAJ9_COREF          PAGA--------------------------------------------------------
Q8NNW5_CORGL          PAGA--------------------------------------------------------
Q84F13_CORDP          PHYA--------------------------------------------------------
Q4JUZ1_CORJK          SAG---------------------------------------------------------
C4LJD3_CORK4          PAGC--------------------------------------------------------
D6Z8M0_SEGRD          PKGA--------------------------------------------------------
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             ------------------------------------------------------------
A7IGT2_XANP2          ------------------------------------------------------------
B8EMM7_METSB          ------------------------------------------------------------
B8IQU0_METNO          ------------------------------------------------------------
Q92RE8_RHIME          ------------------------------------------------------------
A7HQY9_PARL1          ------------------------------------------------------------
D8JUP9_HYPDA          ------------------------------------------------------------
E3I0B2_RHOVT          ------------------------------------------------------------
SMC_RHOS1             ------------------------------------------------------------
Q2W040_MAGSA          ------------------------------------------------------------
D3P3X3_AZOS1          ------------------------------------------------------------
B6IR58_RHOCS          ------------------------------------------------------------
Q2RPA2_RHORT          ------------------------------------------------------------
SMC_CAUVN             ------------------------------------------------------------
B0T003_CAUSK          ------------------------------------------------------------
Q0AMJ6_MARMM          ------------------------------------------------------------
E0TC69_PARBH          ------------------------------------------------------------
C6XRC2_HIRBI          ------------------------------------------------------------
Q0C0X5_HYPNA          ------------------------------------------------------------
Q1GQU3_SPHAL          ------------------------------------------------------------
D4YX43_SPHJU          ------------------------------------------------------------
Q2G9S3_NOVAD          ------------------------------------------------------------
D5BSU5_PUNMI          ------------------------------------------------------------
A5FVJ2_ACICJ          ------------------------------------------------------------
C5B6I7_METEA          ------------------------------------------------------------
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          ------------------------------------------------------------
SMC_THASP             ------------------------------------------------------------
A1K715_AZOSB          ------------------------------------------------------------
C7RKG8_ACCPU          ------------------------------------------------------------
Q3SJI0_THIDA          ------------------------------------------------------------
SMC_DELAS             ------------------------------------------------------------
D6CTE6_THIA3          ------------------------------------------------------------
SMC_BORPD             ------------------------------------------------------------
SMC_BURP1             ------------------------------------------------------------
A4SYV7_POLAQ          ------------------------------------------------------------
D5CRW3_SIDLE          ------------------------------------------------------------
D9SGR3_GALCS          ------------------------------------------------------------
Q2YBB9_NITMU          ------------------------------------------------------------
Q0AE88_NITEC          ------------------------------------------------------------
D7DI79_METV0          ------------------------------------------------------------
C1D4R7_LARHH          ------------------------------------------------------------
Q7NR76_CHRVO          ------------------------------------------------------------
A1KSF4_NEIMF          ------------------------------------------------------------
A1WY82_HALHL          ------------------------------------------------------------
Q0AAV4_ALKEH          ------------------------------------------------------------
SMC_XANOR             ------------------------------------------------------------
B8GTL2_THISH          ------------------------------------------------------------
Q3JAH9_NITOC          ------------------------------------------------------------
D3RSW0_ALLVD          ------------------------------------------------------------
B3PGR0_CELJU          ------------------------------------------------------------
A6V7X5_PSEA7          ------------------------------------------------------------
Q0VR03_ALCBS          ------------------------------------------------------------
C7RBE2_KANKD          ------------------------------------------------------------
Q2SD45_HAHCH          ------------------------------------------------------------
E4PL89_MARAH          ------------------------------------------------------------
E1V8E9_HALED          ------------------------------------------------------------
D3SAL9_THISK          ------------------------------------------------------------
SMC_METCA             ------------------------------------------------------------
SMC_COXBU             ------------------------------------------------------------
Q5WTI1_LEGPL          ------------------------------------------------------------
Q12L80_SHEDO          ------------------------------------------------------------
Q080K7_SHEFN          ------------------------------------------------------------
A4Y804_SHEPC          ------------------------------------------------------------
D4ZIY3_SHEVD          ------------------------------------------------------------
B0TKB4_SHEHH          ------------------------------------------------------------
A3QFJ7_SHELP          ------------------------------------------------------------
A1S5R5_SHEAM          ------------------------------------------------------------
Q5QUJ9_IDILO          ------------------------------------------------------------
E1SMV2_FERBD          ------------------------------------------------------------
F2GBA5_ALTMD          ------------------------------------------------------------
Q15UZ3_PSEA6          ------------------------------------------------------------
Q3IKC0_PSET1          ------------------------------------------------------------
A4SKA4_AERS4          ------------------------------------------------------------
D0KWM8_HALNC          ------------------------------------------------------------
A0A2W1K6W8_ACIFR      ------------------------------------------------------------
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          ------------------------------------------------------------
A1AU91_PELPD          ------------------------------------------------------------
B9M6F0_GEODF          ------------------------------------------------------------
Q39WG2_GEOMG          ------------------------------------------------------------
B5EFS9_GEOBB          ------------------------------------------------------------
Q3A212_PELCD          ------------------------------------------------------------
A9FIZ2_SORC5          ------------------------------------------------------------
D0LY52_HALO1          ------------------------------------------------------------
Q1D2R5_MYXXD          ------------------------------------------------------------
B4UDF6_ANASK          ------------------------------------------------------------
Q6MNS9_BDEBA          ------------------------------------------------------------
A9A0M3_DESOH          ------------------------------------------------------------
B8FHS3_DESAL          ------------------------------------------------------------
E1QL74_DESB2          ------------------------------------------------------------
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ------------------------------------------------------------
B1ZZB8_OPITP          ------------------------------------------------------------
SMC_DESHY             ------------------------------------------------------------
A4J682_DESRM          ------------------------------------------------------------
Q67PF3_SYMTH          ------------------------------------------------------------
B0TGW8_HELMI          ------------------------------------------------------------
Q2RJX0_MOOTA          ------------------------------------------------------------
SMC_BACSU             ------------------------------------------------------------
C5D8T7_GEOSW          ------------------------------------------------------------
D5DQR5_BACMQ          ------------------------------------------------------------
B7IUK7_BACC2          ------------------------------------------------------------
Q9KA07_BACHD          ------------------------------------------------------------
Q5WFM8_BACSK          ------------------------------------------------------------
Q7ZAM6_OCEIH          ------------------------------------------------------------
D6XTT7_BACIE          ------------------------------------------------------------
Q81ZN4_ENTFL          ------------------------------------------------------------
A0A0E0UX46_LISMM      ------------------------------------------------------------
B1HQH6_LYSSC          ------------------------------------------------------------
C6D303_PAESJ          ------------------------------------------------------------
C0ZFN9_BREBN          ------------------------------------------------------------
C8WWA4_ALIAD          ------------------------------------------------------------
D5WPA2_KYRT2          ------------------------------------------------------------
C4L5Z7_EXISA          ------------------------------------------------------------
B1YIN0_EXIS2          ------------------------------------------------------------
D3R1B0_MAGIU          ------------------------------------------------------------
D2RLB2_ACIFV          ------------------------------------------------------------
D1BLY1_VEIPT          ------------------------------------------------------------
A5UQ60_ROSS1          ------------------------------------------------------------
B8G556_CHLAD          ------------------------------------------------------------
A9B100_HERA2          ------------------------------------------------------------
D1C6T1_SPHTD          ------------------------------------------------------------
D7CMX2_SYNLT          ------------------------------------------------------------
Q0AYV7_SYNWW          ------------------------------------------------------------
SMC_LACPL             ------------------------------------------------------------
Q03RT7_LACBA          ------------------------------------------------------------
B2GD41_LACF3          ------------------------------------------------------------
A5VKP1_LACRD          ------------------------------------------------------------
Q03FW9_PEDPA          ------------------------------------------------------------
A0A249N2C3_LACRH      ------------------------------------------------------------
Q38XR7_LACSS          ------------------------------------------------------------
Q1WU99_LACS1          ------------------------------------------------------------
Q04GL1_OENOB          ------------------------------------------------------------
Q03VW6_LEUMM          ------------------------------------------------------------
A0A0U5K8Z4_LACDE      ------------------------------------------------------------
E4SKB3_LACAR          ------------------------------------------------------------
Q74IP9_LACJO          ------------------------------------------------------------
A0A0T8KIP4_STREE      ------------------------------------------------------------
A4VVL7_STRSY          ------------------------------------------------------------
C0MCR5_STRS7          ------------------------------------------------------------
A2RLZ7_LACLM          ------------------------------------------------------------
B9EBB4_MACCJ          ------------------------------------------------------------
SMC_MYCHR             ------------------------------------------------------------
E0TKT8_MYCHH          ------------------------------------------------------------
Q4A770_MYCH7          ------------------------------------------------------------
C5J708_MYCCR          ------------------------------------------------------------
A5IYM7_MYCAP          ------------------------------------------------------------
D5E4P4_MYCCM          ------------------------------------------------------------
Q6KHN4_MYCMO          ------------------------------------------------------------
Q98PK8_MYCPU          ------------------------------------------------------------
D1J8Q8_MYCHP          ------------------------------------------------------------
Q4A588_MYCS5          ------------------------------------------------------------
SMC_MYCGE             ------------------------------------------------------------
SMC_MYCPN             ------------------------------------------------------------
Q7NBU0_MYCGA          ------------------------------------------------------------
Q8EVS6_MYCPE          ------------------------------------------------------------
Q9PR04_UREPA          ------------------------------------------------------------
Q6F1N4_MESFL          ------------------------------------------------------------
Q6MTD2_MYCMS          ------------------------------------------------------------
E3GP81_9FIRM          ------------------------------------------------------------
SMC_HALOH             ------------------------------------------------------------
E4RL35_HALHG          ------------------------------------------------------------
D9QRN7_ACEAZ          ------------------------------------------------------------
A8MHB7_ALKOO          ------------------------------------------------------------
A6TRT3_ALKMQ          ------------------------------------------------------------
A3DDY2_HUNT2          ------------------------------------------------------------
D5X8N2_THEPJ          ------------------------------------------------------------
D9R048_CLOSW          ------------------------------------------------------------
C4Z0E6_EUBE2          ------------------------------------------------------------
C4Z924_AGARV          ------------------------------------------------------------
E0RV40_BUTPB          ------------------------------------------------------------
A9KLR0_LACP7          ------------------------------------------------------------
D9S347_THEOJ          ------------------------------------------------------------
B2A2N3_NATTJ          ------------------------------------------------------------
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             ------------------------------------------------------------
B0C9C4_ACAM1          ------------------------------------------------------------
Q115J3_TRIEI          ------------------------------------------------------------
B2J925_NOSP7          ------------------------------------------------------------
E0UKI1_GLOV7          ------------------------------------------------------------
B7K4Q6_RIPO1          ------------------------------------------------------------
B0JSN6_MICAN          ------------------------------------------------------------
SMC_SYNY3             ------------------------------------------------------------
Q84EC7_SYNP2          ------------------------------------------------------------
D3EQ04_ATETH          ------------------------------------------------------------
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          ------------------------------------------------------------
A9B9B9_PROM4          ------------------------------------------------------------
A2BNJ6_PROMS          ------------------------------------------------------------
Q46EX0_METBF          ------------------------------------------------------------
D7EAF5_METEZ          ------------------------------------------------------------
D1YW78_METPS          ------------------------------------------------------------
A0B8B9_METTP          ------------------------------------------------------------
D4GT30_HALVD          ------------------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          ------------------------------------------------------------
O28714_ARCFU          ------------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             ------------------------------------------------------------
A6UQ42_METVS          ------------------------------------------------------------
A6UVP1_META3          ------------------------------------------------------------
SMC_METJA             ------------------------------------------------------------
C9RFQ3_METVM          ------------------------------------------------------------
D5VT24_METIM          ------------------------------------------------------------
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             ------------------------------------------------------------
C5A612_THEGJ          ------------------------------------------------------------
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             ------------------------------------------------------------
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          ------------------------------------------------------------
SMC_KORVE             ------------------------------------------------------------
C1F1T5_ACIC5          ------------------------------------------------------------
Q01Y77_SOLUE          ------------------------------------------------------------
SMC_MYCPA             ------------------------------------------------------------
SMC_MYCTU             ------------------------------------------------------------
SMC_MYCLE             ------------------------------------------------------------
A4FMG9_SACEN          ------------------------------------------------------------
C8XH72_NAKMY          ------------------------------------------------------------
D7GEI0_PROFC          ------------------------------------------------------------
Q2J6Z3_FRACC          ----------------------------------------------------PLPA-GAV
A8L599_FRASN          ----------------------------------------------------DLPA-GAV
C9Z3S1_STRSW          ------------------------------------------------------------
D7CC86_STRBB          GEVSADAGVGGPGVSPDVAADESGVAYTGPATDVAVSHREGRAVSVAETAGPDDDL-GAP
B1VYX5_STRGG          -----------------------------------------------------TAL-AAP
E4NHH3_KITSK          ------------------------------------------------------------
C7QGY1_CATAD          ------------------------------------------------------------
A0LV82_ACIC1          ------------------------------------------------------------
A0JXV4_ARTS2          ------------------------------------------------------------
A1R7H8_PAEAT          ------------------------------------------------------------
A6W7T9_KINRD          ------------------------------------------------------------
D1BJA3_SANKS          ------------------------------------------------------------
C7NGM6_KYTSD          -----------------------------------------------------LPG-VAV
B2GFM7_KOCRD          ---------------------------------------------------------GCV
E1VVN2_GLUAR          ---------------------------------------------------------DAV
A5CQQ2_CLAM3          -----------------------------------------------------------V
Q6AE90_LEIXX          -----------------------------------------------------------R
D1AB24_THECD          ------------------------------------------------------------
D6Y659_THEBD          ------------------------------------------------------------
D7BMZ9_ARCHD          ------------------------------------------------------------
D6ZIF1_MOBCV          ------------------------------------------------------------
C7R311_JONDD          ------------------------------------------------------------
D6ZV06_BIFLJ          ------------------------------------------------------------
Q7ZAJ9_COREF          -----------------------------------------------------------T
Q8NNW5_CORGL          -----------------------------------------------------------S
Q84F13_CORDP          -----------------------------------------------------------S
Q4JUZ1_CORJK          -----------------------------------------------------------K
C4LJD3_CORK4          -----------------------------------------------------------E
D6Z8M0_SEGRD          -----------------------------------------------------------R
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             ------------------------------------------------LAQHVTAP----
A7IGT2_XANP2          ------------------------------------------------LSRFVSGA----
B8EMM7_METSB          ------------------------------------------------LSELVQAP----
B8IQU0_METNO          ------------------------------------------------LASVVAGP----
Q92RE8_RHIME          ------------------------------------------------LIDFVQAP----
A7HQY9_PARL1          ------------------------------------------------LSYFVKGP----
D8JUP9_HYPDA          ------------------------------------------------MVMHVQAP----
E3I0B2_RHOVT          ------------------------------------------------LSNFVRGP----
SMC_RHOS1             ------------------------------------------------LAPHVGVP----
Q2W040_MAGSA          ------------------------------------------------LARFVAAP----
D3P3X3_AZOS1          ------------------------------------------------LSNHVQGP----
B6IR58_RHOCS          ------------------------------------------------LARHVKAP----
Q2RPA2_RHORT          ------------------------------------------------LADLVEGPEAVR
SMC_CAUVN             ------------------------------------------------LAPLVKAP----
B0T003_CAUSK          ------------------------------------------------LAPLIKAP----
Q0AMJ6_MARMM          ------------------------------------------------LSDHIQAP----
E0TC69_PARBH          ------------------------------------------------LADEVSAP----
C6XRC2_HIRBI          ------------------------------------------------LNQLVEAP----
Q0C0X5_HYPNA          ------------------------------------------------LTGYVDAP----
Q1GQU3_SPHAL          ------------------------------------------------LAAHVQAP----
D4YX43_SPHJU          ------------------------------------------------LSAHVSAP----
Q2G9S3_NOVAD          ------------------------------------------------VRHIPTCP----
D5BSU5_PUNMI          ------------------------------------------------LADFVSGS----
A5FVJ2_ACICJ          ------------------------------------------------IGETITAP----
C5B6I7_METEA          ------------------------------------------------LSARVRGV----
Q937L3_DEIRD          ------------------------------------------------PRPRRDGP----
Q1J060_DEIGD          ------------------------------------------------ARPRRDGP----
L0A7J5_DEIPD          ------------------------------------------------PRSRRDAV----
D7BH70_MEISD          ------------------------------------------------PAARPRRD----
SMC_THASP             ----------------------------------------------------------TV
A1K715_AZOSB          ------------------------------------------------------------
C7RKG8_ACCPU          ------------------------------------------------------------
Q3SJI0_THIDA          ------------------------------------------------------------
SMC_DELAS             ------------------------------------------------------------
D6CTE6_THIA3          ------------------------------------------------------------
SMC_BORPD             ------------------------------------------------------------
SMC_BURP1             ------------------------------------------------------------
A4SYV7_POLAQ          ------------------------------------------------------------
D5CRW3_SIDLE          ------------------------------------------------------------
D9SGR3_GALCS          ------------------------------------------------------------
Q2YBB9_NITMU          ------------------------------------------------------------
Q0AE88_NITEC          ------------------------------------------------------------
D7DI79_METV0          ------------------------------------------------------------
C1D4R7_LARHH          ------------------------------------------------------------
Q7NR76_CHRVO          ------------------------------------------------------------
A1KSF4_NEIMF          ------------------------------------------------------------
A1WY82_HALHL          ------------------------------------------------------------
Q0AAV4_ALKEH          ------------------------------------------------------------
SMC_XANOR             ------------------------------------------------------------
B8GTL2_THISH          ------------------------------------------------------------
Q3JAH9_NITOC          ------------------------------------------------------------
D3RSW0_ALLVD          ------------------------------------------------------------
B3PGR0_CELJU          ------------------------------------------------------------
A6V7X5_PSEA7          ------------------------------------------------------------
Q0VR03_ALCBS          ------------------------------------------------------------
C7RBE2_KANKD          ------------------------------------------------------------
Q2SD45_HAHCH          ------------------------------------------------------------
E4PL89_MARAH          ------------------------------------------------------------
E1V8E9_HALED          ------------------------------------------------------------
D3SAL9_THISK          ------------------------------------------------------------
SMC_METCA             ------------------------------------------------------------
SMC_COXBU             ------------------------------------------------------------
Q5WTI1_LEGPL          ------------------------------------------------------------
Q12L80_SHEDO          ------------------------------------------------------------
Q080K7_SHEFN          ------------------------------------------------------------
A4Y804_SHEPC          ------------------------------------------------------------
D4ZIY3_SHEVD          ------------------------------------------------------------
B0TKB4_SHEHH          ------------------------------------------------------------
A3QFJ7_SHELP          ------------------------------------------------------------
A1S5R5_SHEAM          ------------------------------------------------------------
Q5QUJ9_IDILO          ------------------------------------------------------------
E1SMV2_FERBD          ------------------------------------------------------------
F2GBA5_ALTMD          ------------------------------------------------------------
Q15UZ3_PSEA6          ------------------------------------------------------------
Q3IKC0_PSET1          ------------------------------------------------------------
A4SKA4_AERS4          ------------------------------------------------------------
D0KWM8_HALNC          ------------------------------------------------------------
A0A2W1K6W8_ACIFR      ------------------------------------------------------------
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          ------------------------------------------------------------
A1AU91_PELPD          ------------------------------------------------------------
B9M6F0_GEODF          ------------------------------------------------------------
Q39WG2_GEOMG          ------------------------------------------------------------
B5EFS9_GEOBB          ------------------------------------------------------------
Q3A212_PELCD          ------------------------------------------------------------
A9FIZ2_SORC5          ------------------------------------------------------------
D0LY52_HALO1          ------------------------------------------------------------
Q1D2R5_MYXXD          ------------------------------------------------------------
B4UDF6_ANASK          ------------------------------------------------------------
Q6MNS9_BDEBA          ------------------------------------------------------------
A9A0M3_DESOH          ------------------------------------------------------------
B8FHS3_DESAL          ------------------------------------------------------------
E1QL74_DESB2          ------------------------------------------------------------
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ------------------------------------------------------------
B1ZZB8_OPITP          ------------------------------------------------------------
SMC_DESHY             ------------------------------------------------------------
A4J682_DESRM          ------------------------------------------------------------
Q67PF3_SYMTH          ------------------------------------------------------------
B0TGW8_HELMI          ------------------------------------------------------------
Q2RJX0_MOOTA          ------------------------------------------------------------
SMC_BACSU             ------------------------------------------------------------
C5D8T7_GEOSW          ------------------------------------------------------------
D5DQR5_BACMQ          ------------------------------------------------------------
B7IUK7_BACC2          ------------------------------------------------------------
Q9KA07_BACHD          ------------------------------------------------------------
Q5WFM8_BACSK          ------------------------------------------------------------
Q7ZAM6_OCEIH          ------------------------------------------------------------
D6XTT7_BACIE          ------------------------------------------------------------
Q81ZN4_ENTFL          ------------------------------------------------------------
A0A0E0UX46_LISMM      ------------------------------------------------------------
B1HQH6_LYSSC          ------------------------------------------------------------
C6D303_PAESJ          ------------------------------------------------------------
C0ZFN9_BREBN          ------------------------------------------------------------
C8WWA4_ALIAD          ------------------------------------------------------------
D5WPA2_KYRT2          ------------------------------------------------------------
C4L5Z7_EXISA          ------------------------------------------------------------
B1YIN0_EXIS2          ------------------------------------------------------------
D3R1B0_MAGIU          ------------------------------------------------------------
D2RLB2_ACIFV          ------------------------------------------------------------
D1BLY1_VEIPT          ------------------------------------------------------------
A5UQ60_ROSS1          ------------------------------------------------------------
B8G556_CHLAD          ------------------------------------------------------------
A9B100_HERA2          ------------------------------------------------------------
D1C6T1_SPHTD          ------------------------------------------------------------
D7CMX2_SYNLT          ------------------------------------------------------------
Q0AYV7_SYNWW          ------------------------------------------------------------
SMC_LACPL             ------------------------------------------------------------
Q03RT7_LACBA          ------------------------------------------------------------
B2GD41_LACF3          ------------------------------------------------------------
A5VKP1_LACRD          ------------------------------------------------------------
Q03FW9_PEDPA          ------------------------------------------------------------
A0A249N2C3_LACRH      ------------------------------------------------------------
Q38XR7_LACSS          ------------------------------------------------------------
Q1WU99_LACS1          ------------------------------------------------------------
Q04GL1_OENOB          ------------------------------------------------------------
Q03VW6_LEUMM          ------------------------------------------------------------
A0A0U5K8Z4_LACDE      ------------------------------------------------------------
E4SKB3_LACAR          ------------------------------------------------------------
Q74IP9_LACJO          ------------------------------------------------------------
A0A0T8KIP4_STREE      ------------------------------------------------------------
A4VVL7_STRSY          ------------------------------------------------------------
C0MCR5_STRS7          ------------------------------------------------------------
A2RLZ7_LACLM          ------------------------------------------------------------
B9EBB4_MACCJ          ------------------------------------------------------------
SMC_MYCHR             ------------------------------------------------------------
E0TKT8_MYCHH          ------------------------------------------------------------
Q4A770_MYCH7          ------------------------------------------------------------
C5J708_MYCCR          ------------------------------------------------------------
A5IYM7_MYCAP          ------------------------------------------------------------
D5E4P4_MYCCM          ------------------------------------------------------------
Q6KHN4_MYCMO          ------------------------------------------------------------
Q98PK8_MYCPU          ------------------------------------------------------------
D1J8Q8_MYCHP          ------------------------------------------------------------
Q4A588_MYCS5          ------------------------------------------------------------
SMC_MYCGE             ------------------------------------------------------------
SMC_MYCPN             ------------------------------------------------------------
Q7NBU0_MYCGA          ------------------------------------------------------------
Q8EVS6_MYCPE          ------------------------------------------------------------
Q9PR04_UREPA          ------------------------------------------------------------
Q6F1N4_MESFL          ------------------------------------------------------------
Q6MTD2_MYCMS          ------------------------------------------------------------
E3GP81_9FIRM          ------------------------------------------------------------
SMC_HALOH             ------------------------------------------------------------
E4RL35_HALHG          ------------------------------------------------------------
D9QRN7_ACEAZ          ------------------------------------------------------------
A8MHB7_ALKOO          ------------------------------------------------------------
A6TRT3_ALKMQ          ------------------------------------------------------------
A3DDY2_HUNT2          ------------------------------------------------------------
D5X8N2_THEPJ          ------------------------------------------------------------
D9R048_CLOSW          ------------------------------------------------------------
C4Z0E6_EUBE2          ------------------------------------------------------------
C4Z924_AGARV          ------------------------------------------------------------
E0RV40_BUTPB          ------------------------------------------------------------
A9KLR0_LACP7          ------------------------------------------------------------
D9S347_THEOJ          ------------------------------------------------------------
B2A2N3_NATTJ          ------------------------------------------------------------
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             ------------------------------------------------------------
B0C9C4_ACAM1          ------------------------------------------------------------
Q115J3_TRIEI          ------------------------------------------------------------
B2J925_NOSP7          ------------------------------------------------------------
E0UKI1_GLOV7          ------------------------------------------------------------
B7K4Q6_RIPO1          ------------------------------------------------------------
B0JSN6_MICAN          ------------------------------------------------------------
SMC_SYNY3             ------------------------------------------------------------
Q84EC7_SYNP2          ------------------------------------------------------------
D3EQ04_ATETH          ------------------------------------------------------------
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          ------------------------------------------------------------
A9B9B9_PROM4          ------------------------------------------------------------
A2BNJ6_PROMS          ------------------------------------------------------------
Q46EX0_METBF          ------------------------------------------------------------
D7EAF5_METEZ          ------------------------------------------------------------
D1YW78_METPS          ------------------------------------------------------------
A0B8B9_METTP          ------------------------------------------------------------
D4GT30_HALVD          ------------------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          ------------------------------------------------------------
O28714_ARCFU          ------------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             ------------------------------------------------------------
A6UQ42_METVS          ------------------------------------------------------------
A6UVP1_META3          ------------------------------------------------------------
SMC_METJA             ------------------------------------------------------------
C9RFQ3_METVM          ------------------------------------------------------------
D5VT24_METIM          ------------------------------------------------------------
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             ------------------------------------------------------------
C5A612_THEGJ          ------------------------------------------------------------
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             ------------------------------------------------------------
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             --------------ANINGVLGLTADLITADKKYQKVIDFIFGGLLIVENIDIATDILNK
E3H7H1_ILYPC          --------------PNEKGIIGIAADLLEFPEKYASVVKFLLGNLLVVEDMDTALRISKS
D1AK68_SEBTE          --------------PAGENIVGFVRDIVSYDKKIEKAAFFVFGNAILVKDLDSGLKILK-
SMC_CLOK1             -------------FEDIKGFIGVASELVSYSKEFKDVLDYILGRTIICENIDNAFEIAKL
D8GS00_CLOLD          -------------FKGISGYIGIASEVINYKDKFKNALEYVLGRTVICEDMDSALKIAKL
Q97IA1_CLOAB          -------------TRHEKGFIGIASELIDYDSTFLPAVNYVLGRTVIVDNMDSALKIAKL
A0Q0Y7_CLONN          -------------VKSIEGYIGIASELIKYDEKYLNAMNYTLGRTVIAKDMDSALNIAKE
Q895M7_CLOTE          -------------IKNTSGYIGIACELINYKEEFSQIIKHILGRTIICEDMDKALNIAKK
Q0SSA4_CLOPS          -------------IVESEGFLGIASDLVNFKEVYNNVINYVLGKTIICDNIDNAIKIAKM
A6LSM4_CLOB8          -------------ITEANGYIGIASDIISYDKEYKNIMDYSLGRTIICSDMDCALNIARI
D9SLC7_CLOC7          -------------IANMKGYLGIASELIEYEARFKKAIDFVFGRTLIAEELDAATAIAKA
D7APA8_THEM3          -------------ILSERGVIGVASKLIKYNDNLEEIFNFLLGRVIIVDTIENAVRLSKK
Q8R9W7_CALS4          --------------LTEEGVMGIASSLVKYAPSLERVFNFLLGRTLVVDTIETAIHLARK
D9TN88_THETC          ---------------NVDGVVGLASDIIEYDKRIEKAIKFILGRVIITRDIDTALLLTRK
C9YKI7_CLODR          --------------KANTKFIGIASDLITFDEKYRNIIENILGRTILINNIDEGIKFAKE
E3PS49_ACESD          --------------G------IIALDAIEYNDDYKDITAYLLGRTVIVEDIDKALEISKK
B0S1M4_FINM2          -----------------NLVLGHLNQFIKSDEKYRDIIDYFAQKTLVTENMDDAISVGSR
Q3AC59_CARHZ          -------------LTDSDGFIGTALDLISFPQELSKAYESLLGKVLVGKDYQSCLIIAKK
E4SF58_CALK2          --------------INADGFLGFADEFIDINDELRKVVEFLLGRTLVFDTIDRAIEYQRK
SMC_RHOBA             ------RPGDKIRLDGLAGVIGRADKMIDCEVELEPLVRHLLGNTWLVDTLATAIGLRKL
D2QWB0_PIRSD          ------LPSAPATVSRDGAVIGRADKLVQFDPRYAPLVRRLLGTTWVVRTLSDALGLHRS
D5SU17_PLAL2          --HFPLDHRRLVSLDGQPGVVTRADRLIRQERGVHGLAAAVLADTWIVHDLPTAVRLSAG
SMC_KORVE             --FSFVLDESMRLPFTP-DRVTPMKNCIRVLNGFGKSLEVVLPKLGNGYIVPDPAIGREL
C1F1T5_ACIC5          --FSFAATENAQATVAERAGVVPLKDCIRVLNGFGRSLEVILPKLRDGYVAPDTETARSL
Q01Y77_SOLUE          --RAPMPEPAIGPETGI---SARLSESLRLTNGFKDRAVDLMPRVSQCFLAEDRAAAQRL
SMC_MYCPA             WALDLIDAP--------------ERLRGAIT--------AMLSGVAVVDDLDRALALVAE
SMC_MYCTU             WALDLVESP--------------PQLVGAMI--------AMLSGVAVVNDLTEAMGLVEI
SMC_MYCLE             RALDLIEAP--------------PWLQGALI--------AMLYGVVVVNYLAEALGVVDI
A4FMG9_SACEN          WAVDLVRAP--------------DGLRPAVT--------AVLDRMAVVDDLATARELVGR
C8XH72_NAKMY          WAVDLIRAP--------------DMLLPALT--------RTLELVAVVPDAAAAIALIGA
D7GEI0_PROFC          RVRDLVQVP--------------QPMAPAVN--------ELLGEFLAVEDLDEAFAVVSG
Q2J6Z3_FRACC          AALDLVEIG-------------DDRFRTAVS--------SLLARTVVVEDLAAAERATAL
A8L599_FRASN          YALDLVTVV-------------DARYAPALR--------ELLADTVVADDLDVAGQVIEH
C9Z3S1_STRSW          FAADLVRTP--------------SDLTPAVR--------RLLHRIVVVDTLDDAEALVYA
D7CC86_STRBB          RAAELVSGP--------------GGLLAAVR--------WLLRDIVVVGTLEDAEELVER
B1VYX5_STRGG          AVADLVRGP--------------AALLGAVR--------GLVPDTVVVGTLEEAEELVAA
E4NHH3_KITSK          WAGELVDGP--------------PGPAAAAR--------RLLARTAVVEDLDTARELIAA
C7QGY1_CATAD          YVIDLIQVQ--------------EELRPAFT--------RLLNRMAVVEDLSEASELIGR
A0LV82_ACIC1          WLRDLVDAA--------------PEFRGTLD--------VLLRNVVVVDDLQTAHALVTR
A0JXV4_ARTS2          WAADLVTTSAAGLNGFPSTPEGDASEAGALVQ---VLLRRLLAGTAVAEDLESASALIRA
A1R7H8_PAEAT          WAADVVKIA-------------DPAAQGALA---------LLARTAVVDDVEAAADLIAE
A6W7T9_KINRD          AALSLVTVP--------------ADLQPAVA--------RLLGDVVVVADLTAAQDLVRT
D1BJA3_SANKS          VASSVVSAG--------------RGLGAGLV--------GVLDRTIVVDDLVQARRVVEA
C7NGM6_KYTSD          WATGVVRVP--------------PVLAGALG--------EALDGVALAADAEAARAVLDA
B2GFM7_KOCRD          LARDVLSAA--------------VTDDAAAADRVLAAVRAELATTVLVPDASAALTVLDA
E1VVN2_GLUAR          FAREVVSAP--------------AELDA--------LLERLFSGQYIVEDLGQLQAILDQ
A5CQQ2_CLAM3          AAASVVEAP--------------DGVR------------RILADVVFVDGLAEAVALLDG
Q6AE90_LEIXX          PAREVVDAP--------------SGVL------------GILAFTAIADDLDSARAASDA
D1AB24_THECD          YLADVIDVP--------------EQVRPALR--------HLLRGVVVVDGLQEAADLVRR
D6Y659_THEBD          WAADLVTAP--------------EALRPAVA--------ALLSDVVVVPDLVTARKVVEA
D7BMZ9_ARCHD          SAQGLILGE--------------NQVAQALR--------ALLHDTIIVRDLGVARRVLRA
D6ZIF1_MOBCV          WARELVHARK------------GQSLPPVVA--------TLLAGVAACQDLSEARDLVLT
C7R311_JONDD          HIPGLISAPD-------------PQLRAQLTL----FLHQWLADTVHVPHLEDARAWVKA
D6ZV06_BIFLJ          ALAALVTANP-------------DAENPAQAEAVVYTVRLLLADVAMTGTADEAQHIVAS
Q7ZAJ9_COREF          WLLDHVSLD--------------ATVTGPVT--------RLLADVVLVDDLPTAHTVIQD
Q8NNW5_CORGL          WLLDHVDLD--------------PAIAGPVN--------RLLADVVLVDDPSLGRQAIED
Q84F13_CORDP          WLLDYVELA--------------PEVSSTIV--------QILADVVLVDSYEHGREVVNH
Q4JUZ1_CORJK          WLLDLMDVP--------------TDLLRPLT--------ALLVDVVAVGSAAEARKVVAA
C4LJD3_CORK4          WFLDKVSVD--------------SEFTHAVT--------GLLVDVVAVPSVAAGVALVRD
D6Z8M0_SEGRD          MLLALVEAD--------------DELAPALF--------ALLAGVVVVDAPQEARAVLAQ
C8WGU5_EGGLE          ALVDELAYA------DEDAAAVE----------------ALLGDVAVCDDVDAAFAAHAR
C7MMZ7_CRYCD          CLLDYVEAD------PTVQEALQ----------------SLSGDVLVCKTLDDARGACR-
C7N560_SLAHD          -LLDRIDAD------ADVMGALE----------------SLIGDVVVVDTVDEAFAGSA-
E1QVK5_OLSUV          -LVDELVVT------EGAEGLVS----------------ALLGDVRIVDDVRCALRAHEE
C8W740_ATOPD          -LLEHVSAQ------KGAEALVQ----------------ELFGHVFVAQSLDDAYIARKN
SMC_RHOPA             -----------------------PELARRLAQI------GVVTKE-RGNELCEQLKTGQR
A7IGT2_XANP2          -----------------------PALNRRLAQV------GIVPRA-MGAGLVARLKAGQR
B8EMM7_METSB          -----------------------EALARRLNQI------GLVTRE-DGRRLRGALKPGQR
B8IQU0_METNO          -----------------------DRVARRLRQV------GIVSRT-EAASLRTALHPGQR
Q92RE8_RHIME          -----------------------EALRRALRQI------GIVESDGEAERLLPLLRAGQR
A7HQY9_PARL1          -----------------------NALARRLSQI------GIVVSVEEGNRLQPLLTPGQR
D8JUP9_HYPDA          -----------------------QELTRRLRQI------GVVH-RSAGPLLQPHLKPGQR
E3I0B2_RHOVT          -----------------------LELSRRLAQI------GVVASRDEGERLKASLAVGQR
SMC_RHOS1             -----------------------EVLRRRIGQI------GLVGRE-AGAALQPLLQPGQR
Q2W040_MAGSA          -----------------------APLARRLAQV------GVVKDAAAGEALRSLLAVGQR
D3P3X3_AZOS1          -----------------------PAAGRALAHI------AVVADAAQGAALAATLAPGQV
B6IR58_RHOCS          -----------------------PALARCLAHV------GVVTDAASGAAAAPRLRPGQV
Q2RPA2_RHORT          -----------------------ALLARRLGRV------GVVEDAAAAQALLPRLTPGQE
SMC_CAUVN             -----------------------PALAARLSHV------AVVTRA-NGDRLQKELKPGMR
B0T003_CAUSK          -----------------------PELAARLAHV------AVVARA-DGDRLAKGLPVGAR
Q0AMJ6_MARMM          -----------------------PALKARLDAV------GVIKAD-KAIEAAAKLKPGQR
E0TC69_PARBH          -----------------------DLLHRRLAMI------GVVSPE-AGPDLAQHLVPGQC
C6XRC2_HIRBI          -----------------------AALAARLSQC------GLVEAE-DAAKLKSQLKQGQR
Q0C0X5_HYPNA          -----------------------GELAARLAQC------GLVSAA-DGPRLMAELKPGQR
Q1GQU3_SPHAL          -----------------------AALARRLAQV------AVAETD-----GGQPLAVGQR
D4YX43_SPHJU          -----------------------PELARRLAQV------AVADGD-----EGQALAVGQR
Q2G9S3_NOVAD          -----------------------PELAARLALV------RVAEAD-----EGQVLRPGEW
D5BSU5_PUNMI          -----------------------NALNSALAGV------GVVEDEATAESIQSSLRPGQA
A5FVJ2_ACICJ          -----------------------DALRRALDHI------LLLPDGEDGEALQATLRPGQI
C5B6I7_METEA          -----------------------PQLAERLASV------GVVATAGEADAMAAGLVPGQR
Q937L3_DEIRD          ----------------------------LLREA------GVIGNLADLCPTDP-PLVGEA
Q1J060_DEIGD          ----------------------------LLREA------GVIGNLADLCPTDP-PLVGEA
L0A7J5_DEIPD          ----------------------------LLREP------GVLGNLAELCPSAP-AIVANV
D7BH70_MEISD          ----------------------------WSQEK------GVRGLARELVEVRGYPQVGAT
SMC_THASP             ATTATESSTAIATDVAPAVLALAGLVE-VRDPALRALVDDFLAGAWAVERLEDWLPLRAQ
A1K715_AZOSB          --------------APAGTVPLADRIT-LTDTSLQPLVRDWLGGHFAVDNLADWLPRRAE
C7RKG8_ACCPU          --------------GGARDDRLLARVR-CDHPELSAILADWLDAVLASPDLATALARRAD
Q3SJI0_THIDA          --------------------LLASKIT-SDDAAARIVLGDWLAGVYWAEDVDAARARQPS
SMC_DELAS             ----------------GRWQHLSDLLR-VNDAGLRAVLGDWLQDCYTAPTLEEALSRRSE
D6CTE6_THIA3          -----------VSTPPAGCRPLREGVR-SGDAGLASLLDDWLTAVFIAPTLQQALALRAT
SMC_BORPD             ---------------PQGLTPLASLLR-ITDPDLRTLLNDWLGNIYTAPDLGQALAARAT
SMC_BURP1             ---------------PGALRPLLPLVR-IDDAGLRAVLNDWLGTVFVADDLAQALAARMQ
A4SYV7_POLAQ          --------------APADFTPLLSRVQSAGGARLTSVLQEWLDNIYIASSLEDALHRREK
D5CRW3_SIDLE          --------------------LLANYVR-CQDAQAAPVVDDWLAGVYAVSNLSEALGQRNN
D9SGR3_GALCS          --------------------RLLDCVQ-SSNAQAS--INEWLASVYTVADVALGVSIRGQ
Q2YBB9_NITMU          ----AEGGGGKPPRDGEAGVALRSYLT-CSDTSVKSVVDEWLSGIFAIDSLEAGLSRRNL
Q0AE88_NITEC          --------------DRSTWKPLSILLN-CHSPAVQAVLENWLHGIFVIDDLKSGLAIRKQ
D7DI79_METV0          ----------------PQQNSLYSLME-KITPDLQAVLQDWLAGAYVLEEGVDANAARKG
C1D4R7_LARHH          -----------------AALTPLLQRVRLGDERFAPWLHDMLAGACSAGSLEEALAARDQ
Q7NR76_CHRVO          -----------------RAWPALSAAVKA-QAPFDAALGDWLAGVYLADTLDAALARRGE
A1KSF4_NEIMF          -----------------LPVQALLNQIQA-QPPFQTALHYWLDGVLCAPDLSYALAHQND
A1WY82_HALHL          --------------QQLPAPEE--DRLAARVHGSEA-ARELLAGIRCAADAAAAEALRPG
Q0AAV4_ALKEH          --------------AVASGGAGGGDWLADQVRDDGR-TAALLAGIRCADDLPTALARRGE
SMC_XANOR             --------------TDNANFAP--TSLAAKVQGPIA-IRRLLARLHTAEDLDAARTLQRS
B8GTL2_THISH          -------------GEAAAGGDA--PWLLDRVKGPKP-LNDLLRGVRTAGSLPEALALRGR
Q3JAH9_NITOC          -------------SAQANRTESGVPLLLSKVRAPWP-LDSILGGVYAVETLAEALVLRAS
D3RSW0_ALLVD          -------------PGSEPEPETGYWRLGQRAQSPWP-IGGLLGPTHTVAHLREALAARHD
B3PGR0_CELJU          -------------QRALSDSATKAPLLADKVTASWD-VPGLLAGIYIAEDLSTALALRRQ
A6V7X5_PSEA7          -------------RGAAKASGS----LLDKVRADAD-LSPWLARVTPVETLEQALAQRGA
Q0VR03_ALCBS          --------------GAVKATAGSKATLLRDHVEGQA-PEGLLAGVYVADNLDAALTLRSQ
C7RBE2_KANKD          ----------------NGSGGSHPNTLHSKIKNADA-LAGQLSKVKVADSLEQAMDIRGQ
Q2SD45_HAHCH          ----------------DEL-ASEALRFASASSVNSA-VAAWLDGVRSADSFSAAVERRHE
E4PL89_MARAH          ----------------EATDGSERSGLAAKVSGVPG-IASLLRGIDTVETVSDAMGMRSG
E1V8E9_HALED          ------------------ERQAPPGSLAAEVKGAGA-AAQWLATIRCVATREEAWAGQAA
D3SAL9_THISK          ---------------PGADAEIPRDSLAARVRGSAP-VGHWLARIHCATELEDARRRMAT
SMC_METCA             --------------QGPVAEGTGGPRLLDYIRAPLA-LEGLLAGIYCASDPAEAAERARS
SMC_COXBU             --------------SVSASAFDKAPTLASQVKSEWP-FQQWLAGIYIADTLDQAKQLQSS
Q5WTI1_LEGPL          ---------------ALNGEKQERPRLADKIQGLVPSTVNHLEHIYAADNLEEAKAWFPD
Q12L80_SHEDO          ----------------------------HQAFSAAVNLTPWTERLIWVEDLAYAKAHLNE
Q080K7_SHEFN          ----------------------------YPALTTPVNLTPWLQHVVWASSLSEAKELLPT
A4Y804_SHEPC          ----------------------------CTKIQSNVNLAPWLTGLKWAQDLQSAKQMLAK
D4ZIY3_SHEVD          ----------------------------WHGMSSNANLSPWLSLIRWAETLEQARELVSG
B0TKB4_SHEHH          ----------------------------LAAVKAPVNLAPWLNHVTWLETINQAMLQRGA
A3QFJ7_SHELP          ----------------------------WTGLSSEVNLAPWLSRLNWADSLSQAKAMLGS
A1S5R5_SHEAM          ----------------------------WGIMQAPANLAPWLDTVGFAESLNEAQERLVG
Q5QUJ9_IDILO          ---------------------------LASKVKGPLRYWAPLQQCLAIEQDADAKQQLQQ
E1SMV2_FERBD          ---------------------------LLDKIQSPFNLAPWLNHIYCADSEAQAQSWLQQ
F2GBA5_ALTMD          -------------PAFFNDIYLCDDDNELIQLIGNCTLHKEGDQAGKAHNGPGELRGKES
Q15UZ3_PSEA6          --------------------------GTLATVLGDSVIPQWMADIRIARTRQEALAARNA
Q3IKC0_PSET1          ----------------------------LAAFITQGVYPEVLSRIAYSKSG--ELKALED
A4SKA4_AERS4          ------------------------------ARLEGAHIPAFLNAIWLVEDRDAALARQPG
D0KWM8_HALNC          ----------------------DLEQKRSPSDALAPWLRDWQHTRHPAPSLNEALAQRHT
A0A2W1K6W8_ACIFR      ----------------------TLLQVLEMPESLTLGLSDWLWGLRMAPDLASALDQRHQ
A0A0J1A050_ACIBA      -------------------------NLTCLNDWIASPQLSIFSNVAIAQDLSHALNEQKQ
B3E294_GEOLS          ---------------------PDLLSLVEVNDNARLPVQRMLAQVLLANSLEEALAYS--
A1AU91_PELPD          ---------------------LPLERLVQVSGPHGGLVRHILGGVMLTETLAQALELA--
B9M6F0_GEODF          ---------------------VCLLDNISIVDPFREYIEPLLAHTYLVDSLEKALILG--
Q39WG2_GEOMG          ---------------------VPILSHVTIAEGRNPVVEHILAGTYLVGDLATACSLS--
B5EFS9_GEOBB          ---------------------APLLERVTVPAKHAQLVEPLLSGAYLARDLAHALELA--
Q3A212_PELCD          ---------------------RPLAEVVQCSPEVASQVMPLLQGVFLVDDLLPYLDAV--
A9FIZ2_SORC5          -----------------EGVLGPLVDRLVFAPEDEALARALVGDAVVVASAEVAARLAA-
D0LY52_HALO1          ----------------PQGVLGRMAELVAFADGYEQVGRRLLGDCLVVDTLERAVNLRG-
Q1D2R5_MYXXD          ----------------QPGVLAHALREVTCEEALTPLVQLLLGDVVIVQDVATARAWTE-
B4UDF6_ANASK          ----------------QPGFVAVCLDVVTFDPSYEKVARFLLGDAIIVRDLPSALEIWQ-
Q6MNS9_BDEBA          ----------------QDGVQAILKDVVQAADKFKNTVTYMLDGVAIVDSIRTALNLR--
A9A0M3_DESOH          ------------------GHADRLVDHLAVETGYEKMVHALIGNVLLAPDLETATALWHS
B8FHS3_DESAL          -------------------HASSLLQHVEAADGCGHLIKSLLSDVLVAEDAQAAVEL---
E1QL74_DESB2          --------------------ATRAVELATFAPGLEALAHLLEGVGCCADQAAAWAAA---
B3EFQ6_CHLL2          ----------------REG-GRRMMDIIGYPEALSAALNNLLFRYYLVDTLDTAENMSRQ
A1BDT4_CHLPD          ----------------PENEALRVIDLLQFPPELDNVLALMLHETYLVRDLNAAETLAMQ
A4SG64_CHLPM          ----------------IPG-AQKTIELLSAPPELHDALAMLLWGSYTVPTAETAEKLAFH
SMC_CHLTE             ----------------IEG-ARRAIDLVETPAELSKALNLLLQHCYVVADLDAAEQLGKK
Q3ATI3_CHLCH          ----------------IEG-AEPLANLVSVPPAWQHALRLLLGTTFVVANAEQAEALVKR
B4S519_PROA2          ----------------MES-ATPVLSLIDAPETIRKALWLLLRYAYITQDLATAETLSRQ
B3EM83_CHLPB          ----------------ING-TIKINSILSFPKSLSKAITALTEGCYLVDTFSTAETLASE
B3QRZ4_CHLT3          ----------------LPEGVYRTADVIRAPETVRALLAILLENAYVAESLEAAQQLAAA
D0MFL5_RHOM4          -----------------PDARPLLDHVRLARPELRPLAASLLHDAYLVDDLETARRLARS
Q2S457_SALRD          -----------------EGAVPLRDVVRTTDPAYAPLADTLLRDCFLVDTLAAAEALAEQ
C7PLU2_CHIPD          ------------------PGSIPALEVVELEERYKGLGNYLLGKVFIADDISILEFDQLA
E4TVF1_MARTH          ------------------DQAVAATEIVEYDAKYKKLIGFILDNVYVVKGDYNSIPD---
B2KBE7_ELUMP          ----------------------DVKNLIKYPSGLERLINCLSNSNVSGGTVKGGFWISGG
B1H0P2_ENDTX          -----------------PLGYVELIKYFRYNPEDEKIIRFLCSYTLVCGNKIYGNVIVQG
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ----------------VDHPLINFFLKDVIVKERSEELWNAESLARISHRILSEDGQDVR
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          ----------------SVVNVRDDSLFEPAQRLLSGC-----------------------
B1ZZB8_OPITP          ----------------QALAEMDP--AHPALGVLSEC-----------------------
SMC_DESHY             ----------------DPGFIGVAVDLITFAEKYRKAFESQLGRTLIVTDMEAATRVARA
A4J682_DESRM          ----------------LPGVVGLAANLIEVELKYRVVVELLLGRLVVVDTLDNAIQVARQ
Q67PF3_SYMTH          ----------------APGILGVALELVRFDERFRPAIASLLGRTLVAETLDAALALGRR
B0TGW8_HELMI          ----------------QPGVIGCAADLVRSATAHMPAVRFLLGRTLVMENLPGALQFARQ
Q2RJX0_MOOTA          ----------------EPGVVGVAAALVRSEAEIRPAVDYLLGQILVVADLRRALDLGER
SMC_BACSU             ----------------HSSFLGVASELVTFDPAYRSVIQNLLGTVLITEDLKGANELAKL
C5D8T7_GEOSW          ----------------HPAFVGIASELIHYDSAYRSVIANLLGNVIITTDLKGANELARL
D5DQR5_BACMQ          ----------------HEAYVGIASSLVKYEATYERVIKNLLGTVIVVNDLKGANELARL
B7IUK7_BACC2          ----------------HPSFVGVAAELVQYNNKYENVVSNLLGTVIVAKDLRGANELAKQ
Q9KA07_BACHD          ----------------HDAFVGIASELVSFDQRFTPVIRNLLGHVIVAKSLEGANAIARL
Q5WFM8_BACSK          ----------------EPGYLGIAADVVEAKPEHRQAVGFLLGSTILAETLPQANKIAKR
Q7ZAM6_OCEIH          ----------------QKGFVGIAANLIKVDDKYKKVLNHLMGHVIIAKTLKDANEIAKQ
D6XTT7_BACIE          ----------------IDGVIGQASRLIDTEPRLRPVIEHQLGNVVFTENLKQAQQAAKI
Q81ZN4_ENTFL          ----------------APGFVGIASELVRYPEQVQTVIQNLLGVTILAADLTSANQLAKL
A0A0E0UX46_LISMM      ----------------QPAFIALASEVISFDEKVSPVILNALGTTILAKDLKGANTLARL
B1HQH6_LYSSC          ----------------HPAFVRMADALVTFNEDNRTIVENLLGNVIVAANLEGASQIARL
C6D303_PAESJ          ----------------VDGFVGVAADLVSCEPRYEAIIQNLLGNVLLAETLEQANRIASK
C0ZFN9_BREBN          ----------------ESGVVGIASELVTFEEAYRPILESLLGNVIITEKLEQANRVART
C8WWA4_ALIAD          ----------------EPGFLGLASDLVSFDERFRHAVEHLLGNVVIAQDLERASRIART
D5WPA2_KYRT2          ----------------APGWVGVAADLVQAEPAFQSLVSYLLGQVAVAKDLRGAVEMARR
C4L5Z7_EXISA          ----------------MNGFVGVASELVETDASYETLKKSLLGSVLVAETLEVANRIAQS
B1YIN0_EXIS2          ----------------MPGYLGVASQLVTTREDFTKLKDNLLGTTLVVESLEQANAIARS
D3R1B0_MAGIU          ----------------VRGCWGVAADLVTVDGKLDLLKQYLLANVLVAEDMEVGRYIAKM
D2RLB2_ACIFV          ----------------CPGIIGIAGDLVRCEEAVRPAVRFLLGQVLVADNLDHAMAAARK
D1BLY1_VEIPT          ----------------ESCVLGTAVDCISFDNKYAHIFQYLLGRTLVVSSMDDAIGLQKK
A5UQ60_ROSS1          ----------------EDGVLGVAADLIDVDERYRPVVELLLGRTLVVRTLAVARRELQR
B8G556_CHLAD          -------------------VIGIAAELVEYDPRYAVVVEQLLGRTLVVADLATARSELRH
A9B100_HERA2          -------------------VLGLASELVNYAEAYERAVQHLLGRTIVVEDLATARRVLAE
D1C6T1_SPHTD          --------------------RGLAVDLIDYDPRVEQVVTGLLGRVVVTDDLTATRAILRA
D7CMX2_SYNLT          ----------------MPGVVGWGHELVDYPAGFEKVVKYLLGRVVVVETLQSAVKVYRE
Q0AYV7_SYNWW          ----------------QDGVLGLASRLVHYDKKFAKAVEYLLGRVLLVEDLSRGIRIFRE
SMC_LACPL             ------------------------------------ARQLPVNTERDLSQQPGVLGVASE
Q03RT7_LACBA          ------------------------------------GRQIDRQTLQLLHSMTGYLGVGSE
B2GD41_LACF3          ------------------------------------GG-FAPRNLAKLVTMPGYVGRAGE
A5VKP1_LACRD          ------------------------------------HR-RPLSIWPQLTGLPGFLGRATE
Q03FW9_PEDPA          ------------------------------------QRSIREDTLQKVKKMPGFVGVAAD
A0A249N2C3_LACRH      ------------------------------------PRELPSAVLQLVESADGFLGTGLQ
Q38XR7_LACSS          ------------------------------------PRTLPSSLVNQLQTEPGFIGIASD
Q1WU99_LACS1          ------------------------------------ARMLNKQYRVTLESLDGYVGIASE
Q04GL1_OENOB          ------------------------------------ARYLPANIRSQLDQEKDFIGIGAA
Q03VW6_LEUMM          ------------------------------------SRHLSG--LEAVQHMDGFIGVAAN
A0A0U5K8Z4_LACDE      ------------------------------------YRAIPASTRQALERFAGFQGLASE
E4SKB3_LACAR          ------------------------------------QYGIPQSTVTTLESYEGFRGVASD
Q74IP9_LACJO          ------------------------------------HNEIAASTLNSLQSIEGFKGVAAD
A0A0T8KIP4_STREE      ------------------------------------ARTISSQNQDAIAVSPGFLGMADE
A4VVL7_STRSY          ------------------------------------PRQLSGQQVSLLESSEGFLGLASD
C0MCR5_STRS7          ------------------------------------ARQLSEVTLKQLRACQGYLGTADS
A2RLZ7_LACLM          ------------------------------------GRDFNG--LNRIQNMTGFVDLAIN
B9EBB4_MACCJ          ------------------------------------PRNITSDIVTGLTQFEGYIGTLNT
SMC_MYCHR             ------------------------------------EREVREDHLLVLKGQKGFLGVAKE
E0TKT8_MYCHH          ------------------------------------EREVREDYLLVLKGQKGFLGVAKE
Q4A770_MYCH7          ------------------------------------PRFIPDLYLEHLNSQKGFINLASN
C5J708_MYCCR          ------------------------------------PRYVHETHMLVLRGQKGFINIAYN
A5IYM7_MYCAP          ------------------------------------PKSVRDDHLLAIQGQPGFIAVASE
D5E4P4_MYCCM          ------------------------------------AKSIRDDHMLVIQTQPGYIGIASE
Q6KHN4_MYCMO          ------------------------------------PKKIRENHLYVLPSLDGFIDIAEN
Q98PK8_MYCPU          ------------------------------------PKSIKDEHFLALNMKKGFIDVASN
D1J8Q8_MYCHP          ------------------------------------PKFVPEQHIVVAQTQKGFLGIASE
Q4A588_MYCS5          ------------------------------------AKSIRQDLYYGLQSYNGFLCAANE
SMC_MYCGE             ------------------------------------DTKITNEHMEILKQLDGFLGVCSD
SMC_MYCPN             ------------------------------------DTKIAPEHMEILQQLDGFLGVGSD
Q7NBU0_MYCGA          ------------------------------------DRDVKPEHLEVLEQVEGYLGIAAN
Q8EVS6_MYCPE          ------------------------------------PKPMRDEHHQILLQLDGFIGIASE
Q9PR04_UREPA          ------------------------------------AKSIKPEFYDVLKELEGFVGVANE
Q6F1N4_MESFL          ------------------------------------PSSIAGPQRDIIKRAPGFVGFANE
Q6MTD2_MYCMS          ------------------------------------PNLINPVQRQILEKSEGFVGFANE
E3GP81_9FIRM          ------------------------------------YGRVEARDLEILSRTPGFEGIASE
SMC_HALOH             --------------------LGIASSFVDCEDYLKPVIEYLLGRTIISTDLKSAIEIARL
E4RL35_HALHG          --------------------KGLAVDLVDFPERLENVFNYLLGQIVVSDNLENAVKMAKG
D9QRN7_ACEAZ          --------------------LGIAADLIDYQDKFSPVVKNLLGRIIIADNIDAAVTISKK
A8MHB7_ALKOO          --------------------AQIAFDIIQYENTFKNIFSSLLSRVLVVRSLDQGIELARK
A6TRT3_ALKMQ          --------------------VKVAYDLVDCANEFKTIFSNLLSRVLIVENMDKGIKVAQN
A3DDY2_HUNT2          --------------------VGVASDLIEYDEQYRGIILSLLGKVVVVESLDAGIRMARK
D5X8N2_THEPJ          --------------------VGIAAELVTFDREYEPAVKSLLGNIIVAEDIDTALQIAKD
D9R048_CLOSW          --------------------LGLANTLVKADEEYEGLLNYLLGRVVVVDTIDHAIALAKK
C4Z0E6_EUBE2          --------------------IGIASNLVRVSFEYENLAKYLLGRILVVDNIDNALLIAKK
C4Z924_AGARV          --------------------LGIANKLVKCDPKFDEVVAYLLGRVIVVDTIDNAIALAKK
E0RV40_BUTPB          --------------------LGMADELVTTDPKYRSVAKAMLGRIVAVDNVDNAVKIARK
A9KLR0_LACP7          --------------------IGLANTLVHAESRFDDLLKYLLGRTYVVDHIDHAIALSKK
D9S347_THEOJ          --------------------IGLAYKLIEYDKKFTPVLTYLLGRVIVAEDMDSALTIARK
B2A2N3_NATTJ          --------------------TGIASQLITISEKYRVVAEHLLGRVIVVPNMDTGLELAKK
A8F8R1_PSELT          ------------------FVGYAAQVVRVNE-KFSALPGYLFGNDIIVKNLEDAVDIKKR
A5IN04_THEP1          ------------------FVGYAVDLVKLPS-DLEVLGGFLFGNSVVVETLDDAIRMKKE
C5CIS4_KOSOT          ------------------FLGYAAKVVDVAE-EFKIVPEYLFGSAIVVKSLDDAIDIRKN
A7HMD4_FERNB          ------------------FIGYAAKLVNVSK-EYEALPYFLFGNDIIVKDIDNAIEIKRK
B7IHN5_THEAB          -------------------IDFAKNLVKVKIDEKEKLLNYLFGNDIVVENIDIAVDIKRK
SMC_THEEB             -----------LSPIALAGCIDYALNLVTFEPQYAPIFAYVFGSTLVFESLEAAREYLG-
Q2JHS4_SYNJB          -----------PSPLKLDGLIDYAIRLVRFEERYRDVFGFVFGSTLVFQSLELAQPHIG-
SMC_SYNP6             ---------EIPRWQQPEGLVDLAIALVDCDDRYREVFKFVLGGTVVFERLDQARRYMG-
B0C9C4_ACAM1          ---------KGLPSLTASGAIDFAIELIDFDPIYEPIFAYVFGNTVVFKTLSDARRHIG-
Q115J3_TRIEI          ---------DGSLGWGAAGFIDYAVNLIECDPHYQDIFAYVFGSTLVFDILVNARKYLG-
B2J925_NOSP7          ---------DATLRF-ASGFVNYAVNLVDCDRRYKDVFSYVFGNTVVFANLEAARKNLG-
E0UKI1_GLOV7          ---------TYNLRF-AKGFVNLAVNLINCNPRYNNIFSYVFGGTMVFETLEDARHYLG-
B7K4Q6_RIPO1          ---------NPLLRQ-SKGFIDLAVNLVLCKPEHSDIFAYVLGNTVVFETLNDARSHLG-
B0JSN6_MICAN          ---------ISSLRH-ARGYLDLAVNLVKFQSQYREVFNYIFGSTVVFEDIDSARYYIN-
SMC_SYNY3             ----------PNLSY-AHGYIDLAVNLIDGDRRYADIFAFIFGNTIVFDTLVNARNHLG-
Q84EC7_SYNP2          ---------NTIPRY-AQGFVDFAVNLIQCDRRYLDIFRYVFGSTAVFESLDLARNFMG-
D3EQ04_ATETH          ---------NFYLKN-APGFIGLAVDLVECNSKYAKVFSYIFGNTAVFETIDYAKQYSG-
SMC_GLOVI             ----------YLERLHEEGAIGYALDLIEFDRRYEAAFVQVFGDTVVFRSLELARRQLG-
A5GQT1_SYNR3          --------LQRGGAPSGGGCLGRAVELLHFEPIYRDVFGHVFGDTLVYSDLQSARRELG-
A9B9B9_PROM4          --------FSNATNRYMEGLIGGAIELVKFESIYKGVFSYVFGDTLVFKDINSARSYLG-
A2BNJ6_PROMS          --------FENNRE---NGFIDKAINLITFDEVYSDVFRYVFGDTLVFSDLSSARLSIQ-
Q46EX0_METBF          ---------RLENLSYENGVIGYAIDLIQFDSGFEPAFWYVFQDTLVMENLESARRLMG-
D7EAF5_METEZ          ---------PYKDLSDKKGVVGYAIDLIDFDDKFEPAFWYVFRDTLVMDSLENARKLMG-
D1YW78_METPS          ---------QLRNIR-EPGVIDYAINLVQFDGRFDPAFWYVFGDTLVVDTLETARRLIG-
A0B8B9_METTP          ---------SLPEVPRVPGVIDFALNLIRFDDRFYPAFWYVFRDTLVVEDLDTARRMIG-
D4GT30_HALVD          ---------SLPREPDNPGVVDFARNLVDYDSQYESIFSYVLGSTLVVEDMETARDLMG-
A7IAD8_METB6          ---------QLPPIK-EPGIIDYAVNLLDYDPVYDKAFAIALGSTVVVDTLDRARKLIG-
A3CWK7_METMJ          ---------ILSPLEADPGIVGYAVDLLEFDPAFDRAFRVVFGATVVVDTLERARRLMG-
B8GG37_METPE          ---------PLPPVD-GDGIVGYARHLIAYDPLYDPAFGQVFGTTLVVDTLNRARTLMG-
E1RII6_METP4          ---------ESYPSL-DKNVINYAVNLLDYDSRYDVVFRHVFGTTVVVDKMDTARKMIG-
Q2FLH3_METHJ          ---------PLPSLPPGSDVLGFALDLLDYDPRFDAAFRVVFGSTIVIDTLDHARKRIG-
A2SS75_METLZ          ---------PPLPPLAGNGVVDYAINLIDFDPEYRDAFNLVFGQTVVVETLDAGRRLMG-
D3RYW2_FERPA          --------ELDKKVLKEKGVIDYAVNLIKCDEKFRPIFNFVYRDTLVVDNLDNAKRLMD-
O28714_ARCFU          --------SLDKSILKEDGVIDFAVNLVRCDKKFQPVFRFILRDTVVVDRIETAKRLMDR
D2RFP2_ARCPA          --------NLDKSVLSVEGVIDYAVNLIECDRKFRKVFELVYKDALVVEDIDTAKKFMN-
SMC_THEAC             ---------DVGKISKDPGYLGILMDFVDFEDQYRSAVYYAIRDTILVQDIDAGRRLMG-
Q97AI9_THEVO          ---------EPDILSRDAGFLGFLIDFIDFDDKYRNAVFWVFRDTGLVSDIDAGRRLMG-
SMC_METVO             ------------KDISDTGIIGKAIDLVEFDIKYTNVFKFIFGNTHIVDNLENAKKLSLK
A6UQ42_METVS          ------------MYLNEEGVIGRAIDLVEFNPEYECVFKYVFGNTLIVKDLNIAKKLSKE
A6UVP1_META3          ------------KHIKGDGVIGRAVDLVEFKEEYRTLFNYIFGSSIIVENLNIAKELSKI
SMC_METJA             ------------YYIDEDGVIGRAIDLVEFDEKYRRVFEYVFGNTVVVENIDIAKELAKK
C9RFQ3_METVM          ------------VFINEKGVVGRAIDLVEFDEKYRDVFEYVFGNTVIVENIDVAKELSKK
D5VT24_METIM          ------------EHIYEDGVVGRAIDLLSFSPEFQKVFEHVLGNTIIVENIDIAKELSKK
D3SQ87_THEAH          ------------PYPRVRGYVDFAIRLVEYDPRVEKAIKFVFGDTLVVEDYERAKAI--G
D3DG53_HYDTT          ------------PYPRRKGFIDFVVNLVEYDRKFEKAVRFIFGDTLLVENFQSAKDL--G
SMC_AQUAE             ------------RYPRTKGAVDFAVNLVEYDPKFEKVVKFVFGDTLIVENFESAKAI--G
B4U7R1_HYDS0          ------------PYPRQRGYIDFAVKLVDYDKALEPAISFVFGDTLVVESFDVAKSL--Q
C0QSN8_PERMH          ------------KPPYMRGVIGLAVDFIDYDKKIEKAVRFVFGDTVIVQDFDSARNL--G
B2V736_SULSY          ------------KLPLAKGVLGYAIDFVNYDKKVEKAIKYVFQDTIIIDTFDTAKVL--G
SMC_PYRFU             ------------HVD--SSVGLPAVDVIEYDQKIENAVKFALGDTVIVNSMEEARP---H
C5A612_THEGJ          ------------SMRERPSLGVPAMDVVQYDPRFKNAVAYALGDTLIVEDMDEARSV--G
D1CC09_THET1          ----------------IDGVVGIASELVSYPEQIDRAISYMLGRILVVRDLGIARQVLPS
D3TAQ9_ACIB4          -----------------PHAIGFAMDLIKFDPKFEAAFWYVFGDTVIVDTLDNARKLMGG
SMC_HALMS             ------------------GDITPVHELLNLPEEYKSKLIPFFDGYFIASKFDQEVFKSIS
Q6L0R1_PICTO          -----------------DGILGFLRDFVSYDKEFENIIYYVFSDTLLADSMETARKHMTG
C1A7M6_GEMAT          ----------------------------ELGADDGALAGSVQASGPTSRWVRALLGKVRA
C9RN51_FIBSS          -----------------PCVVGSLKDFVKTDDEVSPWLSGILSRYFVVDSLQTALNLAKE
D1B5Z0_THEAS          ----------------------------RPDRANLRSAPGVVGFAMDLIEADSRYERALQ
                                                                                  

SMC_FUSNN             NLFSGN---------------------------------------IVTLTGELVSSRGRI
E3H7H1_ILYPC          NVHRGN---------------------------------------IVTISGELLSGRGRI
D1AK68_SEBTE          NGFNDR---------------------------------------IITVDGELITSRGRI
SMC_CLOK1             AEYSFKIVTL---------------------------------------SGDVVNSGGAI
D8GS00_CLOLD          SGYSFRIVTL---------------------------------------AGDVVNSGGSL
Q97IA1_CLOAB          NSYSFKIVTL---------------------------------------TGEVVNPGGSL
A0Q0Y7_CLONN          WGYSYKIVTL---------------------------------------NGDVVNPGGAL
Q895M7_CLOTE          LNYRYKIVTL---------------------------------------AGEIINAGGAL
Q0SSA4_CLOPS          LNYRHKIVTL---------------------------------------SGEVVNAGGAL
A6LSM4_CLOB8          GKYNYRIVTL---------------------------------------DGEIINPGGAL
D9SLC7_CLOC7          SNYSYRIVTL---------------------------------------QGEVVSPGGSL
D7APA8_THEM3          YNQAYKIVTL---------------------------------------EGEVINPGGSI
Q8R9W7_CALS4          YDQAFRIVTL---------------------------------------DGELINIGGAI
D9TN88_THETC          FKNQYKIVTL---------------------------------------KGEVINPGGSI
C9YKI7_CLODR          TGHRFKIVTL---------------------------------------DGEILNPGGSL
E3PS49_ACESD          YKNSFRIVTK---------------------------------------DGDIFNAGGSI
B0S1M4_FINM2          YK-NFRIVTL---------------------------------------DGDIINSWGSM
Q3AC59_CARHZ          TKHRYKVVSL---------------------------------------EGELLLPGGII
E4SF58_CALK2          VGYKARCVTL---------------------------------------SGELISPGGVF
SMC_RHOBA             SSAG-----------------------------------------LRFVTASGDLLDNDG
D2QWB0_PIRSD          SGST-----------------------------------------VRLVTLTGEVIEPNG
D5SU17_PLAL2          EGQS-----------------------------------------CRFVTLQGEVLEANG
SMC_KORVE             ALEN-----------------------------------------PDAFFLSQSGECFHN
C1F1T5_ACIC5          ALEH-----------------------------------------PRAFFLAPSGECFHN
Q01Y77_SOLUE          AVSY-----------------------------------------PHLYFLLPDGVCYHG
SMC_MYCPA             HPR------------------------------------------LRAVTLD-GDLVGAG
SMC_MYCTU             RPE------------------------------------------LRAVTVD-GDLVGAG
SMC_MYCLE             CPQ------------------------------------------LRVVTVD-GDLVGAG
A4FMG9_SACEN          HPE------------------------------------------VRAVTST-GDVLGGH
C8XH72_NAKMY          VPD------------------------------------------VRCVTAD-GDVIGPD
D7GEI0_PROFC          DPQ------------------------------------------LQVVTRR-GELLSAW
Q2J6Z3_FRACC          RPD------------------------------------------LRVVTRA-GDVIGAP
A8L599_FRASN          SPE------------------------------------------ARVVTRD-GDVVGPR
C9Z3S1_STRSW          RPD------------------------------------------LTAVTAE-GDLLGAH
D7CC86_STRBB          RPE------------------------------------------LTAVTAE-GDLLGAH
B1VYX5_STRGG          HPG------------------------------------------ITAVTAE-GDVLSAH
E4NHH3_KITSK          DPD------------------------------------------WQAVTRA-GDLFSAA
C7QGY1_CATAD          IPD------------------------------------------VRAVTRD-GDVLGRD
A0LV82_ACIC1          HPG------------------------------------------LRVVTRD-GDLLAAA
A0JXV4_ARTS2          QAG------------------------------------------LTVVTRA-GDVFTAF
A1R7H8_PAEAT          HPG------------------------------------------LRAVTRE-GDVLTSL
A6W7T9_KINRD          RPD------------------------------------------LVAVTRD-GDLLGTH
D1BJA3_SANKS          HPG------------------------------------------WTVVTRA-GDLLSSD
C7NGM6_KYTSD          TPG------------------------------------------VRAVATATGELWTRH
B2GFM7_KOCRD          ARALGS-----------------------------------AGHGVRAVTRD-GDVYGGH
E1VVN2_GLUAR          YPS------------------------------------------AQLTTLE-GISVSAA
A5CQQ2_CLAM3          P-----------------------------------------DAPATAITRA-GEVVSAH
Q6AE90_LEIXX          YRKR-K-----------------------------------LAGPVTLITRA-GEVLTEH
D1AB24_THECD          EPS------------------------------------------LRAVTRE-GDLLGAH
D6Y659_THEBD          NPR------------------------------------------LRAVTRA-GEVLGAY
D7BMZ9_ARCHD          G-A------------------------------------------QRVATVN-GDLFTPT
D6ZIF1_MOBCV          GGV-------------------------------------------TAAVTQVGDFLSAT
C7R311_JONDD          HPT-------------------------------------------DTAVTDQCDVVRSH
D6ZV06_BIFLJ          GEA------------------------------------------MRAVTKN-GETFTHG
Q7ZAJ9_COREF          DPR------------------------------------------LRAVTRE-GVIAGSG
Q8NNW5_CORGL          DPR------------------------------------------LRAVDRN-GVLIGAG
Q84F13_CORDP          DPR------------------------------------------LRAVCVD-GTMWGHG
Q4JUZ1_CORJK          DPR------------------------------------------LRAVTKD-GSVYGAG
C4LJD3_CORK4          DAR------------------------------------------LRAVTKS-GIVIGPG
D6Z8M0_SEGRD          HPR------------------------------------------AKVVTKS-GDLIGLG
C8WGU5_EGGLE          GAEGVRFVTRGGC----------------------------VVWP---------NGKVTL
C7MMZ7_CRYCD          --AGWRAVTPDGV----------------------------MALP---------TGTIHL
C7N560_SLAHD          -EAGVRYLTRDGV----------------------------LVWP---------GSKARV
E1QVK5_OLSUV          -SRPYTYVTPDGV----------------------------AVLP---------DGRTTM
C8W740_ATOPD          -EPRGLYVLLDGT----------------------------LLYP---------DGRLVL
SMC_RHOPA             LVS-------------------------------------------LDGDVWRWDGFV--
A7IGT2_XANP2          LVS-------------------------------------------VEGDLWRWDGVV--
B8EMM7_METSB          LVS-------------------------------------------KEGDLWRWDGFF--
B8IQU0_METNO          LVT-------------------------------------------REGDLHRWDGFT--
Q92RE8_RHIME          LVT-------------------------------------------RQGAVWRWDGHV--
A7HQY9_PARL1          LVT-------------------------------------------REGALWRWDGYT--
D8JUP9_HYPDA          LVS-------------------------------------------LEGDLWRWDGFV--
E3I0B2_RHOVT          LVT-------------------------------------------REGDLWRWDGFV--
SMC_RHOS1             LVS-------------------------------------------IEGDLWRWDGFR--
Q2W040_MAGSA          LVT-------------------------------------------PEGDLWRWDGYVAR
D3P3X3_AZOS1          LVS-------------------------------------------RDGGAWRWDGLTVQ
B6IR58_RHOCS          LVT-------------------------------------------RQGHAWRWDGLTVT
Q2RPA2_RHORT          VVD-------------------------------------------RAGGLWRWDGLVRR
SMC_CAUVN             LVS-------------------------------------------KDGDLWRWDGFVAR
B0T003_CAUSK          LVS-------------------------------------------KEGDLWRWDGFVAR
Q0AMJ6_MARMM          LVT-------------------------------------------REGDLWRWDGLVAR
E0TC69_PARBH          LVS-------------------------------------------TVGDIWRWDGYVAK
C6XRC2_HIRBI          LVS-------------------------------------------KEGDLWRWDGFVRT
Q0C0X5_HYPNA          LVS-------------------------------------------REGHLWRWDGFTRT
Q1GQU3_SPHAL          LVT-------------------------------------------LSGVMRRWDGFVTR
D4YX43_SPHJU          LVT-------------------------------------------RDGQLRRWDGYVAI
Q2G9S3_NOVAD          LVT-------------------------------------------RSGRLRRWDGFVAR
D5BSU5_PUNMI          VTT-------------------------------------------KSGHLWRWDGFVRH
A5FVJ2_ACICJ          LVS-------------------------------------------IEGGVWRWDGFVVR
C5B6I7_METEA          VVS-------------------------------------------ADGYMRRWDGFRST
Q937L3_DEIRD          VLA-------------------------------------------DTLLVDDLSTANRL
Q1J060_DEIGD          ILA-------------------------------------------DTLVVEDLRAANRL
L0A7J5_DEIPD          LLA-------------------------------------------DSLLVQDARTATRL
D7BH70_MEISD          LFG-------------------------------------------ETLVLESLEAALSL
SMC_THASP             LAPSTC--------------------------------------LVGPRGQVLTRDALVH
A1K715_AZOSB          LPAGTV--------------------------------------LVSRVGQTLSRHALTH
C7RKG8_ACCPU          LSGNAC--------------------------------------CVTPGGDIVTRQSVTL
Q3SJI0_THIDA          LGAGEH--------------------------------------VVTPQGHLFTRHSVTF
SMC_DELAS             LRPGET--------------------------------------VYVPTGHAVSSHSVSF
D6CTE6_THIA3          LPAQTV--------------------------------------LLTREGHAVSRQSVSF
SMC_BORPD             LPAGAA--------------------------------------CVVPAGHLVDAHSVRF
SMC_BURP1             LPQGGA--------------------------------------FVVKAGHVVTRSGVQL
A4SYV7_POLAQ          LPAGGA--------------------------------------FVTQQGHLVSRVSVQL
D5CRW3_SIDLE          LPAGAW--------------------------------------LVTAQGHLVGAHSVLF
D9SGR3_GALCS          LPSGGR--------------------------------------FVTPEGHLIDRRSVLF
Q2YBB9_NITMU          LSPGEM--------------------------------------LVTREGCVVTSHSLTF
Q0AE88_NITEC          LAAGEM--------------------------------------LVTAEGHSITGHGVSY
D7DI79_METV0          LAYGEY--------------------------------------LVNKQGDIYTAQSVTY
C1D4R7_LARHH          LAAGER--------------------------------------CFTPEGHVVSPTAVQY
Q7NR76_CHRVO          LTAGEC--------------------------------------WLTPEGHRVDAVSVRY
A1KSF4_NEIMF          LGAHQI--------------------------------------WLTPEGHQVDKVSVLL
A1WY82_HALHL          LAAGET--------------------------------------VVTPDGVWMGANWVRL
Q0AAV4_ALKEH          LAAGES--------------------------------------FITPDGVWLGANWLRL
SMC_XANOR             LPEGDS--------------------------------------VITRNGERLGEGWVRV
B8GTL2_THISH          LAAGES--------------------------------------VITPEGIWLGRAWLRV
Q3JAH9_NITOC          LAPGES--------------------------------------IMTRNGIWLSLAWLSL
D3RSW0_ALLVD          LSRDAT--------------------------------------LITPEGIEVGRHWLRV
B3PGR0_CELJU          LSGHES--------------------------------------VVTRDGIWLSAHWVRV
A6V7X5_PSEA7          LDDGES--------------------------------------LISRDGYWVGRHFLRV
Q0VR03_ALCBS          LEAHES--------------------------------------VVTRDGIWLGPDWLKV
C7RBE2_KANKD          LAEDES--------------------------------------VITQDGLWLGKNWLRV
Q2SD45_HAHCH          LSDRAF--------------------------------------FLTPDGMQVGRDWILA
E4PL89_MARAH          LRDGQS--------------------------------------LMTPEGVWISREWVLM
E1V8E9_HALED          LAPGES--------------------------------------LITADGLWVGDGWARH
D3SAL9_THISK          LAPDES--------------------------------------VMTPDGTWMGPGWVAH
SMC_METCA             LQPHES--------------------------------------VVTPGGFRIGKGWVLA
SMC_COXBU             LQENES--------------------------------------VITKEGLWLGPHWARI
Q5WTI1_LEGPL          LLAHES--------------------------------------IVTVNGIWLGKGWIKL
Q12L80_SHEDO          LKPQQC--------------------------------------FVSRDGYLLGHGFLLQ
Q080K7_SHEFN          LLPEQY--------------------------------------IATQEGYLIGNGFVLN
A4Y804_SHEPC          LKDDER--------------------------------------IVTADGYLLGRGFLIA
D4ZIY3_SHEVD          ISEHER--------------------------------------IVTADGYLLGKGFVIK
B0TKB4_SHEHH          LKQEQL--------------------------------------IATADGYLVGIDFIIE
A3QFJ7_SHELP          IEDDER--------------------------------------IVTADGYIVGNGFVLQ
A1S5R5_SHEAM          TAQSTL--------------------------------------IATKDGYLVGHGLVLQ
Q5QUJ9_IDILO          SNASFA--------------------------------------VSKTGNWYWQDGFIAA
E1SMV2_FERBD          AGPEVS--------------------------------------VVLADGRWLARGFEAA
F2GBA5_ALTMD          QGRDNSRING-------------------------------CASVISPTGLWASSQWVVR
Q15UZ3_PSEA6          LTRGQS--------------------------------------IVSADGLWLGKDWALD
Q3IKC0_PSET1          NFYIAV---------------------------------------MDETAALHGRNWHIS
A4SKA4_AERS4          LLAGES--------------------------------------VLTPTGDWFGPNWADL
D0KWM8_HALNC          LPSGHC--------------------------------------FVLADGWQVGRHWIGR
A0A2W1K6W8_ACIFR      LRAGEA--------------------------------------WITPQGVLVHRSGVAY
A0A0J1A050_ACIBA      LQYGQS--------------------------------------ILTLDGYHVGQDWVIA
B3E294_GEOLS          ------RRYP-------------------------------EQTFVTREGDVVAPD-GTV
A1AU91_PELPD          ------RRFP-------------------------------ALSFVTRDGDMVSLG-GVV
B9M6F0_GEODF          ------KQSP-------------------------------HLMFVTSQGDMVHSG-SIV
Q39WG2_GEOMG          ------RLHP-------------------------------HSTFVTLRGDVAFGG-GIV
B5EFS9_GEOBB          ------ASFP-------------------------------HATFVTVDGDLVHGG-GIL
Q3A212_PELCD          ------LPV--------------------------------GLTLATAAGDCLNHR-GIL
A9FIZ2_SORC5          ------EGA--------------------------------GCTLVTLDGTVLRED-GVV
D0LY52_HALO1          ------SGQ--------------------------------SVTMVTLEGDIVDER-GVV
Q1D2R5_MYXXD          ------SGGP-------------------------------ACTLVTVEGEVFRPD-GTI
B4UDF6_ANASK          ------QSAV-------------------------------KRTLVTLDGEVLDPY-GVV
Q6MNS9_BDEBA          ------PRYE-------------------------------GWTFVTLDGDTLTAD-GVL
A9A0M3_DESOH          -----SNGSG-------------------------------RRPVVTLDGD-LITDRGIL
B8FHS3_DESAL          -----KNGYN-------------------------------DLTVVTKDGVVLVSPRGIV
E1QL74_DESB2          -----PGLLP-------------------------------GQAVVAAGGLRLDGPALLT
B3EFQ6_CHLL2          D--------------------------------------PDAVFVTPEGEKFSGRGLLYG
A1BDT4_CHLPD          H--------------------------------------PQASFVTPEGEKFSGKGVLFG
A4SG64_CHLPM          H--------------------------------------PDLSMVTREGEKFTAKGLLLA
SMC_CHLTE             H--------------------------------------PEALFITEKGEKFTRRGMLYG
Q3ATI3_CHLCH          Y--------------------------------------PAYRFVTLAGELSLGGGLLRG
B4S519_PROA2          H--------------------------------------PSCTFVTPEGERIDPKGIIHG
B3EM83_CHLPB          N--------------------------------------PGYTFVTPDGEKIGGNGVVFG
B3QRZ4_CHLT3          L--------------------------------------PNASFTTLSGERYRSAGFLRG
D0MFL5_RHOM4          T-------------------------------------SAPTRFFTPQGEWIDSRNWWHG
Q2S457_SALRD          TQDA----------------------------------ARSVRVFARTGEWVDSTGVLRG
C7PLU2_CHIPD          D--------------------------------------QDVLVIEKSGRMNRGRYSFSG
E4TVF1_MARTH          D--------------------------------------KDSVFITQSGKVTKRKFSMSG
B2KBE7_ELUMP          A----------------------------------------------------QNIKVPE
B1H0P2_ENDTX          G----------------------------------------------------GKISFEK
E4TEW8_CALNY          --------------------------------------------------------SGSL
D3PDY1_DEFDS          --------------------------------------------------------FSKK
D4H2V6_DENA2          --------------------------------------------------------PGAD
D6YSC9_WADCW          LDLLSNPREYCQTDKVRGGESEGGRADCLDSPRGCEKCELEVWTEDGAYIDRHRVVFFPS
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          -------------------------------------------------YFAEDLAGFID
B1ZZB8_OPITP          -------------------------------------------------YVADDLGAFLN
SMC_DESHY             SGYRAR---------------------------------------IVTLEGDQVHPGGSL
A4J682_DESRM          MQQRLR---------------------------------------IVTLTGELFNPGGSL
Q67PF3_SYMTH          TGQRFR---------------------------------------IVTLDGEVLAAGGAI
B0TGW8_HELMI          TRYQWR---------------------------------------IVTLEGDLLQPGGSV
Q2RJX0_MOOTA          LRPPVR---------------------------------------LVTLEGEVIQPRGPV
SMC_BACSU             LGHRYR---------------------------------------IVTLEGDVVNPGGSM
C5D8T7_GEOSW          LHYRYR---------------------------------------LVTLDGDVVSPGGAM
D5DQR5_BACMQ          VQHRYR---------------------------------------FVTVKGDVVNPGGSM
B7IUK7_BACC2          LQYRYR---------------------------------------IVTIEGDVVNPGGSM
Q9KA07_BACHD          LQHRYR---------------------------------------IVTLEGDVVNPGGSM
Q5WFM8_BACSK          SGHRYR---------------------------------------VVTLEGDIVNPGGSM
Q7ZAM6_OCEIH          VQRRYR---------------------------------------IVTLEGDVVNPGGSM
D6XTT7_BACIE          LKHRYR---------------------------------------IVTLDGDVVSPGGAM
Q81ZN4_ENTFL          VNYQYR---------------------------------------VVSLEGDVMNPGGSM
A0A0E0UX46_LISMM      VNFRYR---------------------------------------IVTLEGDVVNAGGSM
B1HQH6_LYSSC          CGFRYR---------------------------------------VVTLDGDIVNAGGSL
C6D303_PAESJ          CQYRYR---------------------------------------VVTLEGDVVNAGGSM
C0ZFN9_BREBN          LGYRYR---------------------------------------VVTLEGDIVNAGGSM
C8WWA4_ALIAD          LNHRFR---------------------------------------VVTLEGDVIAPGGLM
D5WPA2_KYRT2          VRRRYR---------------------------------------VVTLEGDVVHPGGTM
C4L5Z7_EXISA          TGYRFR---------------------------------------VVTLEGDIVNVGGSM
B1YIN0_EXIS2          TGHRYR---------------------------------------IVTLEGDVVNVGGSM
D3R1B0_MAGIU          CRHRVR---------------------------------------IVTLEGELFSPGGSL
D2RLB2_ACIFV          ADMRVR---------------------------------------IVTLEGDVVYAGGSL
D1BLY1_VEIPT          YNQQLR---------------------------------------IVTLTGEQFQPGGSL
A5UQ60_ROSS1          IGGGWT---------------------------------------IVTLAGEQVSAGGAV
B8G556_CHLAD          LPPGWT---------------------------------------IVTLAGEQVQSGGAV
A9B100_HERA2          LDGAWT---------------------------------------IVTLGGEQVGSSGAM
D1C6T1_SPHTD          LPPGWS---------------------------------------VVTLGGEITRSSGAV
D7CMX2_SYNLT          SGLPVK---------------------------------------LVTLEGEVLTYTGAI
Q0AYV7_SYNWW          SSLPCR---------------------------------------IVSLDGELINVSGAI
SMC_LACPL             LVDCE---------------------------------------SRLTAIKRYLLGTTAI
Q03RT7_LACBA          LLTIN---------------------------------------DQAQVILQYLLGTTIF
B2GD41_LACF3          LIAYD---------------------------------------ARFQVVVDQLLASTVV
A5VKP1_LACRD          LIKFD---------------------------------------QKFQLIADHLLGTTVI
Q03FW9_PEDPA          LVKVK---------------------------------------DDNQVISQYLLGTTLI
A0A249N2C3_LACRH      LAQYP---------------------------------------ADLKAVMANLLGSVLI
Q38XR7_LACSS          LIQFD---------------------------------------DAVSPVMMHLMGNLII
Q1WU99_LACS1          LVKVS---------------------------------------KENLKVSQNLLGTTVI
Q04GL1_OENOB          LIRSE---------------------------------------KKYSNIIENLLGTTLI
Q03VW6_LEUMM          LIDMP---------------------------------------EEMSAIKANILGTTVL
A0A0U5K8Z4_LACDE      LVEAKGD-------------------------------------TDISEAIQYLLGSIII
E4SKB3_LACAR          LVESKTE-------------------------------------HNINAAINYLLGSVII
Q74IP9_LACJO          LVTSKTA-------------------------------------TDISNAISYLLGNVLV
A0A0T8KIP4_STREE      LVTFD---------------------------------------TRLEAIFKNLLATTAI
A4VVL7_STRSY          LVTYQ---------------------------------------PNLDAIFQNLLGTIAI
C0MCR5_STRS7          LVTYE---------------------------------------PSLVAIVQSLLGVTAI
A2RLZ7_LACLM          LVSFE---------------------------------------SRLHKAMSSLLGTTVI
B9EBB4_MACCJ          LITAD---------------------------------------NKYKNIIDNIAGHIII
SMC_MYCHR             LIEFD---------------------------------------TQFNKLFGFLLGNILV
E0TKT8_MYCHH          LIEFD---------------------------------------TQFNKLFGFLLGNILV
Q4A770_MYCH7          LVDFE---------------------------------------KKYKILADFLLGGIIV
C5J708_MYCCR          LISSE---------------------------------------PKYTNLVDFLLATIIV
A5IYM7_MYCAP          LVEVE---------------------------------------PIYLILSQFLLGNVIV
D5E4P4_MYCCM          LVDIE---------------------------------------PKFEILNKFLLGNIIV
Q6KHN4_MYCMO          LVKID---------------------------------------PKYDILKNFLLGNIIV
Q98PK8_MYCPU          LVKYE---------------------------------------PKFEVLSKFLLGNILV
D1J8Q8_MYCHP          LVSTE---------------------------------------EQYNVLKKFLLGNVLV
Q4A588_MYCS5          AVECH---------------------------------------PQLEVLRDFLLGNVIL
SMC_MYCGE             HVKCD---------------------------------------PLFQPVVNTLLAQVII
SMC_MYCPN             HVSCD---------------------------------------ESLQPIVNALLGQVII
Q7NBU0_MYCGA          LVNYH---------------------------------------DQYDPAIRALLGQIII
Q8EVS6_MYCPE          LIKCD---------------------------------------KKIKPVFDVLLNKVII
Q9PR04_UREPA          LVKIN---------------------------------------VNYKISIDYLLGNTII
Q6F1N4_MESFL          LVEIE---------------------------------------KDCQVVLDYIYGTTIV
Q6MTD2_MYCMS          LVEYS---------------------------------------ETISKAVEYALASIIV
E3GP81_9FIRM          LVEYG---------------------------------------PRFKRVIESLLGRIVV
SMC_HALOH             RKRGFKIVTL-------------------------------------EGDVINSGGAITG
E4RL35_HALHG          IKRSFRVVTQ-------------------------------------KGDVVYPGGAISG
D9QRN7_ACEAZ          TGQRVKVVTL-------------------------------------EGEVVNPGGSMTG
A8MHB7_ALKOO          LNHKFKIVTL-------------------------------------DGDVLNIGGSLTG
A6TRT3_ALKMQ          LNHRLRVVTI-------------------------------------EGDVLNIGGSLTG
A3DDY2_HUNT2          FGYGFRIVSL-------------------------------------DGDILSTTGSISG
D5X8N2_THEPJ          NEFGFKVVTL-------------------------------------DGDVVNPGGSLTG
D9R048_CLOSW          FQYSFRIVTL-------------------------------------EGELLSVGGSMTG
C4Z0E6_EUBE2          YKYSLRIVTL-------------------------------------EGEQLNPGGSMTG
C4Z924_AGARV          NHYSLHIVTV-------------------------------------EGEYLAPGGSMSG
E0RV40_BUTPB          FNYTIRMVTL-------------------------------------EGELLVPGGAISG
A9KLR0_LACP7          YKYSLRIVTL-------------------------------------EGEQLNPGGSLSG
D9S347_THEOJ          TDFSIKVVTL-------------------------------------EGEIINPGGPITG
B2A2N3_NATTJ          LKFSLKLVTL-------------------------------------DGELILPGGAMVG
A8F8R1_PSELT          YRVRCR---------------------------------------IATLKGEIIGQHGSI
A5IN04_THEP1          YQLNTR---------------------------------------IATLDGELISGRGAI
C5CIS4_KOSOT          LGFQGR---------------------------------------IVSLDGQLLSAGGAI
A7HMD4_FERNB          YNIRSR---------------------------------------IVTLDGELISGRGAM
B7IHN5_THEAB          YNLR-----------------------------------------IATLDGEIISSSGAM
SMC_THEEB             ------------------------------------------------QYRMVTLEGELL
Q2JHS4_SYNJB          ------------------------------------------------KHRMVTLEGELL
SMC_SYNP6             ------------------------------------------------QYRIVTLDGELL
B0C9C4_ACAM1          ------------------------------------------------KYRMVTLDGELL
Q115J3_TRIEI          ------------------------------------------------KYRIVTLDGEIL
B2J925_NOSP7          ------------------------------------------------LYRIVTLDGELL
E0UKI1_GLOV7          ------------------------------------------------KYRIVTLEGDLL
B7K4Q6_RIPO1          ------------------------------------------------QQRIVTLEGDIL
B0JSN6_MICAN          ------------------------------------------------QYRIVTLDGELL
SMC_SYNY3             ------------------------------------------------KHRIVTLEGDLL
Q84EC7_SYNP2          ------------------------------------------------QTRIVTLDGELL
D3EQ04_ATETH          ------------------------------------------------KQRIVTLDGDLL
SMC_GLOVI             ------------------------------------------------RYRMVTMAGELL
A5GQT1_SYNR3          ------------------------------------------------RSRIVTLEGELL
A9B9B9_PROM4          ------------------------------------------------RYRSVTLGGELL
A2BNJ6_PROMS          ------------------------------------------------KNRLVTLSGELL
Q46EX0_METBF          ------------------------------------------------KARMVTLEGELL
D7EAF5_METEZ          ------------------------------------------------GLRIVTLDGELV
D1YW78_METPS          ------------------------------------------------TGRMVTLDGDLV
A0B8B9_METTP          ------------------------------------------------RYRMVTLDGDLI
D4GT30_HALVD          ------------------------------------------------DYRMVTLDGDLV
A7IAD8_METB6          ------------------------------------------------KYRMVTLEGELL
A3CWK7_METMJ          ------------------------------------------------RYKMVTLEGDFV
B8GG37_METPE          ------------------------------------------------KHRMVTLEGELV
E1RII6_METP4          ------------------------------------------------RYRMVTLDGDLV
Q2FLH3_METHJ          ------------------------------------------------SSRMVTLDGSLL
A2SS75_METLZ          ------------------------------------------------RYRMVTLEGELL
D3RYW2_FERPA          ------------------------------------------------GRRIVTLDGDLI
O28714_ARCFU          ------------------------------------------------GFRFVTLDGDIV
D2RFP2_ARCPA          ------------------------------------------------KFRVVTLDGDLI
SMC_THEAC             ------------------------------------------------IFRLVTLDGDIF
Q97AI9_THEVO          ------------------------------------------------SIRLVSLDGDVF
SMC_METVO             Y-----------------------------------------------KARFVTLEGEVI
A6UQ42_METVS          H-----------------------------------------------KARFVTLEGEVI
A6UVP1_META3          H-----------------------------------------------KVRFVSLDGDVV
SMC_METJA             YR----------------------------------------------KVRFVTLDGDVI
C9RFQ3_METVM          YR----------------------------------------------KVRFVTLDGDVI
D5VT24_METIM          Y-----------------------------------------------KARFVTLDGDVI
D3SQ87_THEAH          IG----------------------------------------------LYRMVTLEGELF
D3DG53_HYDTT          IG----------------------------------------------TYRMVTLEGEVF
SMC_AQUAE             IG----------------------------------------------NYRMVTLEGELF
B4U7R1_HYDS0          ------------------------------------------------NYRCVTLEGEVF
C0QSN8_PERMH          IG----------------------------------------------TFRMVTVDGDIF
B2V736_SULSY          IG----------------------------------------------NYRMVTLDGEVF
SMC_PYRFU             IG----------------------------------------------KVRMVTIEGELY
C5A612_THEGJ          IG----------------------------------------------KVRMVTLGGELL
D1CC09_THET1          SRG----------------------------------------ISSIVTLEGEVVRQGGA
D3TAQ9_ACIB4          VRL-----------------------------------------------VTLDGQLIEA
SMC_HALMS             DSIRFKAI------------------------------------SSTDGKLLVKNPGNGK
Q6L0R1_PICTO          V-------------------------------------------------RIVTLSGEIF
C1A7M6_GEMAT          VDS---------------------------------------------GEAFVDEHGAVF
C9RN51_FIBSS          YRG-------------------------------------------ENLNFVTADTIVRT
D1B5Z0_THEAS          HLM----------------------------------------------GDLLVVRDYDS
                                                                                  

SMC_FUSNN             TGGENQKSTINQIFERKKEIKTLEEKVTDLKSKITEGSKKREDLSIKLE-----------
E3H7H1_ILYPC          TGGENLRSASSQIFERKKEIKKLAEVVKKLNLEYKKQEKEYNKLTSLME-----------
D1AK68_SEBTE          SGGFKTK-GKDELFERKKELGEINSSLESLIKETELCTAEIEKAEILEK-----------
SMC_CLOK1             TGGSLQK-RSSNIIGRKREIEETLVKIENTKETLQVLNGDIRRIKSDKE-----------
D8GS00_CLOLD          TGGSFQK-KSSNIIGRKREIEESAIKINKTSESLKDLNGKVQEYKKCIK-----------
Q97IA1_CLOAB          TGGSTYS-KAASIIGRKREIEELNLELNNVSQALEQSSNKIIENKKVVK-----------
A0Q0Y7_CLONN          TGGSLYN-KGSNIIGRKREIEELKEKINKYSKDISVINDNINNLKSKIK-----------
Q895M7_CLOTE          TGGSVYQGKNSNVIGRKREIKELQREIKEIENKIKLETDVIEKDKNKLS-----------
Q0SSA4_CLOPS          TGGSLYQ-KNTGIMSRKNEVKALEDELVRVKNEEHILTKELEKLNRNQE-----------
A6LSM4_CLOB8          TGGSIKG-KNSNVLGRKREIEELVLDISNKKEKYEELKILVQDIKKEIQ-----------
D9SLC7_CLOC7          SGGSLYS-KSLNIIGRKREIEDISDKLKEISDKLEDKKIKIENLRKEIA-----------
D7APA8_THEM3          TGGSLKP-KLQSIFKRKEEITKLKKEIDSLKNQQEIVEEEIRQKMNDKI-----------
Q8R9W7_CALS4          TGGSLKS-TNTSILSRRNEIKRLRKDIEELLDSERDIKAEVEVVASEKE-----------
D9TN88_THETC          TGGSINH-KSQNILKRKEDIKYASIRCDKLEKDLKEFEKSKEGLMRKTE-----------
C9YKI7_CLODR          TGGSLKT--NGNILSRKRYINEYTEKISNIKNEISHLELKRESLDKDVK-----------
E3PS49_ACESD          TGGSIFT--SNSIFTRRKQISELEEMLKGLELKKYDIELEIKELLVVNE-----------
B0S1M4_FINM2          VGGYKKP---------------SNYSILSTKNSLNTAKSIYENCVNEYN-----------
Q3AC59_CARHZ          IGGSFNQ--TVSVLQRKNEIKLLQKQVDELLQKNNEVEEALSAFLKKQE-----------
E4SF58_CALK2          VGGEKKA--DFSLLERKVEKEELELDVKNLSSKLEEMDRLIIENSKVLY-----------
SMC_RHOBA             SSVVGPPGGETGLVSRRSELAAAKSEMQHYSYQIAEAEKEVGRLTGVVD-----------
D2QWB0_PIRSD          SIATGPRSASLNLVSRKSQLRELKTELAAAENDLASAELAQQQLADAII-----------
D5SU17_PLAL2          AIALGTLRTDTAVIPRKSELRQLRIDIARLEREIERQEQSVNITYTQLS-----------
SMC_KORVE             VTVTGGKQRSQGPLSLKRELRDVMRCIDDVERSLRDGEARVLMLGKEIA-----------
C1F1T5_ACIC5          LTVTGGRSRSGGPLALKRDLREVSEKLAAVEKDLGQAEVTAAELSKLLG-----------
Q01Y77_SOLUE          HTVTGGKKSGAGPLAMKREARELAVQLKSRQGTLDEMLARIDGLNQEII-----------
SMC_MYCPA             WVS-GGSDRKLSTLEVTSEIDKAGAELAAAEAQVAQLSAALSGALAEQ------------
SMC_MYCTU             WVS-GGSDRKLSTLEVTSEIDKARSELAAAEALAAQLNAALAGALTEQ------------
SMC_MYCLE             WVS-GGSGRRLSTLEVTSEIDKAGAELAAAEAHMAQLNAALSGALSEQ------------
A4FMG9_SACEN          WAT-GGSADSQSVIEVQAAVDEAERELAAAERRLEQHAAALEGARAEE------------
C8XH72_NAKMY          WAS-GGSAGGQTLLEIQATRDQAADELTAAQARIEELTAALAQAKARV------------
D7GEI0_PROFC          FMA-GGSGSGRSRIELQAAISSTREELSTARHEAERAHFSRQQAGEAV------------
Q2J6Z3_FRACC          LSI-GGSANPPSAIELQAAADEAEAGVAEATRRVESAHEAFEPARAEV------------
A8L599_FRASN          SAV-GGSATPPSVLEIQTAADEADRGATEASARREAAREEMGPARAEV------------
C9Z3S1_STRSW          FAH-GGSAGAPSLLEVQAAVDEAAAELEELAVRCEELAEVQRGAVEAR------------
D7CC86_STRBB          FAQ-GGSAGAPSLLEVQASVDEAAAELKELAVRCEELTDGQRAAAERR------------
B1VYX5_STRGG          FAH-GGSAGAPSLLEVQASVDEAAAELAELAVRCEELAEAQRLAGERR------------
E4NHH3_KITSK          LAQ-GGSPGAPSPLETRAAVAEAARGIEELAARCERLAAELAAARELR------------
C7QGY1_CATAD          SAR-GGSSSAPTLLEVQAAVDEAAEKLYEAGARAERLRTELEFATAER------------
A0LV82_ACIC1          EAA-GGSATAPSLLEVQAALDDARRQLDEVVARQHQLRFEIAAAEQAR------------
A0JXV4_ARTS2          TVR-GGSASAPSLLEVQAAVDDAETRLAKVSADLERNRFALAAAQARR------------
A1R7H8_PAEAT          TIT-GGSATAPTLLEVQAAVDDAVARLQEVTARLERGRFALAGAQSRR------------
A6W7T9_KINRD          LAA-GGSRSAPSLLQVQAAVDEATDALSAAGHRAQRAQFALQQAQAER------------
D1BJA3_SANKS          RAW-GGSAAAPSVLHLQAALDEARAAAADAQRRGADADRRRETVERAV------------
C7NGM6_KYTSD          RVT-GGSSTGPSSVEVAADHDRAVAELEQAQQEVAAAESARDAAQERL------------
B2GFM7_KOCRD          RVQ-GGATEAAGNLEIMALLDQAEAETAALETAAQGAAEAARSAEQES------------
E1VVN2_GLUAR          RSA-VGDSASASLIAQQALVEQTTAELQSCREELGAIESQLAQRGPQL------------
A5CQQ2_CLAM3          VLR-GGSGATRSKLELVAAREAAATTLTDVRARIDDLQVDLAAGRERL------------
Q6AE90_LEIXX          LLR-GGSGAKQSRIELLADRDAAEERLAEVASLSDRARFALAEQRGVL------------
D1AB24_THECD          WAQSGGTGGAQNLLQTRTALDEATGALEKAQSRAAETAAALQAAQEAE------------
D6Y659_THEBD          AAQ-GGPGGRTSVLQMRRALDEAAAGLAAAQAEAERNARALAEALAAEEECRNAVAEAEE
D7BMZ9_ARCHD          SAR-GGEAEHSALLAKQALYDDATRQAATAEENETRAQEHVARAIAAQ------------
D6ZIF1_MOBCV          RIV-GGGDPEAGILRRATEYDEAVSQSEAAAAAADQADSELAQAKTEL------------
C7R311_JONDD          HIN--TRRQGSAHALVKEERDRHHHDVATWNARCEELTREHNAAVQRH------------
D6ZV06_BIFLJ          VAAVGGSSISQSDLSLAARRDKALAQVKQLAAQDGGMAEQVAEAKAKR------------
Q7ZAJ9_COREF          WIQ-LGT--GTSTVEITAQIDDARRQLAEVSRALGDLAGTVEGARVAA------------
Q8NNW5_CORGL          WIQ-VGT--ETSTVEITAQIEEAEAQLAAASAALDDIAGTFDGALHAA------------
Q84F13_CORDP          WVA-VGSA-ERSAVEIAAEIDQAEKDLEVARLQRVELAGTLNGAHQAA------------
Q4JUZ1_CORJK          WVA-SGSG-GTTPVELADRIAAETEGVTKKKKELGDLQAALSGALDAA------------
C4LJD3_CORK4          WMS-GGSG-EATTLDIKSSVDQAQEELADYTAKARELAGTIAGAETTV------------
D6Z8M0_SEGRD          WTL-AGVGRSTGVLDVRAQIVRARDELADAERQLGEAQQAAEHLRAEL------------
C8WGU5_EGGLE          GAAAVD--DEEGVLARARRLEELRAQLRAAESERASAEERAAAAEEALR-----------
C7MMZ7_CRYCD          LRADAEGSSARDALSVHGRLEEARKAADSAEKALAAAQQRVVAAEDNLR-----------
C7N560_SLAHD          LGRVEE---GEGMLAYERRIAELEGKVGGLEAAVASAEAALTAADEDLE-----------
E1QVK5_OLSUV          GLSSAA---EQGALERKRRIRALRDGMAALEEELAQASSAIAVAEEELS-----------
C8W740_ATOPD          GHASRA---EDGSLERKRRIRELEIALPALKRHLEAARSAVTNCENELA-----------
SMC_RHOPA             ASA-HAPTGAARRLAERARLTDIENELEQARIEATAKRQALETA----------------
A7IGT2_XANP2          AAA-DAPTAAARRLAERNRLKDIEAEVAVAEAHLEEIRAALADR----------------
B8EMM7_METSB          QAA-EAPTPAARRLVEKNRLGDLVIEADAAREFADALKAEAESC----------------
B8IQU0_METNO          AAA-EAPSPAARRLAERNRLEELRAEAALAREAAEAARGSFEGL----------------
Q92RE8_RHIME          TGS-EAPSAAGLRLAQKNRLSELEGEAEEASDASLKAEAHLAAA----------------
A7HQY9_PARL1          AAA-DAPTASARRLEQRNRLIDLEGELAAARATAAEARAAFDAA----------------
D8JUP9_HYPDA          AAA-GGVTPAAQRLAHKNRLLELDRKAQAVLNEAKDTIEAERAA----------------
E3I0B2_RHOVT          SAA-NAPSAAARRLAERNRLAGLEEQLDEVREAADRAEAERLAA----------------
SMC_RHOS1             AGAEDAPSAAALRLKQLNRLVALKRDLEEVAARAEGARQAHEAL----------------
Q2W040_MAGSA          AGA---PSPMALRLAQRNRLRELEASLDDASMGVEEAEEKVETA----------------
D3P3X3_AZOS1          AGA---PTAAAIRLKQRNRLAELRGELELAEEQVDLAREALDAA----------------
B6IR58_RHOCS          AGA---ETAAAQRLRQRNRLAELELELEAADERLDAAREALAEAEETAERALA-------
Q2RPA2_RHORT          PGSRDGAALSAARLETRNRLGALATEREDAEAALAEARDAHGAA----------------
SMC_CAUVN             ADA---PRPAAVRLEQRTRLAEVEAEIDVMAPRAEATTIALKAA----------------
B0T003_CAUSK          ADA---PKPAAVRLEQRTRLAEVETEIDQVTPRAEAATAALKAA----------------
Q0AMJ6_MARMM          ADA---PSAAVARLEQKNRLDAIRVELDDTLTDHDTAREAETDA----------------
E0TC69_PARBH          AGA---KTAEALWLERKRELAEKETALAAAFTARDDAESAFADA----------------
C6XRC2_HIRBI          AKA---PSSASEKLEQRALILDLEKQLSKANKAADKLRTAQQNA----------------
Q0C0X5_HYPNA          PQA---PVSAAARLEQQARLETARADLAPLQADLIARTEALEAA----------------
Q1GQU3_SPHAL          GDG----ATATERLQRRNRLDELAAQRPAVELGVQELRDRREAA----------------
D4YX43_SPHJU          EGG----AAAAERLIRLNRLEAIAAARPAAEAEVETARAAQDAA----------------
Q2G9S3_NOVAD          GEG----AAEAAALEAENRLAELQALLPARREALAAAEAGFEDV----------------
D5BSU5_PUNMI          ANQ---NDRSAERIRQRRRLETLQTDAIKLGKDAEAMAEKTASA----------------
A5FVJ2_ACICJ          PGA---PTEAAVRLAQRNRLDQLDVEFARARQSAEATRAALQEA----------------
C5B6I7_METEA          LGD----DASARRLSLEARRRVLEVDLQAASRASASAAQGLEGV----------------
Q937L3_DEIRD          ARA---HSSRPRLVTLAGELVEPGGAITGGRLRDSGSAVLADQR----------------
Q1J060_DEIGD          AHA---HPNRPRLVTLDGELLEPGGAITGGRLRDAGFSVLADQR----------------
L0A7J5_DEIPD          ARI---HAQRPRLVTLDGEVLEPGGALTGGRLRDSGTSHLADQR----------------
D7BH70_MEISD          AKR---YPDAPRMVTREGELLEPSGALTGGKLPKGG-QMLALRR----------------
SMC_THASP             HAPDART---HGVIERQREIEGLSAELQAHEDEAHLAHDALVVAESAAS-----------
A1K715_AZOSB          FVPDSRT---HGVMERQREIDTLASEQQALEEEAHLAHDALLAAEASAT-----------
C7RKG8_ACCPU          FAPDSGE---HGLLERQREIDTLTGVIAQREETVDQAQARLAAIEQSLA-----------
Q3SJI0_THIDA          HGPHTAV---EGILARGRELERLGQDSARLHEEVAGLEAAYAETQQAYA-----------
SMC_DELAS             YAQDSEQ---SGLLARAQEIEHLEKEVRAQALISDESRTALVRAESAYA-----------
D6CTE6_THIA3          YAPDSEQ---SGVLARQQEIDNLERQIKAEQLIAEQSRAQLHQAEHDLG-----------
SMC_BORPD             YAPDSEQ---AGLLARQQEIENLQREIKAQQLIADQARAAVARAESAWQ-----------
SMC_BURP1             YAADSEQ---AGMLARAQEIENLTRQVRAQALLSDEAKAAAIRAEAAHT-----------
A4SYV7_POLAQ          YAADSEQ---AGMLARAQEMESLEKQLRAQQLMQSELKGDLDQCVANYQ-----------
D5CRW3_SIDLE          HAPDSQL---HGVLARQREIEQLQQEVQQRSDALEQGKQQSALAEEAYH-----------
D9SGR3_GALCS          HAPDPHL---HGMLSRQREIDMLERSAMIDDEMVAQLKAACSEAEQRYR-----------
Q2YBB9_NITMU          YSPDSQL---HGVLARQREIGQIEVEMEALRAKLDIEQSALDTAGDTCY-----------
Q0AE88_NITEC          FAPDSAV---HGILQRQREIAQISEECEQIEHSVLSKQQTLAEVEQNYQ-----------
D7DI79_METV0          FGAQSIL---HGVLERQAQLDALVKKLPDLQKSLVVATNKVTELEQQLQ-----------
C1D4R7_LARHH          FAPSAE----GSPLARQAELDALRVRIGEVQPALWEAEARLTQLDSERQ-----------
Q7NR76_CHRVO          HAEASG----DGLMARKRQLDEASARADVLRPEIDAMQKKRDSLQSIGN-----------
A1KSF4_NEIMF          YAKPAQ----ESLIAQKARLDGIASELENLAPELSAAEAAFKQAEAAVR-----------
A1WY82_HALHL          PGQEDAE---SGVLEREQEIQTLREEVEAAEARVQEAEGRLADARGGAA-----------
Q0AAV4_ALKEH          RAGDDAE---RGVIAREREIHQLRDRVAEGEARLVEREEAQDRLRQAVR-----------
SMC_XANOR             SRSGAAK---QGALLRERQIQELRTQIETLQEREAELEHQLASFREQLL-----------
B8GTL2_THISH          ARDADEH---AGVLAREQEIKALQAELAGLNTEQERLQQALEAERERVR-----------
Q3JAH9_NITOC          VREDDGK---LGALARGREIARLQEEMTHCEREVEALDKQLEEVRGRFY-----------
D3RSW0_ALLVD          P-ERDGA---SGVLERAETIAALESELAALADEEAERLDEELELRDART-----------
B3PGR0_CELJU          ARDSDAS---SGVIARRQELEELTAAIEDAEAAVADLSEQLEGARSTIK-----------
A6V7X5_PSEA7          RRSDEAQ---GGMLARAQELEALQEQRETLETRVAEGEERLAAARDEQR-----------
Q0VR03_ALCBS          AKEEDQE---AGILERRRELEALVGEIETLQATVDDLKEQLESTREQIS-----------
C7RBE2_KANKD          SKQSEQG---AGILEREAELNELAGKIEQQEALMEELEQTKERLAEQLS-----------
Q2SD45_HAHCH          PPAKQTG---DGLLARNRRLAEIEQEMEEVATQLASLSQDKETIDAALS-----------
E4PL89_MARAH          PDSDAGQ---VGVIERQKKVTELAAQLAEAEEALEAATERLEELQERAE-----------
E1V8E9_HALED          RGQEDGP---DALLVSRRREAEVREELATVEARLETLEAQLAEAGEEVE-----------
D3SAL9_THISK          RTLEGGA---SGAVARVRLARELREREQALQGQIEQHQATLAERSEAIE-----------
SMC_METCA             QKPDAGH---AGALARERELRECRRRVEELEAQCRILEREASEAEVELE-----------
SMC_COXBU             SKLQDAPQ--SGFLLREQQLKQLKANILGQQKKCDEQEALLKSGEQQLN-----------
Q5WTI1_LEGPL          PRQKEQDE--VGILARQQRIIELDLSVESLQQKIESIRLARDSYQARLQ-----------
Q12L80_SHEDO          A-QSQKQ----SNLLLTQELNQLSSQISRLASEVELSEQQVLDARNNLA-----------
Q080K7_SHEFN          H-TQAGQ----SAIVLSQERTSLSQQLIELEQQLLLSQQSLTSLTQRAA-----------
A4Y804_SHEPC          K-QDSAE----SLVQLSKEQAQLAQSIADLDIALGLQQIKLTELTEMLN-----------
D4ZIY3_SHEVD          K-GTDSG----SLVQLKREQEALDVSIDDSEALLSELNNQGHGLDANIT-----------
B0TKB4_SHEHH          K-TQAAG----SIVELKNEQIALQQSVTNSQANLARLTESLTEIKLMVV-----------
A3QFJ7_SHELP          K-AEQGR----QLVQLKAEQQALELSIAASVEAIDERRAVLAEVNQALD-----------
A1S5R5_SHEAM          Q-QGTGT----DKVALKAEAEALGARIGQIQAELAQYERAVAQQRDALN-----------
Q5QUJ9_IDILO          RVD-EDN----SVLHLQTQRQNLLEQLQVLASRLSESETQLEQTQTQVE-----------
E1SMV2_FERBD          PGQGSER----PLTEIQSELSEAEQRLLGLSDEQHQAEQAEQVAVTALN-----------
F2GBA5_ALTMD          P-GKAND----GALQRANKIQALSESILVSESVLDEVNMSLNAAQHALT-----------
Q15UZ3_PSEA6          GCSEDAG----GSIQRANAIAALESALPAIQQQCEEAQGTNEQAQENVE-----------
Q3IKC0_PSET1          SDRNAEN----SLLVKHKQLQLKTAQLKNVEGELQLAAQVLEQQKALQS-----------
A4SKA4_AERS4          G-QGGAL----GTLALLGERERLHTELAAGQQALGRLNEQLGTADATRA-----------
D0KWM8_HALNC          GGSDQAA----VRLAQQTRLAELQQAGTEAETTAEQAQIEYQRIQNQLA-----------
A0A2W1K6W8_ACIFR      PEHEDGA----SLLQCRRELAENWECFQRAQADAAAAHAALIAAEQQAR-----------
A0A0J1A050_ACIBA      LMYDDESQSAQGMLTHRIRLDEIEQVLQKQQPELQALDQIIVQQKDELG-----------
B3E294_GEOLS          SGGSVET-AQNGIIHKKREIRSLELPVENLLAELESCESERDRVRADLQ-----------
A1AU91_PELPD          TGGSSEQ-VQKGIIHKKREIRELEGRVSELGEQASVLEAERDQLRTLSR-----------
B9M6F0_GEODF          NGGSPEA-AYQGLIHKKREIKELSLEAELLTKQISELEERRTQLKEDVA-----------
Q39WG2_GEOMG          SGGSTEA-AGPGLVHKKREIRELTGEVERLTAVLDDLDATRGRTQQERA-----------
B5EFS9_GEOBB          NGGSAEP-AQQGIIHKKREIKGLGADVERLTGEVQQLATARETRRVEIA-----------
Q3A212_PELCD          CGGAREG-LGHSFLSQKREIKELKARQAVLDDDLARLRQQRVDQKAALG-----------
A9FIZ2_SORC5          SGGSGDA-VAAGMIEQKREMRALHEFVATKSEEVTALLDAQQKLRLRIT-----------
D0LY52_HALO1          LGGSREA-QGASVLAQKREIRELEELTARLEGELTEATARFVSTKAEHQ-----------
Q1D2R5_MYXXD          VGGESEG-AAVGALQKKREIAELATEVARVEERYNEILTRHYTLQKQMG-----------
B4UDF6_ANASK          TGGPLEG-EGHGALQRRREVQELEETVRGFEAEFSLAQERHRTLQARLL-----------
Q6MNS9_BDEBA          TGGSSES-ADSGMLKRRREIKELSEKKDEFAGKLQLAQMALKKTEEQLA-----------
A9A0M3_DESOH          VGGSKDQ-LSG-ILAKKQEIKDLESAMADMDRQIDQAKKEQAALEAVVR-----------
B8FHS3_DESAL          GGGQENS-GPG-ILAQRQQLTQLEETIASLEEELETAKESQETLEKETR-----------
E1QL74_DESB2          LAGDQGQ-SGGSVLGQRNELTKRRQQLEQSRLLLDDLSAQRQALQADMA-----------
B3EFQ6_CHLL2          GSSSNSEG---VRLGKKAERDLLLNRHTLLQSKITGTEVTLRQLQEELESVK--------
A1BDT4_CHLPD          GSSTINEG---LRLGKKAERDRLLQEQQALEKTVQEAERMLTELNREIEGQQ--------
A4SG64_CHLPM          GSPKSSEG---LRLGKKTELDSLEKKLKAMESTISGEEMRTAELEHTLRELK--------
SMC_CHLTE             GSAKGGES---VRLGKKAERDRLQKQMAGMAETIAEAENALAVLRKEFSAID--------
Q3ATI3_CHLCH          GSNKSNEG---LRLGKQAERAALLEEVAKEERSMQHLEQTMQQLRNELAMLP--------
B4S519_PROA2          GSSRESEG---LRLGKKMERDELLADKERCMQRIQDEEKTLQALNRSLQEIP--------
B3EM83_CHLPB          GSSAENEG---LRLGKKAERDQLRAEEHDLEKELGLEQSRLQSIRNKLQNIK--------
B3QRZ4_CHLT3          GSVKEDEG---LRIGKKEELELLSAEKSEIEADIKKTEAALLEAQTGLNRTS--------
D0MFL5_RHOM4          GSMQAPRSPLSGRLDRRERLNALQTEAASLETEIARLRDERATLEQQLQALP--------
Q2S457_SALRD          GSRQEDVSPAASRLGRREQLARAREQLGDLQAACEEQDEDVAEAEAALNEID--------
C7PLU2_CHIPD          GSVGLFEG---KKLGRAKNLEKLDEEIKALEEVVASLRHQIQEKHNQVLGYN--------
E4TVF1_MARTH          GSVGLFEG---KRIGRAKNLEKLQVEIKDLNKKISQIKESLESRQNDLDNLK--------
B2KBE7_ELUMP          AYWGEEE-------SVKDEINSVKEKAASITKQIEENAADINNAENNLKTLR--------
B1H0P2_ENDTX          PMLIEEQI-----KKLQKKSDEIRRSISSVQSEIEQIREYQINSRLEKERLG--------
E4TEW8_CALNY          DKAEYIIGMKKEIVDIKDDIKEISNNIEKFDSELNEIKKIKNEKIEYIKNIEN-------
D3PDY1_DEFDS          DYRVVLKELREKVESLEKEIAVLDKEITEIEVKNKKLKEEFIKTESEKDKLFN-------
D4H2V6_DENA2          DKRENVIRLKKQIEGYETELTKAQKDCEELEQSLPELTEKLELLADKKDELLE-------
D6YSC9_WADCW          EGEENAFVREAELKSLDQKLAECERKKVEFAESLHAFTEQHSMLIGRKQEADQ-------
Q04TU9_LEPBJ          ---------------------------VHLEDMIRNILFDRDGFLSRKEALDQ-------
E1R6H6_SEDSS          ------------------------------ESEKQKTLSLVRDA---FEATGL-------
Q73ML2_TREDE          ------------------------------NHSADDVKKFAEDSVQSFSSLLS-------
A0A0H3BKB7_TREPS      ------------------------------THTEGELCRMLTTVVDAFNEAVK-------
E0RSK7_SPITD          ------------------------------NPDP--------PFEEWLEEMAR-------
D5EMY0_CORAD          FWKSNLDFNFLLVATKQGEIIDCRGLIHGGTASGKKSS-SVLEREAEIRTLRS-------
B1ZZB8_OPITP          FWKANPAFAFLAVATRKGDLVDRRGFVYGGHHSTKRSANSIVQREIDLRETAR-------
SMC_DESHY             TGGSLQ-RKGSNLLGRSREIQELRQECDERRTQQKEMELKAGALGTQIQ-----------
A4J682_DESRM          SGGGTV-RNIGGMLHTRRERDELAKVVQDLHNQVHKLTGILGEQQQHQR-----------
Q67PF3_SYMTH          TGGDAV-GRGSGLLARERERDELRARVQELQAELEAVRRACEQAAARRT-----------
B0TGW8_HELMI          TGGSQG-QRGGQTFLRRRELALLAEEEQTLGLAISDLKQQREEAAEQIG-----------
Q2RJX0_MOOTA          TGGNTR-QRAG--FLQRR------LEIQQGETELANLVARLNDARQQAR-----------
SMC_BACSU             TGGAVK-KKNNSLLGRSRELEDVTKRLAEMEEKTALLEQEVKTLKHSIQ-----------
C5D8T7_GEOSW          TGGGIA-KKANSLLSRNRELETITAKLHEMEQKTEQLERFVQTKKKMIH-----------
D5DQR5_BACMQ          TGGSMK-QKSNSLLGRQREVEAITAKIEEMEQKTLVLEQDVKDKKSQIE-----------
B7IUK7_BACC2          TGGAVK-QAKSSLLGRQRELEEWTRKLTDMEEKTTKLENFVKAVKQEIQ-----------
Q9KA07_BACHD          TGGSVK-QKQTPLLGRQRELEELTDKLKQLEKAAAKLEQEVKQQKNERT-----------
Q5WFM8_BACSK          TGGSAK-QNQSSLLGRKREKEELDAKKTKLEEAIRDLEKQVKQDKERRQ-----------
Q7ZAM6_OCEIH          SGGAQK-KSNQSLFTREKDLQEISDRLEEFQHKALQFEHTVKKRKELIQ-----------
D6XTT7_BACIE          TGGSLQ-QKSGQILSRKSELKTLESEVSSLEANMQEQERFCNGLRTDLA-----------
Q81ZN4_ENTFL          TGGANKRGNQGSLFSQAQELQTITEQMTQLETQLRSVEQEVQALSQEVK-----------
A0A0E0UX46_LISMM      TGGATK-GGKSSILTRKHELGQLAEKIAELNEATREMESAVQLAKDSMA-----------
B1HQH6_LYSSC          TGGALK--QQSSLFTRKAELDGLVLKLESLQASIYGAEQAVAAEKEKLA-----------
C6D303_PAESJ          TGGSLQ-KKGASLLGRQRQIEALDQEIMEGEKTIAQLRDKLSDVRKEQS-----------
C0ZFN9_BREBN          TGGALK-KNSTNLLGRNRQSEELEAQLVEIDQAISGHTTLMEQLTKELA-----------
C8WWA4_ALIAD          TGGHVN-RKGPGLLGRQREREDLENKLKALEAERARLSARQKELRARVV-----------
D5WPA2_KYRT2          SGGAPI-KGSGSLLSRRRQVELMAQRVEEQRKRVEKGEETLRSLREQEA-----------
C4L5Z7_EXISA          TGGSRK--QGVALFTQSRELDDLKQGLTQGLAMLHEQQTRLQEYTEQLT-----------
B1YIN0_EXIS2          TGGSRK--KGTPLFSQSRELEELQAGLKQGQAVIREQERRRDEMKTAMQ-----------
D3R1B0_MAGIU          TGGSMQ-QKRPHLLGRTRELKDLQAELANYPHKKENLQKDLKEFKTEMI-----------
D2RLB2_ACIFV          SGGQKQ--QGKSFLSRKQEIRHLTEETQALEKAGETLRQELEDLAEKGR-----------
D1BLY1_VEIPT          TGGATKR-KRASVLSRKEEAASLEQELVQIEGQIRSLIANLESLEKRVE-----------
A5UQ60_ROSS1          TGGSAA-K-ESGTLRRERELRELPERLEAVSRETEAARVRHVVANEAYV-----------
B8G556_CHLAD          TGGAPT-R-ESGVLRRERELRELPALVAETRAQLAAIDEQRAVIEAELQ-----------
A9B100_HERA2          TGGART-R-EAGTLRRERELRELPAQLEAAQQQLAEHEQQLKQAIAAIG-----------
D1C6T1_SPHTD          TGGARV-K-ESGTLARERELRDLPVECRKLERELDAARAE-VEARAAEV-----------
D7CMX2_SYNLT          TGGTVS-NRSVQHFRRKNWAKQQALVLAEKQKECELLLAQLENLRSTAA-----------
Q0AYV7_SYNWW          TGGKKA-SPTQTPLQRRAEEKKLLLRQQENEQAREDNRREQKQVESRWQ-----------
SMC_LACPL             VDTLDHAMAISRSRRFRCKLVTIDGETIAASGAITGGATRHDDN-GLLQQQQSAEK----
Q03RT7_LACBA          AANLDTAVAISQRIHHRYRVVSLAGDVVSASGAITGGQSKQSHS-SVLRQQQELQQ----
B2GD41_LACF3          VDNLDHATEIARAGQHQVRVVTLDGQLINASGAMTGGANRNQRT-GLLRQRQQLAE----
A5VKP1_LACRD          ADNLDHATEIARAGRHMVRVVTLDGQLINASGAMTGGATRSQRT-GLLSQKQMAKQ----
Q03FW9_PEDPA          VDTLQNALIISKQISRHNRIITLAGDVIGIGGTMTGGATKGNRT-GVLQQDQELKK----
A0A249N2C3_LACRH      VDTLPHAIVIANSTHHRYRIVTTAGDILNPGGSLTGGQVKQGRQASPLARNQEARH----
Q38XR7_LACSS          ATELTEAIKIGRLTGHRYRIVTLAGDILSPGGSMTGGHNNRQNNGGLLARKQTLTD----
Q1WU99_LACS1          AKNIDFATEIAKKLNYGVRIVSLNGDVVNPGGAITGGAVKQKKS-GLLEQKLQIED----
Q04GL1_OENOB          AANLNAAFRISKLLNQRYRVVTIDGHIVNAGGSITGGAN-RHQ-SGLLSKRAELDQ----
Q03VW6_LEUMM          AENLNQATEIAKRGHFRFRVVSLSGQVVNAGGSMTGGAT-QKRGATLLSRQSDIAE----
A0A0U5K8Z4_LACDE      VDNMDTALAVSRQIGHY-RVVTLDGDVISPGGAMTGGARNQRNN-SPLQTTAEINK----
E4SKB3_LACAR          VDTIDTALSISKRINRY-RIVTLDGDVISPGGSMTGGQRNQRNN-SPLQTATEINQ----
Q74IP9_LACJO          VDNIDTALRVQRRIGRYYRIVTLDGDIISPGGSMTGGTRNTRNN-SPLATNAEIDK----
A0A0T8KIP4_STREE      FDTVEHAREAARQVRYQVRMVTLDGTELRTGGSYAGGANRQ-NNSIFIK--PELEQ----
A4VVL7_STRSY          FDSIDHANQAARATKFQVRMVTMDGAEIRPGGAFAGGSNRN-NSTTFIK--PELDA----
C0MCR5_STRS7          FDTIDHANQAAKQLHYKVRIVTLDGTELRPGGAFSGGANRH-NSTTFIK--PELDQ----
A2RLZ7_LACLM          VDSGENATAIARAMNYNVRIVTIDGTQINPGGSYAGGAGKR-NSTTFTS--AEISN----
B9EBB4_MACCJ          ATTLAEANKIAKFVSYRHKVVTLDGQVVNPGGSMTGGSRQKPTQALSSR--NELQQ----
SMC_MYCHR             VDNVDNANRIAKILDHKYTIVSLEGDLFRPGGTITGGSKLERTSILNYDIKIKEH-----
E0TKT8_MYCHH          VDNVDNANRIAKILDHKYTIVSLEGDLFRPGGTITGGSKLERTSILNYDIKIKEH-----
Q4A770_MYCH7          ADTIDSANQIANFLNHKNMIVTLDGDVIRTSGIISGGHKIKNDSSFSIQYKIDEL-----
C5J708_MYCCR          VDNIENANRIAKIIDFKYVIVTLEGDIVRPSGTITGGHRQKVESSTNIEFQIDEL-----
A5IYM7_MYCAP          TETIHHANHISKILDNRYMIVTLDGDIIRAGGVIVGGAKSNTETLLTIDLKISEL-----
D5E4P4_MYCCM          VEDIETANKVANILDKKYMVVTKDGDVVRVGGIIVGGSKERSQNLIGSDDQIREI-----
Q6KHN4_MYCMO          ATDINAANKMSKVLENSYMIVTLDGDIIRVGGILSGGEKENSNNLLGLDNQLEVL-----
Q98PK8_MYCPU          VSDIESAKDIAAILDNKYMIVTLEGDLIRTGGVITGGVQQASTNLIGLDEQIAKL-----
D1J8Q8_MYCHP          ADNIENANKLSKLLETRYMVVTLDGDIIRVGGVLSGGQASQNVSTLAADEQVKKL-----
Q4A588_MYCS5          ATDIDKANEISKLVEQKYMVVTKDGDLIRPGGIIVGGEKKQVSNLLNIDEKIRKS-----
SMC_MYCGE             AKDLNSAINLSNYTYKLYRIVTLDGETVYAGGIINGGFE-KTNLSDGYLSSASLD-----
SMC_MYCPN             ASDLQAALKLSSYTYKLYRVVTLNGETVYAGGIIQGGYV-KDNLSLYNLQEKLAS-----
Q7NBU0_MYCGA          ASDLEAATKISKFTYQLYRVISLGGDIVNAGGAITGGAESKQTHSLFNLDEKIDT-----
Q8EVS6_MYCPE          ANNFEQALEISKYTYQLYKIVTLDGQIINPHGVITGGYTKHLSDSLVSVDKKIKA-----
Q9PR04_UREPA          ANNLKNAIILSEYTYKNYKVVSLEGDIVFGGGAISGGSN-SKKNIILNLEEKIKE-----
Q6F1N4_MESFL          TRNFDDATRLGKSINFRYGIVSLDGQRVLPRGAMSGGSVNKASNIFAAKKVDESFD----
Q6MTD2_MYCMS          VQSYDDAINLAKNTNFRFNIVSLDGQRILPRGAIVGGSTRNANIFTKQNTQNQDNN----
E3GP81_9FIRM          AADFNAGRAIQKAIFGKYTVVTLEGEIFYPGGAIVGGYTKSGKQSPLFKKAEIEKL----
SMC_HALOH             GSKNSNKKMLLSRSRK---IEDLKKEVLKLQNSLGEDSKNLNQLENKLK-----------
E4RL35_HALHG          GSSSNNSRNLIGRSRK---IEELTEKKAELKSRGEKLVAELKTLQKEIK-----------
D9QRN7_ACEAZ          GSSQNKNADLLGRSRQ---IEELSDRIDGLNQKLETLKEEGISVKDRLV-----------
A8MHB7_ALKOO          GSVSGKTTSILGRKRE---LEDLIVEIDDFQHQWESKKQVYLNLEQEIQ-----------
A6TRT3_ALKMQ          GSNSNKGTSILSRKRE---LDDLNELIKKETEVYKQKESQLNSLEGHIQ-----------
A3DDY2_HUNT2          GSKEKRESGILSRNRE---ISELGESIARLKEDDEAIEKNVEGLIRELE-----------
D5X8N2_THEPJ          GSYNKSRSNLLGRKRE---IEELAGAIAVLQVQVKAVQDKEAALQKEKE-----------
D9R048_CLOSW          GAFKN-TSNLLGRKRE---MEELEGICTKALSDVERLEKELLINEGLLA-----------
C4Z0E6_EUBE2          GAFKN-SSNLLGRRRE---IEELKKSVSELSKSSTELKTKIADNRAKIA-----------
C4Z924_AGARV          GAFKN-SSNLLARNRE---IEELEKRVDQTKTKLKELRARKDDIATAIA-----------
E0RV40_BUTPB          GAFKN-NSNLLGRRRE---MDELESNVKKYKERIDELKKELEEDREKRN-----------
A9KLR0_LACP7          GAYKN-SSNLLSRRRE---IEELEENVLTLKNEVAKLNEDIISYKEQRF-----------
D9S347_THEOJ          GSFKK-SSLFLSRKRE---FREIKEKMGIVEEEISALKSRISSLEEAME-----------
B2A2N3_NATTJ          GSNKKSSSSLQQQLSNDDNKTKLQNQISTTQKELQKLQEDQKQIEEQLQ-----------
A8F8R1_PSELT          TGGEVELERSDSLVKRKIRLSEIANQRRELSSLEKLHEQKINQIEEETR-----------
A5IN04_THEP1          TGGKE--ERSINVFEKHIKLKHLEQEMEETERQIAENRDELASLKTEQE-----------
C5CIS4_KOSOT          TGGYIGNDVRLDLVTRKRRIQELEQKEKDLQKAMERMQRESVKIKDEIQ-----------
A7HMD4_FERNB          SGGRSKEDYANSIIARRVRLKTLEENIEQIEHEKENTENEISVINKEIN-----------
B7IHN5_THEAB          TGG--KYENSTSFLARKNLLENLKNELVEKERIEAEITKKLENLKIKLD-----------
SMC_THEEB             EPSGAMTGGSQRRPN-TLRFAQGVP--PQESAEVQQVRDRLGELERLLDR----------
Q2JHS4_SYNJB          ETSGAMTGGSAPQRA-GIHFSVGEP--SEE----AALRSRLAELEELLAA----------
SMC_SYNP6             ETSGAMTGGSIARRSGGLSFGSPDS---GESAEVRAIRDRLEQLEVILDR----------
B0C9C4_ACAM1          EPTGAMTGGSRNR-HNTLHFGTGEA---GESAAIMALKQRLSEIATLLQP----------
Q115J3_TRIEI          ESSGAMTGGSMSRRSGSLHFGTVDGRDLTEIGEMESHSQRLQEIDIVLER----------
B2J925_NOSP7          ETSGAMTGGSNSNRS-ALRFGTGEA---AESDEAIALKTRLVDIERVLER----------
E0UKI1_GLOV7          ELTGAMTGGSKPSRG-SIHFGSVNS---SESAEMAALKHRLADLEQILSR----------
B7K4Q6_RIPO1          ETSGAMTGGSQPKRS-NIRFGTVTR---GESEELKAIKQRLADLDNLLAR----------
B0JSN6_MICAN          EMTGAMTGGSQPTRS-GLRFGKISP---KESSEAESLRERLAEIDRILTR----------
SMC_SYNY3             EASGAMSGGSRNQRS-GLRFGTMVS---EDTAEVKQLRQRLQDIQQVQGR----------
Q84EC7_SYNP2          ETTGAMTGGSLSQKS-TLHFGSMAT---GDSAEILALRERLEEIEHLLRY----------
D3EQ04_ATETH          EASGAMTGGSRPQRP-TIRFGILNQ---GEPEEIRIFKERLVDIENLVLK----------
SMC_GLOVI             EKSGAMTGGSLDARRGGSGFALSEP------PELAEMRARLGDLDRLLAT----------
A5GQT1_SYNR3          ERSGAMTGGSLQQRSGSLSFGRAND-----GDEAEPLRRRLLELGETLVA----------
A9B9B9_PROM4          EKSGAMTGGNFSARSGALSFGISTE-----ADEIEPLRQRLLELGETLLK----------
A2BNJ6_PROMS          EASGAITGGSKLNKDLAYRFGINND-----NDDSSPIKERLLVIEEALKE----------
Q46EX0_METBF          EKSGAMVGGSIS-SKSGTSFAAAEK------DKLLELAEKIRSLDESRNA----------
D7EAF5_METEZ          EKSGAMSGGSKQ-QRSGLSFAAAEK------EKLTKIAEKITEYDSKRNN----------
D1YW78_METPS          EKSGAMTGGY-R-SRTKLKFKASEE------EHIKELAEQITILESSRDS----------
A0B8B9_METTP          ERSGAMTGGH---YTSRLKFAAEES------RRLVGISERISATEARRGE----------
D4GT30_HALVD          ERSGAMTGGS-G-GGSRYSFSKSGE------GKLDRLAKEITKLEDRRRS----------
A7IAD8_METB6          EKSGAMTGGS-A-KKPARGFGAAVD------DEIIRIRSHLAELSGEATT----------
A3CWK7_METMJ          ERSGAMTGGS-Q-GKKIRGFGVAVD------DEVARVRAKLAELEAEAGE----------
B8GG37_METPE          EKSGAMTGGF-L-KKTIKGFSASVD------DDIRRLQAVIATLGEEASD----------
E1RII6_METP4          EKAGAMTGGS-Q-QKRISGFGVAAD------EEIKKLVGAISGLRVQEAD----------
Q2FLH3_METHJ          EPSGTMTGGS-I-KKDAGGFGTTSV------DEVKHLSSQLAALTADEQA----------
A2SS75_METLZ          ERGGAMTGGS-I-RKDLRGFGVAVG------RESADISAKLADLRNDESD----------
D3RYW2_FERPA          EKSGAMTGGSAEKLKSGILMVKELL------KREKEILEEITVLNSKKSI----------
O28714_ARCFU          EKSGLMTGGSAE--KRGILVSRELL------EKERMLSDKIYELQREKEG----------
D2RFP2_ARCPA          EKSGVITGGSIK-----KKATLGLF------DRERRLREDIENLKRSRSE----------
SMC_THEAC             DPGGSITGGYRNYASDYASALR--------------MQHDLEGMKIQLSS----------
Q97AI9_THEVO          DPSGSITGGFRRQVRQPARSP----------------SEDLDSMKKELAF----------
SMC_METVO             EPSGAMVGGNIR-RNSAIKVDIDMKKL-------TNLSEDIKELEQILSN----------
A6UQ42_METVS          EPSGAMIGGHSR-KKSIIKVDIDTTKL-------QKLAGEITELESTLSN----------
A6UVP1_META3          EASGAMVGGSVR-RTSNIQVDIDTTKL-------EKLSTKLKEIEYKLNGNGEDEKEE--
SMC_METJA             EPSGAMIGGTFK-SKAKIKVDVDLSKL-------NKIADEIIAIESELRK----------
C9RFQ3_METVM          EPSGVMIGGTFK-SRAKIKVDVDLNKL-------NRIADEIIKIENELKS----------
D5VT24_METIM          EPSGALIGGSYI-EKNLIKVD-EEEKI-------KELELSILKKERELRE----------
D3SQ87_THEAH          EKSGIITGGYTD-YGGYLGAESYRRKL-------EELLKRKERDDRALVE----------
D3DG53_HYDTT          EKSGVISGGDAQ-SKGELGREFYAKEV-------DRLSLMEKRLKDEEEQ----------
SMC_AQUAE             EKSGVITGGAVK-PSGELNKRYYEEEL-------QRLNAEEEKLKNEESI----------
B4U7R1_HYDS0          EKSGVITGGKAK-QHSNIGKKALLEKL-------EFLNEKYNLLKAKEQQ----------
C0QSN8_PERMH          EKSGTISGGFDKNRGGILGRGSLEQEK-------IKLEQEDERLKAEEGM----------
B2V736_SULSY          EKSGTITGGSEK-QSITIGRSFLEEER-------KKLEEIDQKLKEEERA----------
SMC_PYRFU             ERSGAITGGHFR------ARG-LAVDT-------TKLREKVESLRRRKEA----------
C5A612_THEGJ          ERSGAITGGHYR------PRGRLGINV-------DELKAKVERLEREREA----------
D1CC09_THET1          VTGGNLSKAQGGILAKRRELKESRERAREIGQKLEEVKDQAHKLDNILQ-----------
D3TAQ9_ACIB4          SGAMVGGSVERKKKVSMGNLDEIGRKLREAREERENIEMRLNAIRDELD-----------
SMC_HALMS             ILTMSGSSEGQGVVERNNQIQELEKEIEVLRVEVAELETNSGEKSLVLEQ----------
Q6L0R1_PICTO          EPAGAITGGYLK--NDELIYSKITKEISNLENENNTLNDELKVKSDELN-----------
C1A7M6_GEMAT          LPGTATG---PGPLQRRAELNRLESDLAAADARRDEAALTAEAARLALG-----------
C9RN51_FIBSS          SGLVSFGVSTSGALSRKNEIADAEALLEKVQGDISAGEENVDRLRELTE-----------
D1B5Z0_THEAS          GKEVARSSFRGPIVTLEGDVFQPTGAVSGGQSRSQRSAMEIRCALEEGRG----------
                                                                                  

SMC_FUSNN             ----------NYENEVDKIDSLEDSIRKDIDLLKKDFESLSEKSEKLSKDIRSISFNIED
E3H7H1_ILYPC          ----------KTEEELMTMDDLKEKLRIDVKKLAELLEDLKSKDEKLVKGMKIVDMEIKE
D1AK68_SEBTE          ----------KTAEHIQEERIILQDLESSNRDFNNEFESAKSEYSRSKRELDTVNFEEND
SMC_CLOK1             ---KLHCQNEDFKEKIHLDNIELTKLHQQNDTIERETKKLIESRETANREIKLLYKNKEV
D8GS00_CLOLD          ---ELDEEILDLKEKGYSENIELTKIQGKINNIDNESSKLIENMKISNREIDILTKNKEL
Q97IA1_CLOAB          ---ELDNLCLDLTDTIHGEKIELTKIKERLKSIDIESEKLNKSYNTSVGEIGFIKEKINK
A0Q0Y7_CLONN          ---ILDENSINLKDEIHYENLEKTKIAGKINAIDGETEKLKRDLKIESNELILIEENLEN
Q895M7_CLOTE          ---SLEENCLNLKDEIYFEDIEITKLTEKLYSIEKENLKLKDRMKILKNEKETLNKELED
Q0SSA4_CLOPS          ---ELSIKKQEIIDKIYEKNLELADLNNKIKNVNDETFKIKNSIKSLDLELKDIDSRKIR
A6LSM4_CLOB8          ---DLDEDMLNKRDEVHEKNIELTKKESEIKGLQSDTDKLKRNLETAKEEIKRIAGEREA
D9SLC7_CLOC7          ---LSDEEILNLTDKIHFNNIEKTKVEERVSALEKEILNVKKVVSTNREIVSKLKTELEE
D7APA8_THEM3          ---HEEEQIELLNKEVSDIRYNITSNEQRRISLEKEIGNLLNQLESYTLEIGELKENVRN
Q8R9W7_CALS4          ---SVKSELKKLEEQIYINERELEATKQGKDFVEKEIQNLEEKMQDISVEIKELDEIISI
D9TN88_THETC          ---SIKEKLDNLSKDINNREIIFAEYTKNKVTLESEIEKLSAIIKDNEIEKSQIEEAIEN
C9YKI7_CLODR          ---NIKNEIDSHESKIKDLEKSIIIKSTSIKNVESEIESLKGSITKLENEKNDLNSNLNY
E3PS49_ACESD          ---DLLVELSNKEKEFKNKSDVKMDLLQNHKTHVIQMEHLESKSKNSISDSALISKSLED
B0S1M4_FINM2          ---TLKKSYDENIDIIDKNKCDLEIIVDKIGKLRNEIDDSNSNIKDKQFEIKYLKSNIND
Q3AC59_CARHZ          ---DIDATIKLTGEKLSDIEAQLTEADLKEQNIKDKRNLIESRLIELKGQLDKNNREKKN
E4SF58_CALK2          ---DLKTAKQETEENLNDLLSKMNELEREIEMYDYKIKQLAQNKDALENEKNLIGQQLIT
SMC_RHOBA             ---SEAAELGRHEQAMRKWITEHAAAEAKLHHVTERLSA-------RQATVDELKRSSAS
D2QWB0_PIRSD          ---AATDTLSSAEKLARSCREEQRAETSKLERLEQRETS-------LSEQLTKLDLAIQR
D5SU17_PLAL2          ---AADASLEAAATEADTAATRLAEVRSQVSLAEQIEQR-------LQSELEKAHANRAA
SMC_KORVE             ---ELTSLLQRLEDEKREGEKQAMTSGHTLRQLENEMAR-------VRDRHATYERELQR
C1F1T5_ACIC5          ---DLTRSLEVKSEERRQAERESAQQGAALRQMDSEIQR-------LDRRVQDWNLQSSR
Q01Y77_SOLUE          ---GFEAELERLRALQQSREKDRVALDHEMRKLGDDLAR-------VNSRLSVARLELER
SMC_MYCPA             --AARQDSAEQALAALNESDSAISGMYEQLGRLGQEART-------SEDEWSRLLRQREE
SMC_MYCTU             --SARQDAAEQALAALNESDTAISAMYEQLGRLGQEARA-------AEEEWNRLLQQRTE
SMC_MYCLE             --VAHSDATEQALVALNESDTAILSMYDQLGRLGQEVRA-------AEAEWESLLAQREE
A4FMG9_SACEN          --EARRDEVRAIKDQINEAKVRRARSTERLSSLQKAARS-------ATAEVERVRVQRTN
C8XH72_NAKMY          --SAAEAAAAATLSALNESDAHISAVAEELARYGSAARA-------AAAEANRLEERRQA
D7GEI0_PROFC          --SAAQKKADAALELLNESDAAMSALSEQISHLGQASAT-------ARAEAERAKASIDK
Q2J6Z3_FRACC          --TRARTAIDAALAALHGTDARHRALSEQMARLDRSGGA-------AASEIARLEGARSR
A8L599_FRASN          --ERARAAIDAALAERHAADARHRALSEHLAQIERTRGS-------AAGEISRLERSRLA
C9Z3S1_STRSW          --RDRAALVEELGERRRAAEREKSAVAQQLGRLAGQARG-------AAGEAERSAAAAAR
D7CC86_STRBB          --AECAARVEELAARRSAADREKSQVAQSLGRLAGQARA-------AAGEAERMTAAAAK
B1VYX5_STRGG          --TERTALVEELAERRRTAEREKSGVAQQLGRLAGQARG-------AAGEAERMTASAAR
E4NHH3_KITSK          --AELAAETERLAALRRQGERRRAELAGALGRSGGAARA-------AADEAERTAAAAAA
C7QGY1_CATAD          --QSAKAHVDSLMAQRRQADSQKAGVAQQLGRLGGQARA-------ALSEVERFVAAIEK
A0LV82_ACIC1          --EQAAAAADAALAQLHESDAAMAAIAEQLGHLGAQARA-------AMAEADRLAGSIAQ
A0JXV4_ARTS2          --TQAQERADAALERLHESDARLAAVAERLGHLNSVLRS-------AVGESERLGASLAR
A1R7H8_PAEAT          --AEAQDRADAALERLHESDARLAAVAERLGHLNSVLRS-------AVGESERLAASMAK
A6W7T9_KINRD          --AAASDRVEAALDRLHDSDARMNAVAEQLGQLGSAVRA-------AAAEADRLRATRTQ
D1BJA3_SANKS          --QSAQERADAALDRLHASDAAHSAVAERLGQLGAAARS-------AAAEAVRTQERIDA
C7NGM6_KYTSD          --AAARPAAEAALAALHESDARMAAVADDLAQAAQSERA-------ARSGIEKATERLAA
B2GFM7_KOCRD          --TAAVQEAREATRDLQRAQKEAAAAGAASSRAEATASS-------ADSELARRREVLTT
E1VVN2_GLUAR          --SIAQQARDEAAFALNESDATIEELSSYLARLGEKLRT-------TQASKQKLLLKLET
A5CQQ2_CLAM3          --RAARERASAALGGLREADARLAALAERLSRSRAQAES-------AAAELARVQRGLDL
Q6AE90_LEIXX          --QVAKEQSQTALAALRESDAKLAAQAEQLNRVKVQLEA-------AQAEFDRLSRALEQ
D1AB24_THECD          --SRAQAALEEAQAAAQQAQNGVGQAQAALDRVRGRLRE-------FEARAAQEAKRAAR
D6Y659_THEBD          RVAEAQRAAAAAQSRVDAAQQGLNAAQAALDRLRSRQRE-------ADQAAADAARRLAG
D7BMZ9_ARCHD          --ETAQTAYDHVAAQLTARDSRVAAITAQLGVLRQSAAA-------ARADEARANERLDR
D6ZIF1_MOBCV          --VAAQEKYDAAAAQLKAQDAAAAAAAAAVAAAKAKRGA-------AQAEVERAGKHLEQ
C7R311_JONDD          --QAAIEQVRVAEEQWSNERSQYSDLRAQHAHASAQREG-------ARVAHQRATSHVTS
D6ZV06_BIFLJ          --DEAARLVDQESAKRTEARLKAQQAEKSLKSATDRVAS-------FTRQLEQLDRKITE
Q7ZAJ9_COREF          --EDTRIEAAARAAALRESDMALETITRDLDRLDRQHRA-------AGDERDRHAGRLTD
Q8NNW5_CORGL          --DNTRVEVAARTAALRELDMTRDSITRDLARLDKQHEA-------AESERVRHVGRLHA
Q84F13_CORDP          --DEARVRSAQAQAVCREQEIVVENFSRRVEAVSHEAEA-------RKQELRRHALRVQE
Q4JUZ1_CORJK          --SDLRTAAAAARAAEQEHRALRDAAAKRLSALQKQGEA-------AQRQLERSTAEQQS
C4LJD3_CORK4          --QERRDALGAARAAHTEFTAVASNLKERVSTAEAAVER-------LKKELHEVQENRAH
D6Z8M0_SEGRD          --AAARQASVQARAELTGAAADRAVAGESLARSATQVET-------LEMESRRTAARAEA
C8WGU5_EGGLE          ---AAQGESLRLSQELAELRGKTDSARAEARRAEEKLAA-------VRREFEDIERQRGE
C7MMZ7_CRYCD          ---QHQAKNLETSQALAQAKGMAASAAEDARRAAEDLKG-------LEREAESLAESRRA
C7N560_SLAHD          ---RKQAMSLDLARTSAQKKGDHASAQAERGRLAARVGT-------LEANLQSLGTELAA
E1QVK5_OLSUV          ---AARDGSARTKGELARAEGELASVNSDIGRLESQLRQ-------ATSEEAQVTKGRSA
C8W740_ATOPD          ---SVREKSAQSKGEVARLNGELTSIASERGRLEGQVAS-------SQAELKQVSTSREQ
SMC_RHOPA             -----EADLKMAAAAETASRESLRGARREVDAARERFAA-------AEREVNRHAARKSA
A7IGT2_XANP2          -----DSALRLAAEAETTSREARRAAQRAAEASRSALEA-------AERRAAQHLARLSA
B8EMM7_METSB          -----EALRAAAAAAETEARQGHKAALRDIDAARAKHAA-------AERVEASAAARLSS
B8IQU0_METNO          -----QARAREAAAAETRSLDGARLARRALDAAREALAA-------AERQEAEAAARRTA
Q92RE8_RHIME          -----GARIRAEDERLRLSREAQRMLARQLSEARDALAV-------AERASGDLARRRAV
A7HQY9_PARL1          -----HVAAEKALQEEQSRRAALREAQGEHNRIRDTLQA-------AERAASAQLSRLAA
D8JUP9_HYPDA          -----ADAAQKAEADERRLRQLWRDKQNELAQIRQKLTS-------LEKLQRESETRLAA
E3I0B2_RHOVT          -----QNAATEAQASEKRLREAVRASQAQLAQKRATFSQ-------AERAAMEEANKLRN
SMC_RHOS1             -----QARLAQLTRADQEAREARRAADARVTEASRAAAR-------AEADRSISGGKLES
Q2W040_MAGSA          -----TREVEFAAEAERRAKEAVKQAEAEAAKARDSHAR-------LSQRFAAFETRMAA
D3P3X3_AZOS1          -----KLAVEEATQADRRARDAVRDGFAALNAARDHHAK-------LAREADAASSRLAA
B6IR58_RHOCS          ---DGRAAVEAAAGRDRQARDAVRAAFAALGQAQARHAK-------LAQAAAALATRLQA
Q2RPA2_RHORT          -----RARLEAVAAEDRAAREAVRAGERQMGLARDALTT-------LERRAAASESRLTT
SMC_CAUVN             -----ADRLRAAEDLLRDKRRGPPDAERLLTQAREQVAK-------FEREQALRAARAQS
B0T003_CAUSK          -----AEALRVAEETLRDKRRGPPDAERLLTGAREAVTR-------FEREAAQREARAQS
Q0AMJ6_MARMM          -----RETARTTREAEAAARAAVGPAERQARDAMARISD-------LRESAAKDAARATA
E0TC69_PARBH          -----RHIVTDLKASLATARSRAEAADRERLTAERALAK-------QAAEAERRAAKGEA
C6XRC2_HIRBI          -----AKALVLAQDKARDSQRALPILTQAASRAKQELMQ-------NEQALERLMLRRSN
Q0C0X5_HYPNA          -----RKARQQAEEALRHVRQLIGPAQKALSEARAFAAE-------EIQAAERASLRRDT
Q1GQU3_SPHAL          -----ATKAAALTEAAAAARKALADADAARRTALRAADQ-------AQAALDRHRDAAAL
D4YX43_SPHJU          -----SGREREAGQTLAAGRARLADADQRLRTALRAADE-------AATALERLSGRREA
Q2G9S3_NOVAD          -----RVTLGAVQVTLSQTEKTLSAAADAERAALRALDA-------AEAARARLDQRKAE
D5BSU5_PUNMI          -----QQALDTNRAAVQHARQASIASEQSFGEARR--------------RAESDALKLSA
A5FVJ2_ACICJ          -----EAAERDARHAEDEARTARRAAESAIDRTRKDLRTTAETASRLAAEAERLAAREAA
C5B6I7_METEA          -----RGRTVHARAALEAARRADAAAKTALEAARRAALD-------AVRLRGEVDARIAA
Q937L3_DEIRD          -------RFQELDEELAQAERQTATFQQQLSELES--KAPDAEWDALLRQRDETLRAERD
Q1J060_DEIGD          -------RFQEIDAELEEVDRQTACLQAELQKVQALLAGDAPAHDTLLTARERAAREERA
L0A7J5_DEIPD          -------RLAELHDELASIESRERELGALLLELTAQLGELDTRYDALLRGREDAAHQERQ
D7BH70_MEISD          -------RVREAAAQAEGLEGEILRLAQQAQRLRE----------------ELAKLDLPA
SMC_THASP             ---ALQERINGLRRELQTIQAQVHAEQVEVLKLAQARAR-------AQERREQLARDLED
A1K715_AZOSB          ---ELQERTNTLRRDIQAAQAQVHAEQVELLKLQQARSR-------ADERHAQLAHDLGD
C7RKG8_ACCPU          ---DAQDAVQESRQQLGLLQDRAHAIQVEALKLAQARER-------FRERQAQIDESLAE
Q3SJI0_THIDA          ---ERQREVQALRAQSGQVQARHHTAQMELLRLQQAVER-------VQSRSTQITRELED
SMC_DELAS             ---EASQRLVSARREASESQSRAHELQVETLRLSQLAEQ-------ARARNAQISADLAE
D6CTE6_THIA3          ---QAQEQLAALQRRQQQDTQQLHTVQVELLKLTQQAEQ-------SAARNQQIATDLGD
SMC_BORPD             ---QVSQAVAPARQRVAEITRRVHDIQLEHSRLQQQAEQ-------SGERAARLRQDLEE
SMC_BURP1             ---QASQALTEVRAQAERATQRVHALQMDVLKLTQAHER-------YTQRSTQIREELEE
A4SYV7_POLAQ          ---AAHQAAEQARINAEHAVQEAHGFEVERMQLTQAEEQ-------YSQRAAQIQGELSE
D5CRW3_SIDLE          ---SVEGRIAPLRSSTSDLQQRQHGAQMQILKLTQANER-------TQERNVQIAQELEE
D9SGR3_GALCS          ---DLECQLPVLRRAIHASGQRQHALQMQRHTAQQAEEH-------RRARGEQISVELAE
Q2YBB9_NITMU          ---DLESSLSSLRHENEQLQQLHHNVQMQALKLTQTVER-------SEQRRKQIDSDLAE
Q0AE88_NITEC          ---HIVAEIVQTRKAIETTRTQQHSWQIQIVQLMQKTER-------VAQQQAQLETELAD
D7DI79_METV0          ---TLRHEHQTRSLQLKTVTQQAHQLSMALQQLKQQQSN-------ALQREKTLQADIAL
C1D4R7_LARHH          ---VAREAIRDAQQALEAARQQDTDTRLQRSRLEQQREQ-------GEARAAAIEAEQKR
Q7NR76_CHRVO          ---MLAEAVRGQKGSLTRLEAELNASTLEHVKLDQAARQ-------GAARLSAIEAERGR
A1KSF4_NEIMF          ---SSEVQHKNLMQQQQQHTRQYSQAQQRAAELLARTNQ-------GQIRREHIERELAQ
A1WY82_HALHL          ---EAERRRDELAAELGPLHRRHADLQARLEHRREALDR-------ARARREELASERSR
Q0AAV4_ALKEH          ---SLEEEREALQQRSAPMQRRQADLQARIEHRRDALEA-------ARERREALHEQQIE
SMC_XANOR             ---AAEQQREDAQRQLYMAHRSVSELAGQLQSQQGKVDA-------ARTRIERIETDLSQ
B8GTL2_THISH          ---ELEARREDLQVQVNRAHRGAADLNAQLSNRRTRLEQ-------VEGRFARINEEIAE
Q3JAH9_NITOC          ---TLESEQERQQKVLHQFQRELGGCQSALARVEAKQEQ-------HQLRQRQVQEELEE
D3RSW0_ALLVD          ---DSEQRRLALESELTGLERERSALRSELSALRTRVEH-------QSERRRALDEEWAD
B3PGR0_CELJU          ---TLENQREQLRRDADEQNRRYGELRSQLSARQVRVEQ-------TNMRRERLDNEIRE
A6V7X5_PSEA7          ---ELEGAREQVRRQVQEEGRRHGELKAQLSAQQAKVEQ-------LVLRRRRLDEEVAE
Q0VR03_ALCBS          ---ELEEEREEVQRQASRINRELGEINAQVSARQVRLEQ-------ITMRRERLGREMDE
C7RBE2_KANKD          ---EQEQLWQSKQSQLAQASRTYSELRAKVGSQQAKLEQ-------AKSRLERLQKEQRD
Q2SD45_HAHCH          ---CFDEERETLQKESVEINKQLLQTKSDLSAKEARREQ-------VQRRVESIAAEIAE
E4PL89_MARAH          ---RSEAARDEAQTRLSEADRELSTLASRVSGLRARAEQ-------IDARLQRIRDDIQD
E1V8E9_HALED          ---RAEAGLEAVRVEQRDLEQQRQQLAVQDSGLASRLEH-------LQGRAAELAEEVEG
D3SAL9_THISK          ---AAQAERDRLDAQLREQQGEIDERDRRIQRLHDQARQ-------LEQQQARIDHEAGE
SMC_METCA             ---RLESEGREARKKADELSAGLSLARSELAAAEARSEQ-------WRHRLDQLSHELNE
SMC_COXBU             ---QLETDRDTLLQTYQKLNAEATTVQSALSTKQAQLDN-------AQQQQTRLKIGLNE
Q5WTI1_LEGPL          ---ENLNFIKLHQLNLNASNEALRNHIIAVNSQEQAIFH-------AEKQKDAITNEIIE
Q12L80_SHEDO          ---EVKLLALECQRQGHALALKKQALSSEMAKLLHQDDA-------KETNLAKIASSQAQ
Q080K7_SHEFN          ---TTQVELNQCQQACHQLQIEQTKLHSLVTSLTQQAVE-------KRDKQQQCSQSIAK
A4Y804_SHEPC          ---QQKLQLVTSTQKLHQLQLDKATKTTQLTNATEQAKQ-------LTVKRNQLNEAVAR
D4ZIY3_SHEVD          ---PLKIELASGIDTLQKLNVSIARLTVQIEADKQRNKD-------LSQRREHLVSELAR
B0TKB4_SHEHH          ---PLVSQAQQKQQLIQAKQIELASLSSQLRSQQQSIVD-------IASRLAKVEQELVE
A3QFJ7_SHELP          ---EQREALTQLNTSLQGTQLERERLMAQAQATQERIAQ-------QGEQQARLKALLEE
A1S5R5_SHEAM          ---LARIHREAVEAELFEAKQQQARQQTLWEASVAHQAQ-------RAKQRAFIDEQIQR
Q5QUJ9_IDILO          ---QAQEQLEQVNEQVQQTRNEQGKVEERLQWNLQQAEQ-------IQQQLMSLRDKQQE
E1SMV2_FERBD          ---QARDAETQRQRAAQQSRETLLTLQGKVENLQQRLEQ-------QRQQRALLEEQQQE
F2GBA5_ALTMD          ---ATKAQKQALQSALSEEENQLTQFKNKLSLLEMQQAQ-------QSTRAEKLNQELSK
Q15UZ3_PSEA6          ---HLSTLKEQAQGNLSRCSEALSEHKNHHQWLVQQQQT-------NAQRVTKLQAELKR
Q3IKC0_PSET1          ---ELSTQQSELKETIHQLAQNIAVASTRNDMLKEQVAQ-------YQQQLQQYQTQQQQ
A4SKA4_AERS4          ---QLHSAFELSQRTVREQEQQWQQLREAWSLREGKRQE-------RLQRLGQLGEELTR
D0KWM8_HALNC          ---QQRKQVERLVAEQHQFEQQRQRLHWSLEDLRRKYQQ-------LKQQQADRAANVAR
A0A2W1K6W8_ACIFR      ---TLQEQVRTADARWQDMSRQSARERESLARLRSRVET-------EEQQRAERAAESQR
A0A0J1A050_ACIBA      ---QLQVDLQQKQQVIKQKQKDLQQLDVQIAKQQTAAQA-------FLLQKQQLKDQLAQ
B3E294_GEOLS          ---GAAQELLQARSNLHQLDLTLTGLVKDRQQLEAQSAQ-------LAERLKLLVLERST
A1AU91_PELPD          ---EVAEGLKSMATLLHQSELRLAGLRKDLQRASDEIGR-------TEERRELQALEAET
B9M6F0_GEODF          ---TAGEGLRDIRQKLHQAEIELLNAEKDLTRAREEVGR-------LEERASVGTIENEQ
Q39WG2_GEOMG          ---GTEEEVREVRQSLHQTDIQLVNAEKDLIRAKEEVQR-------VEERLAVTGMEDDQ
B5EFS9_GEOBB          ---EAEAHRVELRQSLHRLEIRVLNAEKDLQSAQAECRR-------LEENAAVREMEEEQ
Q3A212_PELCD          ---AAEQMQEDLREELHALELKRTAAEKDLGRAQQELTR-------IDERLDITSFENDQ
A9FIZ2_SORC5          ---EVGTALERARSEAHEGELALVTAEKDLRRAEEQLAA-------AQKREGVVRSELED
D0LY52_HALO1          ---QVQKALEALRKESHQGDIAILGMEKDVSRSRGEFER-------LRERLAQLNAEQLE
Q1D2R5_MYXXD          ---HAEGVLKGLAKNQHAEELNLASQEKDLHKAGEDLAR-------VRERVRALEVEEGQ
B4UDF6_ANASK          ---QLEAALKSLDKDGREKELALVEEEKDLARVGSELER-------VADRTGQLEAERKQ
Q6MNS9_BDEBA          ---NVLNDFEGAQKRKIDQEIKVAELRKDAERAENEVQN-------ALAAVERQEREVKK
A9A0M3_DESOH          ---EIEEDLQKIKNDRNQARAGHLELEKSLYRVSEELKH-------ADHRLEILEVEQQQ
B8FHS3_DESAL          ---GLETDLQRMVEGLRDLGREEMEAQKEVSRLKEDTKL-------AARHHQIVISEQDQ
E1QL74_DESB2          ---RVEAQATEVASQLQAGQRELQRARQHSSALQEAAGQ-------RRRRLEGLEFDHGE
B3EFQ6_CHLL2          --------KERQRVQTEKLQQEIRVQEKKLAHIEAEEHALRQTIRHAEQEVAELLAAVTQ
A1BDT4_CHLPD          --------KKQQRSETEKHRSELELLEKSLTRIDAERNSRRQTSERMEAEIREILDGQQQ
A4SG64_CHLPM          --------TGSLQPAIRETETTIIGLEKKLALLEAEEQGLNTQILSGETEAVELKHAADQ
SMC_CHLTE             --------TERVKRAAASISQEISALEKRLARLEAEERSGADQIAHADRERTALIASMQS
Q3ATI3_CHLCH          --------IPFMRRQIEQFQREKSAIEKKAARLEAEEQSMQQELMRGEKEHATLLQEQQQ
B4S519_PROA2          --------LAEKERHLQALVNERNVLEKQLTQIDIEQQSRARELEQIHREIVEARRKLQT
B3EM83_CHLPB          --------LGEKEKQRTTLEWEIGEINNNLARMDIEHASQRQDIERTEKEIANTEKRLKT
B3QRZ4_CHLT3          --------LAEFEKEVRRLAKETTDAEKHRSQIQFELTSFENDIRQLDSRLAKDAEEKAA
D0MFL5_RHOM4          --------FDTRRQALREAEQALRTLEQQATRHEATRESLRQRLEALKTRRTQLDEAQAT
Q2S457_SALRD          --------LAGHESAVQEAEATLADAEQRLERLRYERTSTEERRAELQERLDEIEEELTE
C7PLU2_CHIPD          --------TQLNENKINAAREKINQLNNQVFGLQNRIENFRQLVESGDKRLLEMQDSLEA
E4TVF1_MARTH          --------EHSYRENIEILQTEINEVNSEYVSVRTKQEQFSQMLNSAANKREGMEQQRET
B2KBE7_ELUMP          --------TRFQE-----ESISLNSFKNDLASREREIKNIEQSLEAISKNKESLLNKVSE
B1H0P2_ENDTX          --------FDTIK-----IKTQIEEKHSRIEEKKNGLKRIAGEINRHKEEINSKKTELAS
E4TEW8_CALNY          -------QLKELDKSIANIDIHIKNNNGIRDNLIKREITIKKEINFCTEELKKIEEGRFS
D3PDY1_DEFDS          -------HFNELKISYEKKKSEIESEKDFIERLSKNIALIIKEKEVLVASVKKAEEEISK
D4H2V6_DENA2          -------QKQTTTLDLKDRERSLNDLKSRHERLSKRSSIIDSEIQNIDSEIEQAKEKIEY
D6YSC9_WADCW          -------EIRQAEREDVERRYFLERMQADRERFRIESEKEQEEMSALQELSGKVEEVLVE
Q04TU9_LEPBJ          -------QIEDLILE---------------------------------------------
E1R6H6_SEDSS          -------ATKKLSELFTRYRSAVPSFIDEFLAPEGIITIKRE------------------
Q73ML2_TREDE          -------ISDEVQNALEKYKKSSAGFIDDFLAPEGIITKKRA------------------
A0A0H3BKB7_TREPS      -------IVHCVESDIAEYARVSARFIDEFVAPQGIMTKKRE------------------
E0RSK7_SPITD          -------TVEQARDLYAAYLATEPSFLEAFTAPEGIITKKRA------------------
D5EMY0_CORAD          -------EIDAERRDLNALREEATALDERRDAAEATVEEQRQRATSLANEVSSLVTEERG
B1ZZB8_OPITP          -------LLAEEQKVHDEQKAVIDALNARLAEAEQALEQRRTDVLTATQNLAAAQADQRG
SMC_DESHY             ----------KGEENLKHLMGEEQELKSALAVLRTQELNLRAQAQRIHEEVTAIAARMAG
A4J682_DESRM          ----------QCTEQYKVSQQQLVTLGLELQAAEMDLTKAKEALARANERRQESQYQMHN
Q67PF3_SYMTH          ----------DLLGRIDEASTRLRKLEGRLTQTEGDERRLSDEARRWAQVLETHAQEAAS
B0TGW8_HELMI          ----------RLEGRIQAQERSIAHLDAEKAANAADLARLQREMEQEARQISGIEGELAI
Q2RJX0_MOOTA          ----------KLASTLETGRQELRRVTEALIARRGELHNLLQRLSEYKDQLARLAEKTAV
SMC_BACSU             ----------DMEKKLADLRETGEGLRLKQQDVKGQLYELQVAEKNINTHLELYDQEKSA
C5D8T7_GEOSW          ----------QEEAALLALRKQIEEERFALQEVKSELREVQLQEKNMNERLALYDHEKAN
D5DQR5_BACMQ          ----------ELQQEINKQQAFVERLKDKEQESDREVKQIDIEEKAVNDRLTMYDHDIAS
B7IUK7_BACC2          ----------EKEVKIRELRQTVEAERVDEQKLREEINRLELEEHRINDRLSIYDLEIEG
Q9KA07_BACHD          ----------ELQQLIEDLRLQGEAARAEVDGAKETWQAVTYEVKAMRERLSLVDREHES
Q5WFM8_BACSK          ----------ELQETIAKVEAQKAQAQETLEEAQRAHQEASIAYERARQEVERIEQQSKE
Q7ZAM6_OCEIH          ----------ELEFKLSEGDKDKSKLQERLQSQTNILNELEIKLTSVNDNLSIYDMDKQQ
D6XTT7_BACIE          ----------VITQKKEKLKHEGERLRKEERQLESRYQEQSWLYQSYADKQEVAELELSE
Q81ZN4_ENTFL          ----------TATERAEMLRSAGEQNRLKQQEIDNKLANQTETITRLTKEKRLFEYESRE
A0A0E0UX46_LISMM      ----------KKREELEETRGIGENLRLQEKELLGKLDRETENLERFNKQLQLYDIEKAD
B1HQH6_LYSSC          ----------TIRDQVELLKLEGEQLRKDEMQQAGRLRELEAVEKSLSARVTFASTETQD
C6D303_PAESJ          ----------ILSQKMEELRSQAEQYRIDEQQVRAELQQLNNEAKHLTEQEQLFTADRTN
C0ZFN9_BREBN          ----------QMQQEQEALRTEGESLRLKEQEVKGLLQQKESEGRSLGERAKLVEQDIES
C8WWA4_ALIAD          ----------ELGRERDRLEAERAVRLGHLKQFENEERQADFQLKTLAERMEALDWEREA
D5WPA2_KYRT2          ----------VLGRAAAEYEQALHEARTEGNRLQGIQDDLGARLKSLIERLEWDQFEIDR
C4L5Z7_EXISA          ----------DITRQLSELRDEKRSVETNLREVESAYRTAERASLDAKSQLELFDHEMMR
B1YIN0_EXIS2          ----------QLVGSLETNTRDIQLVQAQLESVREAYTDAKRSLAVTSSELSVHDGQLTR
D3R1B0_MAGIU          ----------NSGQNLANAQQERQDAEKEYILATAGSEEIEKQLRNRRAKLAEIEAESAA
D2RLB2_ACIFV          ----------RVKEKRQQGVEALQKIEVEKAGAVARVQQEETQKKRQQENLELLLGEKRQ
D1BLY1_VEIPT          ----------ETEKDQATLDESYQHTNLLYVASETKVQNIQNQLDRKKRVLHEEEQRLVQ
A5UQ60_ROSS1          ----------AAEQSVRDAERHQRQVQRQLDQARVAAAQTQRAVDRAEAEYLVCQRRIEQ
B8G556_CHLAD          ----------AVTHRLRQAEQAERDAHRRRETARNVLDQAQHRARQVEQEQQWVITQQER
A9B100_HERA2          ----------NAEKAVREAEQARRSNRTTMEKARDSLAQRQRGLQQIEQEQQWQQLRSNN
D1C6T1_SPHTD          ----------DRLRAERDALDHDIAAAREAGRAAEAALARQ---QRLRDDEARAATEEEQ
D7CMX2_SYNLT          ----------ELERGLQEIRQQEEELKLEEKMLMLELENACGERERLIQAIDDLRYENKG
Q0AYV7_SYNWW          ----------ELEQVISRARNDLLESQFRCDMMMKQKEDLAHELLDDERERDGYLEQLSR
SMC_LACPL             ----IAANVAQMQSELVTYEQGLADLKKANQDLTVQVETTRQQLSELKDRLSQTQAQLQA
Q03RT7_LACBA          ----LQASIATMQQQLTDQETKIKAQRAALQASEQRSQALQATINELQPQCRQLDDQLAN
B2GD41_LACF3          ----LEQAIKQAQATASQLEAQVQRLQRARQASQVTRDELEQELARARNEAVEQGNQAQR
A5VKP1_LACRD          ----LEEELKKQEQLAANLEQEVAKLQQAQKANEQVVADYQQQVQTLQDKFHEQESSCQL
Q03FW9_PEDPA          ----LQVQVTAMKTKLASKETEVQKILEQGQAIQSELKQALEEQHQAEQKSSELSNQVSL
A0A249N2C3_LACRH      ----LKTQLQDLVADLKQKQADLTTLTKQENAAQEAWQTATAQAQALAADLTAITSQHNA
Q38XR7_LACSS          ----LEQQISKMQLALDQKQTKVQALHQDLAEQQAQLEQQQGAFETAKTHYQTQKNELTL
Q1WU99_LACS1          ----LQSDIEVMKKKLEDMKIYWGKVHEEYKKIQDKIDTLQVKKNRLQTDRDKYRRKFEL
Q04GL1_OENOB          ----LNKQLDDLKKEGQKVNQLIDDSQKEIAVDENKFIELRNSIVAKKESLQLKVGGKKI
Q03VW6_LEUMM          ----LSERADELSVQARTLEETLQLKRSTGEQLQEKLLLAQESLRAAQNDTKKIDYELSR
A0A0U5K8Z4_LACDE      ----TTAMLEELERQFHIKEEKLAGLDKQVKDKQETREQISRDLQSLQQDLSAAVLTFQS
E4SKB3_LACAR          ----LEAQIKTLTKTLREDQNQLETLVDQAQRANAELQKLQSSLQETNQAINEVAISFQS
Q74IP9_LACJO          ----LTLQIKTGKVEFTKLQTALNELDKKLTELQTELEAKNTDLTALNQKISEQAIKYEN
A0A0T8KIP4_STREE      ----LQKEIAADEASLGSEEAALKTLQDQMAALTERLEAIKSQGEQARIQEQGLSLAYQQ
A4VVL7_STRSY          ----LLGEIAELSSQLQEQESLVAAKKTSLDQTREALETIKAEGEEARLNQQSARIHQEQ
C0MCR5_STRS7          ----IEKELALLSEQIKESEGAVAAVQADLKAKKAVQADTKLAGEEARLAEQKTQLAYQQ
A2RLZ7_LACLM          ----LEKQIKLSEEQLKISEKEVQKAQSARQELLKEIELLKTQGEEKRFVEQSLNLKIEQ
B9EBB4_MACCJ          ----LSQQLNEYESQTLQLREKVSQLNESISEAEFQLEQDKQNGIQLRDELHQLKLTREE
SMC_MYCHR             --------TNTLKF----------------------------------------------
E0TKT8_MYCHH          --------TNTLKF----------------------------------------------
Q4A770_MYCH7          --------TNNLNF----------------------------------------------
C5J708_MYCCR          --------KSKIEF----------------------------------------------
A5IYM7_MYCAP          --------ESLIPG----------------------------------------------
D5E4P4_MYCCM          --------KELIPG----------------------------------------------
Q6KHN4_MYCMO          --------KSLLPQ----------------------------------------------
Q98PK8_MYCPU          --------EEIVPI----------------------------------------------
D1J8Q8_MYCHP          --------QDLIPV----------------------------------------------
Q4A588_MYCS5          --------EEFLNK----------------------------------------------
SMC_MYCGE             -------NEQNINK----------------------------------------------
SMC_MYCPN             -------SEANITQ----------------------------------------------
Q7NBU0_MYCGA          -------LKNELLV----------------------------------------------
Q8EVS6_MYCPE          -------IEKEIEE----------------------------------------------
Q9PR04_UREPA          -------LDLKIKK----------------------------------------------
Q6F1N4_MESFL          ----PESIKNKIIT----------------------------------------------
Q6MTD2_MYCMS          ----LEELKNKIEL----------------------------------------------
E3GP81_9FIRM          ----EVEMKRQDSE-----KLKIKAAYREAFKAYEALKEAAKKAELRLNSVEQEHWKITQ
SMC_HALOH             ----------EVLNKKEVIKNDIRDLEIEKNNYHKDLIRLEQEKTKLSERLEEIDEEFVD
E4RL35_HALHG          ----------EKETQNKEQIEELQALKMAENNKQNQIQRFKEELSELKETKNSLEANYNQ
D9QRN7_ACEAZ          ----------SLTERKEEQQEAVHQLDLDLTSKRKDYQQLKEEIERLETDRKQLNNYLNV
A8MHB7_ALKOO          ----------SILANVEALNTNIQENRIQIATLNSTIEQVTQEVHRLQSLYDNAENEIKQ
A6TRT3_ALKMQ          ----------AIQEEISNVKEEQQQYKIEEATLSNQLDQSIKEEQQIKNLISQVSRELKQ
A3DDY2_HUNT2          ----------EITDKISFEERSLKDNELVKIRDESHLAQIEENIKRSLARIDMLKQEKEQ
D5X8N2_THEPJ          ----------KLTGELESIKESQQVGQLRIAGLKAEMEQVKIQKSKLEQSLEVYEMEVAQ
D9R048_CLOSW          ----------ESREELEKLRTEKQQLYLKQNTVKINIRRIEDKKEEIKESYGDLERENSQ
C4Z0E6_EUBE2          ----------SIRELIDADNKANREVSLAVNTEQMNLNQAKQKLSEIRIIYDKDKAETTE
C4Z924_AGARV          ----------LGEEDIAATKTLLQEKYIEQNTAQISVDRADQQKKESANVYEDLRTENAE
E0RV40_BUTPB          ----------ELRTVVEELRAELQGKFIEQNTARLNVENEEKRQREQKGNYTDLKAENDD
A9KLR0_LACP7          ----------SMRETVEANQKRLSELSVEANTAKMNSRQEQEKMDGMRHTYLEFMNELKL
D9S347_THEOJ          ----------KTQRSIETLSQNIYRSNLEIAGLEKEQMEKKGLMEERLERQRLLKLEKKQ
B2A2N3_NATTJ          ----------NKRSNIDKLMSERHQLDLELGELRKDQENFATEKAKILEDIEVYQLKQQT
A8F8R1_PSELT          ----------SLLNQERVVERELTNAIAEGSSTRRMVEELNKTVEELNKEIESMDQLRRN
A5IN04_THEP1          ----------NLRNQETIVQRELFELSRKSSSTKTVLSEILRTINQLQEEVENLEKLLVE
C5CIS4_KOSOT          ----------ELRGYIRVLNEELNGIISKGAAINRMIHELLKTANELESEISELDKLKEE
A7HMD4_FERNB          ----------ELQNNMNIVREELATVSSRSLSSKRVLEELQKAYKEITNEISDLVKLEAE
B7IHN5_THEAB          ----------ELRNYSEVVNSELLEYSSKSSSSKRLLQELVRSESELSKEIKNLEKLKND
SMC_THEEB             -----------LLQERTHQQGRVNALSQALSEAHQSHRDRQRQWEQLQQQQQQLNRQQAE
Q2JHS4_SYNJB          -----------LTLRLQAAQAREKQLAQALLLARQDALQAQQYLERHQADCQKQQARLQH
SMC_SYNP6             -----------SELQILNLQAAIKDAASTLSDRRQQQREQQLTVQQRQQTLQRLQQQQQQ
B0C9C4_ACAM1          -----------IENKIEQTQAKLASKHQELSGLRQQHREAQLKTEQLQKELKVLADRQAH
Q115J3_TRIEI          -----------CLVEIEGLKEKVKERSQAFMEGKQYFRETELKVSQIEAELQRLIRQQEQ
B2J925_NOSP7          -----------CTEAIATLSARSKKLTQELTETRQARREQQLQLEQLQKDIKNLTAQLEG
E0UKI1_GLOV7          -----------NEEQIAQKSQLVKELSQKLTTFKQKERELQLQYAQHQKDIERLSGQKED
B7K4Q6_RIPO1          -----------NEEKLAQKYVEIKELSRSLTELRQSEREHQLKRQQFEKEIKRLSEQKEK
B0JSN6_MICAN          -----------NEEKITQVNNLISQLTQQLTETRQSHRENQLSLQQLSKDLERLTTEKED
SMC_SYNY3             -----------NEELLLERTVRSRQLTQQLMEMRQQQREAQLHGEQTERDIARLSQQQTQ
Q84EC7_SYNP2          -----------TENALLDKGDRLQDLSQQLTQARQREREAQLHQVQLTKSLEKLRPQLEQ
D3EQ04_ATETH          -----------NEANIEIKTKQIQDISDKLIKTQQLDREQQLKYQQVKKEVGKLESYKSD
SMC_GLOVI             -----------LAERLERREQRAHELQSAAEAAQRELVAIENRAEQLGREHSTQQARATQ
A5GQT1_SYNR3          -----------SRRREAELSRQLEAAQGEFSSERSRQAGVEAELAAAQRAHGPQVTRQAQ
A9B9B9_PROM4          -----------CRKEEASLRDLLNQNRPLLSKLEKRQASLDAQRSTFKRSNSPLIERTKE
A2BNJ6_PROMS          -----------SNNDLILKNNRLSILNSNRSQIIEDWASFNKEIEVNQDSLKAVLQRIED
Q46EX0_METBF          -----------AINKQDSIESHLFELSRKIRDCEATISRKESQLDEIAGREAKLAELLEA
D7EAF5_METEZ          -----------TIKKLDDVESQISDVKQEINNHENEISKKQMQLEEISSREERLSQFIES
D1YW78_METPS          -----------VLKKVESIDGHIYGLKKDRSDMETQASKLTARKEELAGRLTRLEAVIKE
A0B8B9_METTP          -----------LLEKLDSVEEEISSISRKLESLDKEISRRTFLLEEKRALRGRMERYIEE
D4GT30_HALVD          -----------LNEEIRDIDDDLDDARGRASDAADRVRTIEREIEDAEEDIEEAEAEIDR
A7IAD8_METB6          -----------LEAAIKRMTEEVDGKRATRGGIDQDLARAGAVTEEYTRRFEAITIEKQT
A3CWK7_METMJ          -----------IEASIGRFAVAAEAKRAERSSIDEQVARYRMLVDEFQKRIEVLSGEKRT
B8GG37_METPE          -----------LENGISRLTAESELLRNQRSEADQRMARYRIMLEEYGHRTESLAGEQKT
E1RII6_METP4          -----------LASAVERFTAEVDESRAKRSTFDEQMSRFRMLSEEYGRMIENLEDEKNG
Q2FLH3_METHJ          -----------LSESLKADTTERDSVQSRRLELEGAIVRAKGQLESAESAKVNLLSEKDS
A2SS75_METLZ          -----------LVAAEARHRSVAEGLRAERNESDSAIVKFELKISDCNRILDKIADDEIR
D3RYW2_FERPA          -----------LNGELRKAEDAWKDAQKKIEELEEKIKEVQNVISTKKGKFEGLISRISE
O28714_ARCFU          -----------LFAELNRAESLRKQYKDEVDRLTGMISELRNRISLLDEKIRTESGRIEE
D2RFP2_ARCPA          -----------LESKLSEVELERKDLEKRIEKLNEDITSLKSKISTSGAKVDEFSKLLKD
SMC_THEAC             -----------LMDDRSRIKREMDQAFSEMSEASRRTGEIMKEQEMLKKEAERSREELKQ
Q97AI9_THEVO          -----------LQSEKAKIKKELDEALQSMSDASKKTGEIEKERQIINDDLAKNKQILKD
SMC_METVO             -----------VKDEIERLNNKINTCSTRKLELDNRLKIARDQEFKKEEITKSNNLKIKE
A6UQ42_METVS          -----------TKDEIERLNRSNATYSSRKMELESRLKVILEMENRKQIVLNSNGTRIKE
A6UVP1_META3          ----------GINKKIENLNRKINGYSIKKMEIENKLKLIKENENRKLDISKNNSKKIKE
SMC_METJA             -----------IKEEIERLSKIVKRSSAKKMEIENTLEIIKKNEMRKREIAEKNTIKIKE
C9RFQ3_METVM          -----------LKDEIDRLNEIIRKNLSKKMEIENTLEIIKKNEMRRMEILEKNSSLIKE
D5VT24_METIM          -----------IEERIEDLENRKRELERRKIRIEEKLRSIEEEERRRERIVEENRIKIKK
D3SQ87_THEAH          -----------LEEKVSTLRKEVLEKEGVIHILRRKIEELQERDKETFEKIKQLEIKLAK
D3DG53_HYDTT          -----------VERLLKTVRQELIEKEGVLKILERRLKDTEESDKMSFERIKEMEDKLRK
SMC_AQUAE             -----------IQKKIREIRNLISEKTALLKVSERKIEELSSEGLEQYE--EKFKEKLEN
B4U7R1_HYDS0          -----------LDQNIGKAKSSLIEKEGVIAINTKYIKDLENQKKDTLLQKSNILERIKS
C0QSN8_PERMH          -----------MEEELKKIAVKWQETEKELYKLQNETESVIERKREIETKIDQNLSRINI
B2V736_SULSY          -----------IENELKLINQKIAENEKNLVKLQTESQSVNSRIQELERELTNKNLRIGH
SMC_PYRFU             -----------LEGELNSLKIELRSLENASFELRIKLSDEKKELELASKDLNRLLEEENA
C5A612_THEGJ          -----------LEAAVNSLKVEVNGLRNELFELRMRRSELSKDLQVAQREMERLLAEDRA
D1CC09_THET1          ----------TLRQEEDSLTKDLSQLEQSLLREKGSEKSLEDQCKLLKERLDWVEQQIER
D3TAQ9_ACIB4          ----------RLIEEIRNIKTQDNSAQLSVWLEEKKKNQ---------EKLKDIKKQIEE
SMC_HALMS             ----KRDSLEEQRNLLSEARADHAAKKSALESKLSGMESGNTRLEILKKRKQEISKSRLD
Q6L0R1_PICTO          ----------RISAALINITKKNTALVENIKNYKSSIEETVISINEKEKKLGEIKNAINE
C1A7M6_GEMAT          ----------EAERAQQAATEGHNRAQQEARRATEVQQEVERRRERAERELAQSSALAER
C9RN51_FIBSS          ----------EDTQMLSSLVDEIREKRDSLRGGDASIRIHRNTVENCTRRLTQLNGDVTN
D1B5Z0_THEAS          -------RLSELETRVEEESKALKALEEAESRLASESREAIADLSVVRSRVEEAASEVQR
                                                                                  

SMC_FUSNN             AEKYKTSYQDRIN--------SSFSTIEETEKHIASLKKDIEADENL-------------
E3H7H1_ILYPC          EELYISEYKKQEK--------NAHGKKLEVEEVMNNLRTTIEEDNKK-------------
D1AK68_SEBTE          NKEFIEKQILKIE--------ENKKIISQIDLNIENNNKLIIETAE--------------
SMC_CLOK1             NLNELQEEEKKLK--------EYSKEEIKNDDYILKMEEELKEGRNR-------------
D8GS00_CLOLD          KEKNLEDKKKKLE--------NSLGQQNKNDSSILKIEKELEENKSN-------------
Q97IA1_CLOAB          HLEKLKVKEEENK--------ALKLREANNNNLIDELERKLKDENSK-------------
A0Q0Y7_CLONN          SFKNLKLKNSKIE--------ELNNLQEENSLKIINFENQLKTKEKE-------------
Q895M7_CLOTE          YGKDEEENKGNLL--------YLEKTQNDNEKKIHILENELKDKEES-------------
Q0SSA4_CLOPS          IVKEIEIVNEKIS--------QYENKEVTNSEKVKELDKKREELSKT-------------
A6LSM4_CLOB8          ILEKIRAKESEVQ--------VIESENTANKSKSIELEQLMKIKVQE-------------
D9SLC7_CLOC7          KQSLLNDKNESVL--------RFKNRKEQLKVFIEEEESKKQQVSKS-------------
D7APA8_THEM3          YQQEIDRFLKELE--------SLEKEKERLDALINGFKEKNNKEEEN-------------
Q8R9W7_CALS4          YRKEIEEESLKLK--------ALEVEKDKLEELVKGFSGQNSKNRDE-------------
D9TN88_THETC          YNKEIESYKDKIS--------ILSEKKSSLDRIIKEYKDNRDNNNGL-------------
C9YKI7_CLODR          TLEKSDDVRKDME--------ELDDLYNKNKEKIDALNEEIKRYNDL-------------
E3PS49_ACESD          AKITYNREKNEVE--------EYEKTLNSLKLLTNDLINKKNSISKV-------------
B0S1M4_FINM2          FNLKLDTNTSQTE--------VDDLQETDLKNQINELECDLKTINVE-------------
Q3AC59_CARHZ          LLVEKENREQQIN--------NIISLKKKLEEKIAFLEKEISRINDL-------------
E4SF58_CALK2          LECDIKSSQENLE--------NLKKSKEGLEKKISNLKTTLSKLKED-------------
SMC_RHOBA             HTELLATAKQQDG--------ELAVSIQKGKQEIETLEAQRTEVDVQ-------------
D2QWB0_PIRSD          AREEQDKTGIEVS--------AIETRLAISQQESQRLDGVIAAEEQA-------------
D5SU17_PLAL2          VETQLLHLQTSQT--------EFTEEKTRLEEQRRSQETALQKARNL-------------
SMC_KORVE             VSNEKSERENAIG--------GLRMELEAAEARHQELEAAMNAATQS-------------
C1F1T5_ACIC5          NKDARTAKQSFLE--------EKREEISRLEEQHRAAEASIAEGQAA-------------
Q01Y77_SOLUE          LRRDAERSADQRE--------RNRAAVADKEQLRAQSEEALEAQRQE-------------
SMC_MYCPA             LEAGRTQTVAEVT--------ELENRLRNAQETPQEPAAE---PVN--------------
SMC_MYCTU             QEAVRTQTLDDVI--------QLETQLRKAQETQRVQVAQ---PID--------------
SMC_MYCLE             LEARRVSILEEVV--------ELETRLHNVEQIQHVHALDENSAAA--------------
A4FMG9_SACEN          VERSREDALAKLA--------DLEERLAAVKSEQEEQAEPD--TGE--------------
C8XH72_NAKMY          AETAREQHRRAVD--------DLEARLAAVESEQ-APVEVD--TSL--------------
D7GEI0_PROFC          ANSRRAADEGELE--------ALRQRLELARSQEEVAEPD---PSR--------------
Q2J6Z3_FRACC          AETARDRAYGALT--------ELEASLAATSEQPEAGERAPDER----------------
A8L599_FRASN          AETVRDQAYGALT--------ELESQLAASSSEPDVGERSPAER----------------
C9Z3S1_STRSW          AQDALDRAVEDAE--------ELAERLAVAEEMP--VEEEPDTS----------------
D7CC86_STRBB          AEEALARATEEAE--------ELAERLIVAEEEP--GDEEPDTS----------------
B1VYX5_STRGG          AQDALERATEEAE--------ELAERLLVAEEAP--TEEEPDTS----------------
E4NHH3_KITSK          AADALAGARAAAE--------ESAARLAAAEEIADGGEDEPDPA----------------
C7QGY1_CATAD          AEEARERDLAQVE--------ELEGQLLEAQEIAAAAEELDDTLSSD-------------
A0LV82_ACIC1          AREANERDRERLA--------ELERALAAAQEADDVPEEPSAEE----------------
A0JXV4_ARTS2          AEANIAAGEEALQ--------AAVARLEAARQAPE-DEEPSAEL----------------
A1R7H8_PAEAT          AEANIAEAQLDLE--------VAAERLAAAQEAP--DEEPSTDQ----------------
A6W7T9_KINRD          VGERLATDRAELA--------DLTERFEVASAAPAEDGDVSTDE----------------
D1BJA3_SANKS          ATRTLADDEAQLV--------ELVARLDAAEADPQDTEDAIEDATR--------------
C7NGM6_KYTSD          RRTEAEADRADLE--------ALEARLEAARTQDAQAPDAADDTAE--------------
B2GFM7_KOCRD          AEERLARRAAELD--------EALRRSEAVETGDEESLEREQLEATA-------------
E1VVN2_GLUAR          LNEKFEIEQESLE--------EITERMELASTEQDD-----ETVDDA-------------
A5CQQ2_CLAM3          ASASVEEAVAAND--------AARRALDEARSRPRPVLDASG------------------
Q6AE90_LEIXX          AAERVAEAESAAE--------RAAFELAAARSRPRPILDVSA------------------
D1AB24_THECD          LEADVRAARGEVE--------RLTKALDAAAQAREQDLAAAEELAEQLAEQEAAAEAADD
D6Y659_THEBD          LEAAANAAADEVA--------RLEQAVRGAEQAREEALAAVVELEERLAEEEYAAELTEE
D7BMZ9_ARCHD          ISDDHTALRAQQK--------LLQAEYDLYAEQPDDADTNLRVFNQR-------------
D6ZIF1_MOBCV          ARAETEKRQESLK--------QAQETLDASLKVQDETGDEEPDFSAE-------------
C7R311_JONDD          LMAKHTAAHTRVT--------ELTTLLNEHLATEPEQPAAQSSKE---------------
D6ZV06_BIFLJ          TQENRNEHQLKLD--------DLNRALASARQSTAEHADFDELDER--------------
Q7ZAJ9_COREF          AEHRRDQLRAELE--------EIVDRLARIED-----DTDTTEPSTR-------------
Q8NNW5_CORGL          AETRREELREQLE--------DIVDRLSRVED-----EEDADEPSTT-------------
Q84F13_CORDP          AQDRLNQLRQLWE--------ETSDRLSRVEE-----DNSEEEPSTS-------------
Q4JUZ1_CORJK          AEQRLAKATEELD--------ELADRVARVDD-----EEHTTEPSSA-------------
C4LJD3_CORK4          AEGRIDNIHAELA--------DLADRRSRIDAEISDADDSSEESSAI-------------
D6Z8M0_SEGRD          LAQQAQDLHEAIE--------QAEAAYQQAQR------DAEELAARV-------------
C8WGU5_EGGLE          AERTVAQARPSVE--------ALEQKLAALKQELESAAARYEKAQEA-------------
C7MMZ7_CRYCD          ARAALDASRPDAA--------ALDDRIRALSVTIDEATSTINELRDQ-------------
C7N560_SLAHD          VESKLSDSDPQIA--------DAQAALAILRAERDELQSKSAESQSQ-------------
E1QVK5_OLSUV          AAQRAAAAREEIE--------LHRKAAEEAQKRAGRLAEELEEAQAE-------------
C8W740_ATOPD          AKERAQEAHTHID--------EHKRAAEEAKARMESLASELKELQDQ-------------
SMC_RHOPA             LAEAQSRLATDRA--------EAEAALENAEAQIADLEPNTEAEAR--------------
A7IGT2_XANP2          LAEARTRLASVRE--------EGEARMEEAQGELLALDTPQILEAE--------------
B8EMM7_METSB          IADAVQRLTAARD--------EGRENYALAQSGLDELEGAAEVTER--------------
B8IQU0_METNO          LAQAEARLAEEAE--------EAAARVEAAEEALAALPDAAASLAV--------------
Q92RE8_RHIME          LAETKLQIEGQAE--------EIAEEIEAAKEASAGQPDLAELDLR--------------
A7HQY9_PARL1          LAESHERLSGDNV--------EAARALEEAEIALQNLKPDEEPRAR--------------
D8JUP9_HYPDA          VTAQRARADEDLT--------NAQARHVEIEAHIVTMSAGEDLEPL--------------
E3I0B2_RHOVT          IEEARERAAYARE--------EAEAAREDAQAALEEARPVDQAEAE--------------
SMC_RHOS1             ARLAVKRYEDEAM--------EARARLREAEGVASALPDLEAARAG--------------
Q2W040_MAGSA          ATQAWTDASADHA--------QAEADLAEARGAVAAFPESSDGRDK--------------
D3P3X3_AZOS1          LVEAVERLAAEEA--------EAAARRDEALDLLASLPDPREGRER--------------
B6IR58_RHOCS          QAEAVESLEADRA--------EVEEAREEARAALAELPDPAEARHR--------------
Q2RPA2_RHORT          LGQALTRAREDGA--------EAEAVVAAQSRALAALDDSAAARAA--------------
SMC_CAUVN             LDDTIGRFEAEKV--------EADAALGEAREAHAAAQTSGDLQPQ--------------
B0T003_CAUSK          LDDTIARFEGERV--------EADAALAAVHADSAGTESAEDLAPK--------------
Q0AMJ6_MARMM          LEERLDRLTAEQA--------ENRKAIDDARALLVEAETAEGDTDA--------------
E0TC69_PARBH          LLARRNEAAARLQ--------SATQALQTAQTALDSLPDLDAAGAQ--------------
C6XRC2_HIRBI          VEDNVSRIEDALL--------QTLEEVAQAKASLSG-GPSENDTRA--------------
Q0C0X5_HYPNA          GNEALTRAENELA--------AIAEAMSFA-TPLAA-DEEAALEAA--------------
Q1GQU3_SPHAL          LARRLAEVAETAK--------DADAQLAAQEAALAALPDEAIGRAA--------------
D4YX43_SPHJU          IEERLSEARADLH--------AAQAEHDKAQAGRAAMPDGEETRAQ--------------
Q2G9S3_NOVAD          ISRTQTDLAEQRQ--------SAQAELSAAEDKRSSLPDPAAGRAA--------------
D5BSU5_PUNMI          GKERATELAANLD--------TLIADIKVCETQLAELGDETMLADQ--------------
A5FVJ2_ACICJ          AAETRARIEAEAG--------EARAALAAIEAEFATLDDAQAFRDA--------------
C5B6I7_METEA          ARDEAVRFEQEDR--------AGRAEHEEALRILSEFPPAEILRAD--------------
Q937L3_DEIRD          AEKRVTELSAQTR--------SLRSHRDELTARLERDAARLPVPTE--------------
Q1J060_DEIGD          AEKRVTELEAQVR--------SLGAHRDRLRVRLATQTLTPAEPDV--------------
L0A7J5_DEIPD          REQQLSGAEAAVA--------SAERTLDALRERL-TAVPQNASSAA--------------
D7BH70_MEISD          LRQQEQTLQAELR--------SLGANLGRLPKVSAPQAPEPVEPPE--------------
SMC_THASP             IVHLESAEREHLT--------RAELEQARAAELAELQRERLDAATEV-------------
A1K715_AZOSB          LVHLEATEREHLA--------RADLESARAAELAELQRHRLDAATEV-------------
C7RKG8_ACCPU          MAVEEESESERRF--------IAEAAIDLQSERVRELQAVMVGARAR-------------
Q3SJI0_THIDA          VAGQQAAEHAAIE--------ALETRLKDYRAQGEVAREALYAARQQ-------------
SMC_DELAS             VEAQLSDIEERRV--------AAEARFEELDMQLADSQERHAQLGDK-------------
D6CTE6_THIA3          IDVQLSELLAQQA--------ESEARFEELDARLADQQQLQADLETE-------------
SMC_BORPD             ISAHEEDLRATRE--------EAEARFEALDAELAEHQSRFADAEIA-------------
SMC_BURP1             IGAQIEEQRALRA--------ESEANFERHDAELAELQARFEDNQLA-------------
A4SYV7_POLAQ          LRQQMEQLALNQE--------QSAAELLESEESKQGLQEALSFAQEK-------------
D5CRW3_SIDLE          LADRIANEQRQME--------EIAEQMAIQREKLSSQQMESDQARQQ-------------
D9SGR3_GALCS          VAKLLLIEHAQQH--------ALLEQMAQLRYEEGCIRAQVSEARQA-------------
Q2YBB9_NITMU          IEQHAEAEASRQC--------SAEARLAEHGVRIKFLQEQVRTEQLA-------------
Q0AE88_NITEC          LAVQIEEELFQKH--------QAEMELTACEAERVVLEAQASQAEST-------------
D7DI79_METV0          TSQKLVKLKAETA--------LKEQLVTEISQGFQQLQHEKDAADKN-------------
C1D4R7_LARHH          LQEDEAHERQVID--------DAELTAEEAAMALEELDGELEEVRLA-------------
Q7NR76_CHRVO          IAEERRHAEEGIA--------EAELMGEEAALTLEELGLQLEEARLE-------------
A1KSF4_NEIMF          LAEEQTVLQHTSD--------GLSDDIVTLQEAAAELEHQQQTTAHS-------------
A1WY82_HALHL          LVEQRDAAREEQE--------EAAAAAEEAAAGAATAAERAAEVEAQ-------------
Q0AAV4_ALKEH          LREERETVVEELD--------GAQARLAEAAARAEAQAERGAALEDE-------------
SMC_XANOR             LLETLDTSREQAR--------EARAKLEDAVTLMGDLQGTREALESE-------------
B8GTL2_THISH          IEAAHQRDAEALQ--------QATNRRNEAVSRMETLAQERERLSAE-------------
Q3JAH9_NITOC          IQTHLAEDERERQ--------LAETCLQEALMDMESFAEEREQLIKQ-------------
D3RSW0_ALLVD          LERQSAESLAEME--------DTRERLHDWLDQMETLAEQRVTLEQE-------------
B3PGR0_CELJU          AREQMEQEAEHLS--------EARMILSEAIDMMEQDTDQRESLLQQ-------------
A6V7X5_PSEA7          LAEQRALEQEQLS--------EARLTLQEALDSMALDTERRETLLAE-------------
Q0VR03_ALCBS          TNEQLEQEQEQLK--------EARAVLAEALDAMETDSGEREALLTR-------------
C7RBE2_KANKD          VLQQLQDDEELLA--------KSRQQIELMVDSMADDTQRREQMTTE-------------
Q2SD45_HAHCH          IQFQIDEEQMGLQ--------ESKGVWNTALMDLEGSVEKKELLLNR-------------
E4PL89_MARAH          VSENLEGQKESLQ--------DAREDWQLALASTEDSDEEKERLLEQ-------------
E1V8E9_HALED          LEASAEETRQAIE--------ETREHWQAAMARLEEGAEKRERLERE-------------
D3SAL9_THISK          LEEETARAREQFA--------TAEQERNQALATLETLDADGEALENR-------------
SMC_METCA             LADQELELAEKRA--------EAEEALQTAERDSLRLQDVAAQRKGE-------------
SMC_COXBU             CEQQIEQCQQQLT--------LIKNKASSLDDSQGLLATRREEMIRE-------------
Q5WTI1_LEGPL          LESSLEELNAEQL--------EMADKISELEGQYQASELQFKRFINE-------------
Q12L80_SHEDO          LEQQREDSQVQLL--------ALMTLLDSQDDELQGLSKKQQELNQE-------------
Q080K7_SHEFN          LEQQIGDKKMHVD--------ALEEQVLTQEDALLQAMNQHDVAQQA-------------
A4Y804_SHEPC          SVAEISALTEQLN--------LLEEQEAELDEVLQLSLEKQLQLSQD-------------
D4ZIY3_SHEVD          LKVLLNKQQEDEV--------SVLANLDNAQSSLKQGEQAQTSLVKG-------------
B0TKB4_SHEHH          AKQERQDFQLNVE--------QRKLQHQLLNETLEQTLRAKTQGQQQ-------------
A3QFJ7_SHELP          QIGELEAVEQSLS--------ELTSRRDQDEAQLTELTRSADSQVAG-------------
A1S5R5_SHEAM          LTQQHEQSLLELE--------VADEALVQQEEALEQAAEALAQVREQ-------------
Q5QUJ9_IDILO          QRLHAENAAEQQQ--------QIEMQLEEYELLLEQTEQVDEDYGEQ-------------
E1SMV2_FERBD          LALRQEELEARQF--------ELESQQEALAEQQAQAEATLVEVEQR-------------
F2GBA5_ALTMD          QKQMLAKEEEQLS--------QLSEKLELQEAQILEHEVHIDEVNSK-------------
Q15UZ3_PSEA6          QQDILLKEQAELT--------ETTAQTEELAETLLGLEEQQNDIERQ-------------
Q3IKC0_PSET1          LVTQLAQIKGGLK--------DQTVQFETLKQQQLSLSSDLATANNK-------------
A4SKA4_AERS4          LDKEQADEAQRLA--------AALQQLELDEERLGELQEQGEPLTES-------------
D0KWM8_HALNC          MEAEHKQLSADRG--------QLEDTIRRLEQIVAQARSARDAFNAR-------------
A0A2W1K6W8_ACIFR      LDVERNALETRLH--------GLRQELAADESGWQALEQVVLDSQRR-------------
A0A0J1A050_ACIBA      LDTQLEEDAMQKD--------DLEIDLHALAMKLETILPDYKTLQFQ-------------
B3E294_GEOLS          LDEEQCLLQEEQK--------SAAIGQEAAELQARQLEQESRGITAE-------------
A1AU91_PELPD          LNEEREALEAELR--------LSQERMAEIGDSSQGLDQEVNRFKEE-------------
B9M6F0_GEODF          LDEEKILLEREIS--------DLKKAVLQGDERKSVLELELASLQQS-------------
Q39WG2_GEOMG          LREERETLEGEIV--------DADTRKAVREEKKGTLEAELERLQET-------------
B5EFS9_GEOBB          LSEEQDLVAKEIS--------QAENRRGEAEERKLALEKNVEALQGR-------------
Q3A212_PELCD          LREEGDALQRQQV--------EAEACCSRLEQARVEQETAVARCEEE-------------
A9FIZ2_SORC5          LADNLDAGGSEQQ--------AARDKLEAGRAAREAAAAGLEHAEQV-------------
D0LY52_HALO1          LDERMRGLAAEEQ--------ELTELHTTASDGIDAYEREQLGLIEA-------------
Q1D2R5_MYXXD          LTQSHQALEHEEE--------ASRGEVAHGQADREGREERVKQLVSE-------------
B4UDF6_ANASK          LEDGVAGLVREEE--------EHRVAAATAEAEQGRAEERAREAVAA-------------
Q6MNS9_BDEBA          LTEQLEVQEQKLE--------ELNEALIEARERKVLLETEVETLNSE-------------
A9A0M3_DESOH          LEGEESEMDDEIV--------AYSRSLQDARQAITDTEERIAGLNHE-------------
B8FHS3_DESAL          LMGEEDDAEEELS--------KYKGLVDEAVNEVQQAEEAVKQAAIQ-------------
E1QL74_DESB2          ALEELAQLRQEQE--------DLAAEAEELEQIGQRLEDELSQAQEA-------------
B3EFQ6_CHLL2          LDLDSAAFVPEIT--------EKENGLRLLLENIQQDQERLTGLETR-------------
A1BDT4_CHLPD          LEQEAAELIPEIH--------EHESLFNTALEMVQKAQENLAALETR-------------
A4SG64_CHLPM          CTEKLLVLLGAIT--------EESSGNEGFQEEITTLQANLSGLETR-------------
SMC_CHLTE             VLDELEKTQPETL--------RIEAEIETAQQKVNVMQEELSAGESR-------------
Q3ATI3_CHLCH          SAEKLTALMPFLI--------DATAQSEAAVTAIEQAQQALQAKEAT-------------
B4S519_PROA2          TEQELTSLLPKIK--------AIEEKNNERYTLLREAQHKIGRSEEE-------------
B3EM83_CHLPB          TEAELEKLLPEIA--------AHKETNTALHTSLENARKELEKNERN-------------
B3QRZ4_CHLT3          LEMELDAQRPQLL--------ALAEDLERENRALELAQESGRSAESE-------------
D0MFL5_RHOM4          LAAELQTLRQTLM--------EAEQTVAERQRALQEAEAALQQAEAD-------------
Q2S457_SALRD          HEDRVHELREAVE--------AAEEEMQRRRQERAEAEEALAEAEER-------------
C7PLU2_CHIPD          NQDSIKGVREELE--------ELNEKVFALQDSIVAAEKAAADAEQQ-------------
E4TVF1_MARTH          LMEEIEAIKPDAS--------KKSDKLKEIEQRLSIISEDLSVQDEI-------------
B2KBE7_ELUMP          RKNKSEELRKQLS--------EIKASQDKIKAEIDAAKSAKAKIVQD-------------
B1H0P2_ENDTX          FSRKIFGFETKLA--------NYENEEGKLYEELKTVDNGIFSVRKE-------------
E4TEW8_CALNY          DAQQLEELSKLQK--------ELEEEYDGIKSRIDYYDEKIEESKEQ-------------
D3PDY1_DEFDS          LKNDIELIANQLK--------EIDDQKDDIEEELSFYEEKYDQEKDE-------------
D4H2V6_DENA2          LKEQNKELSVSIA--------AKEEEKDAMQSKLEDIDNMYEDVRDE-------------
D6YSC9_WADCW          LNASYIEQRAKLE--------RRQELVEVLNVELQEKLERLRLQQSQ-------------
Q04TU9_LEPBJ          ----NENLTRDIK--------DSGLKIESLRESLEANKEQTVFLEKK-------------
E1R6H6_SEDSS          IDRNIEEAGTEMT--------RRREEIAALREENKNLSSKIEEYRRT-------------
Q73ML2_TREDE          VDAAILENRQSIE--------NNRTKIAALIEENNELSIKINDYRKT-------------
A0A0H3BKB7_TREPS      FERQLEQHRAQLE--------RHAARQRTLQEENKLLVGKIEACRKT-------------
E0RSK7_SPITD          IDNLLEDVTKKIQ--------SSRERIAELQTRIREVRTRNEQRRKS-------------
D5EMY0_CORAD          QNQKIEHNGRSRA--------QSEDELAKLDARHGDSVQALDQATEE-------------
B1ZZB8_OPITP          AQRNAEDIANRVE--------RMEREVAGLEQARNEAQARWQKAQAT-------------
SMC_DESHY             IEQERDELQSHKA--------LGAEEQSKLTDSIQEAQEALARQEE--------------
A4J682_DESRM          IEQEMAQWSQSEQ--------EAAAKLALLEQELEQLQRDISITQE--------------
Q67PF3_SYMTH          IEAEIAAAGESAE--------RLRRELAELAAERQGLEAEVRSLTA--------------
B0TGW8_HELMI          LQDDLASLMAEKA--------RLQDEMVAAETEAENLETAMSERQG--------------
Q2RJX0_MOOTA          LGEELARSTTDSR--------ELVTSRREREELLTRLEAREGELQG--------------
SMC_BACSU             LSESDEERKVRKR--------KLEEELSAVSEKMKQLEEDIDRLTK--------------
C5D8T7_GEOSW          DEQEAKQMTEKLA--------VIEQQLCDLEGKLKEIDRTIETLQA--------------
D5DQR5_BACMQ          FRQDQTSLSARID--------ELHTSLQGNQQQANVLEKNIEELAA--------------
B7IUK7_BACC2          FLQDRVKTQGRKE--------ALEGILTNLQADITELDSKIAALTK--------------
Q9KA07_BACHD          FTDEETRIRARLA--------ELKQLLTSAEQEASKMQQTVAEIEG--------------
Q5WFM8_BACSK          QDAEEAKTQDRFL--------EIEEAEKKAIAESMRLEEKIKRLEA--------------
Q7ZAM6_OCEIH          YAQDVDRLSTRKN--------QLTNELDTIKQQLEKIQSEIDKLTE--------------
D6XTT7_BACIE          AVAEYEDADREQE--------RLSLEIEKANERISELDQAIQELSE--------------
Q81ZN4_ENTFL          LHQFLTEYQTKKA--------TLTEQQANLTATKERLDAEMKQVEQ--------------
A0A0E0UX46_LISMM      GSEELNKLLERKE--------TLLHEQVEIAKQIEATDEEIKAMTS--------------
B1HQH6_LYSSC          VKTREEALLAQKQ--------EAEERLSALAVELIEINETVEQLSK--------------
C6D303_PAESJ          HTAEQQSMQDMAT--------EAEVRLEQLTADEARLQEAIRLAEE--------------
C0ZFN9_BREBN          YRREMEEAKRKQE--------QLQTSLTAMEQEEKELSEQIAEAEA--------------
C8WWA4_ALIAD          LAADRSQIERRKA--------EVRDLLAEAEDEVTQLTAAIAERRD--------------
D5WPA2_KYRT2          LSQEVDEQKRDME--------QARERAVQAERQAALVQEKISALEV--------------
C4L5Z7_EXISA          YERTIETATAELE--------RLTIELADTDRAQADIRSRLESLRA--------------
B1YIN0_EXIS2          LAEQAAEAKSIIA--------ASEQDMERLTNRQAELRQAIDQLKE--------------
D3R1B0_MAGIU          QSEREAKLAAVRQ--------ESLVAAEQKQKELGALQDDLAAEEE--------------
D2RLB2_ACIFV          GAENFLALQAQAK--------ELAPQVEAMENADVEGKKAAQALSD--------------
D1BLY1_VEIPT          IDIDLATTTANLK--------DQETALASLQEDHGMDGNQGALMGR--------------
A5UQ60_ROSS1          IDAGMTTLLDRLQ--------AAIAEQEELMQREDAARAQVERLHA--------------
B8G556_CHLAD          LLNDLNALTEQIT--------ALQARQATLRDEHAAAEAALAVVRE--------------
A9B100_HERA2          VQQEQARLAEQLA--------ASQTAIEQAQIHGAEHERLVVAARE--------------
D1C6T1_SPHTD          RHAGVAERLARLD--------ADRQEAERAGQEAAARRQAAAAERERL------------
D7CMX2_SYNLT          YSAEIDSLRESMK--------DVEAQYQAAADQARRLSDRVEEIKQ--------------
Q0AYV7_SYNWW          LDREAAEIERETS--------LLHQKLGDIEQENQKLMIDLENFKD--------------
SMC_LACPL             AQSEQTQLSRQVKALTYEQ--QQTQADDSYEDLVARNQQAQAANAAK-------------
Q03RT7_LACBA          AQTTLEQANRRVKAAELEI--QQAHAGETDEQADQLAEQI-VQGEAQ-------------
B2GD41_LACF3          LQDQVTAAAQTVTSLEYQTN-QQSNQQANYQSRIQEAACEAARVEQE-------------
A5VKP1_LACRD          ISSKYETLTNRVQILETQNK-QQDTQHQDYESQVQQNNEQADKVNQE-------------
Q03FW9_PEDPA          ENDRLTELQRRLKATRFELS-QIDDN----ENQQNDLPAQIANLQQE-------------
A0A249N2C3_LACRH      QAETLRQAQRQ-----LAAAQQANTAQADLSTKLADLHQAGQKIAKE-------------
Q38XR7_LACSS          LNERLTQFERQQQATDYQVQQQQQSYDADLK-RQGELQAAATEIEAQ-------------
Q1WU99_LACS1          IKIENEHQSIKLKELKESSK---YTNIEILSQNLEENKEKLHSLTKE-------------
Q04GL1_OENOB          AEDALNQAEKQFQSNQLEIN-QLEDEFSSIPKTREKLAAQVESLQEK-------------
Q03VW6_LEUMM          QQDAIKQQKRAVQAIEYELK-EVSEQQLELKNRIVEFSTKIENIEQQ-------------
A0A0U5K8Z4_LACDE      QEKEVKRLESAVQLYQAQQA-EQAAYLADLTDKEKAQKIKKEELAAL-------------
E4SKB3_LACAR          QEKEVKRLTDANNLYESRIK-ERDSRIKELKQQIEEAQTKQNELTKQ-------------
Q74IP9_LACJO          EEKEVQRLTQLNDLQQKAQL-EKKQEEAELTSRLEKEQAKKKELEEV-------------
A0A0T8KIP4_STREE      TSQQVEELETLWKLQEEE---IDRLSEGDWQADKEKCQESLATIASD-------------
A4VVL7_STRSY          AENRLAQLSAQYDLQMSQ---VSPTILTELEEAAAKEEVNVQALNEK-------------
C0MCR5_STRS7          LAEKLADSKELLELLSNR---QTVQSSERLLSEKARLEEALQLLADE-------------
A2RLZ7_LACLM          LTEQKVALEQLTNLSANQ---EATGNLLELTKENEHKVEVLAKITER-------------
B9EBB4_MACCJ          IHIKLERLQSKLETRTQYD--KERQEINQLEKDRVLIYDNIQTIEAR-------------
SMC_MYCHR             -----------------------------AEDQIHDLKIKQQTIYNE-------------
E0TKT8_MYCHH          -----------------------------AEDQIHDLKIKQQTIYNE-------------
Q4A770_MYCH7          -----------------------------FEEKIQEFKVKSNEFEQL-------------
C5J708_MYCCR          -----------------------------YNKKEQELDLIKHKNETE-------------
A5IYM7_MYCAP          -----------------------------IQIAITDDRSKHNEISNE-------------
D5E4P4_MYCCM          -----------------------------LNSLIKAQEDKILDFRSK-------------
Q6KHN4_MYCMO          -----------------------------LQNAVNEKNRALAELEQD-------------
Q98PK8_MYCPU          -----------------------------ISKEVENTSNQITNLEHK-------------
D1J8Q8_MYCHP          -----------------------------INAKISQLSNELFELEKD-------------
Q4A588_MYCS5          -----------------------------ALPSLNVYESKFEKLKTQ-------------
SMC_MYCGE             -----------------------------LENNERELKKELTELEVK-------------
SMC_MYCPN             -----------------------------LEHNEKQLRTNLTSLETK-------------
Q7NBU0_MYCGA          -----------------------------AEKNINELNKKLEFLTAD-------------
Q8EVS6_MYCPE          -----------------------------NKKTLATKENRKAEVELQ-------------
Q9PR04_UREPA          -----------------------------LNEEQIELNNLHNQTKKQ-------------
Q6F1N4_MESFL          -----------------------------LDKIFNEKQKTFNDLKEV-------------
Q6MTD2_MYCMS          -----------------------------LEQKEISKTKEITEYKTA-------------
E3GP81_9FIRM          NLETTKKRMAESDRIFKSLQDDAGSSLENEKRLRETVAQKEAELAAL-------------
SMC_HALOH             CHDRLGKNDAAKQ--------KLEDKLKALNDDFSLEKNEIENKEKR-------------
E4RL35_HALHG          LEEKISENKKTIE--------SKELQSQKLKANIAAEKEKIEELKEK-------------
D9QRN7_ACEAZ          LDKELSSLKNEKE--------DISSQLADLTDGNQDIEGIITSIEEE-------------
A8MHB7_ALKOO          IRHTKEETNIRYL--------QLENEVAKLEQEVENVKGKISDNQLE-------------
A6TRT3_ALKMQ          LIETANETDVKSN--------MIQSEIQCLEMKIENIQEKLNQMQEL-------------
A3DDY2_HUNT2          LIRQEKDTCLELS--------KYEDELSEIERDIAEKKEVVARYQEK-------------
D5X8N2_THEPJ          LDERLKEVLTQNG--------EITGKIQQLKIRHDELNKRVAESQQD-------------
D9R048_CLOSW          LEGQIREVSASQQ--------ELLSAVDMLENQNQDTVGVLERLNGQ-------------
C4Z0E6_EUBE2          IDRQIKEIDENKN--------QVSGSLSALDIQNESSRKEIENLNKQ-------------
C4Z924_AGARV          IEKQLEEIDQGKK--------DIAAQLEASKQREEQLEKENSSYSEI-------------
E0RV40_BUTPB          IEAKLKEIAEERG--------KSESALLESEELEKECSAKVEKYQKE-------------
A9KLR0_LACP7          MEEQNQELKVNME--------NLKNSLIDNERISKEKEQRIEECNQN-------------
D9S347_THEOJ          IESEIEDIDRQIL--------KVQEDISSIEEQNAKHQSRVETLQRE-------------
B2A2N3_NATTJ          KQQELSDLDSNIE--------ETESKLQELDQTRSKLEQDIKELETE-------------
A8F8R1_PSELT          YAIKSEGMRSRRE--------QIISELSDLSNQIGIYEEELKKFDEQ-------------
A5IN04_THEP1          YRAKEEGLNARRE--------KIFEEIDELKQNREDLQRSLAEYSEE-------------
C5CIS4_KOSOT          YTKKLNDSLNKRE--------ELEEEFKTLNQQKKEFEKELQTFSQE-------------
A7HMD4_FERNB          YNAKYEGNIARIE--------VLENQSKELDEKRKNLQNSVNEFSKG-------------
B7IHN5_THEAB          YSLKVQGMNERIK--------VIESEIENSNNTLKLLKKELEDSNKE-------------
SMC_THEEB             LERQQQYLSQELT--------AAETELTHLEARLPELEAELAAERLALN-----------
Q2JHS4_SYNJB          LQGSLAQRQSESH--------QIQQRLQQIQLRWDPLQQRLADLTLKLS-----------
SMC_SYNP6             LNAELQQRQQQAS--------QAQARLAALALELPAALKQLKTLRQALA-----------
B0C9C4_ACAM1          LEKQRQTYGSDLK--------GAQDRLQTLQTDLPQQETELEQLREALE-----------
Q115J3_TRIEI          GQGQLEKNNQELV--------DAHNRLMSLDQEIPAQEVQLTELRKTLA-----------
B2J925_NOSP7          TRSQLAQNSEKLA--------TAQSRLEILERELPGKENELQQLRHALA-----------
E0UKI1_GLOV7          LNRQLWQNREELQ--------QATSRLQQLTQEIPILETQLHQEQQRLA-----------
B7K4Q6_RIPO1          ISLQLATHRQELE--------IVTSQLTILEAEIPVLESQLKTEQQRLE-----------
B0JSN6_MICAN          LTRQLSGQQEEMT--------ISRQRLEILTGEIPELELSLQQEQEKLT-----------
SMC_SYNY3             INQQQINQQQKLA--------ELQQNLALLQQSLPPLEQQLASAQQQLT-----------
Q84EC7_SYNP2          SQQQQQQSQNELA--------IAETHLEDLTQTIPQLEQQLAAQQQHLA-----------
D3EQ04_ATETH          SKIKISSYQKEIE--------TLKNELASIDKKSSLLEIELLKKQQQLK-----------
SMC_GLOVI             LRVFLDSCQVGLE--------ADRQEQADLAARLGPLREQIVQVREELA-----------
A5GQT1_SYNR3          LQARLEQVSQSLS--------SDQTRLQELQASMQPLRQDLEQLEQGEA-----------
A9B9B9_PROM4          RADRLNALGKTKQ--------EYILRLGSLKQAIEPLVIALKDLEDKEK-----------
A2BNJ6_PROMS          CKSRLNKLDTANN--------LLVKELGHLKNQLKPYHDKFDQLQTIQK-----------
Q46EX0_METBF          KQADLKAIEESRT--------ELGTEMDRVTAEKADKEKVVSELEEQIS-----------
D7EAF5_METEZ          KNKELEEIEESRK--------ELKEEMDKVVADKDEKTKKENELDEKIS-----------
D1YW78_METPS          KEASIESLREDRR--------KLRDELIAAEEAISKADSEITTIGAEAG-----------
A0B8B9_METTP          RKSRLSEMERESE--------EWRSRLTVLEQEMQELESALSEKGDLRE-----------
D4GT30_HALVD          LEDRLDELQSERE--------SVDEQMSDLDDEIADLDDEIETVEAEIE-----------
A7IAD8_METB6          IEAAVARQREETS--------TSAAELSVLEGDLFKVTEGINAITAKID-----------
A3CWK7_METMJ          LEESLHEMLDAAK--------TGGEELARLEADLERITGEIAQVSAEVD-----------
B8GG37_METPE          LEETLAQMASDME--------AGVAEITGVESNLDRIGDQIVTINDEIT-----------
E1RII6_METP4          VLRRQEEIQGEVS--------GAGEKLAEIEGLVENISNEIQQIQDEYN-----------
Q2FLH3_METHJ          LQKQREAAGGGGG--------GSSLELATVEAAIEEKNQTLAGIQKAIQ-----------
A2SS75_METLZ          ASRLLEETDRDKK--------ETANQVAELETRVDALSDELEVLNQRVS-----------
D3RYW2_FERPA          IERKLKEKEDEKK--------ELKIKLSEKNEEIKRFEEEISKISSEME-----------
O28714_ARCFU          LREKISQKSREKE--------NYISSLKDYNSKLAEMEEAIGELEAEIE-----------
D2RFP2_ARCPA          IEEKLKEKRREAE--------ILNSKALEVEEEINKIEENIRCIEREVK-----------
SMC_THEAC             VMDDISSTDRAIA--------DKKRMIDENEKVIEQKTLDLHKYQEALN-----------
Q97AI9_THEVO          IASELSKLKQEIA--------ENKEEKEALEKDISDRQLDLHKYQEALN-----------
SMC_METVO             LNMLNSKIDDEIS--------ELTDEKEILSQKVQNLDNKLSEVMGQRE-----------
A6UQ42_METVS          LELENKKFSEDLY--------YLNDSKEEINRKIDEISKKISSSTSQRD-----------
A6UVP1_META3          MQLINNKLNDELD--------ELEIIQDELESKINKLEENINSAMSTRE-----------
SMC_METJA             LELKNKDILEELE--------ELNLKREEILNRINEIESKINELIERRE-----------
C9RFQ3_METVM          LTLKNEEILDEIE--------ELNLEKEEILRNIEKIEKKIDELMEKRE-----------
D5VT24_METIM          LELRNKELEEEIS--------KLR--EEEKNIDVEKLEKEIEELSKKKD-----------
D3SQ87_THEAH          GKEYMRHLVEQEE--------RLLLEKRSLEEEIPTLREKLDNLVLRRS-----------
D3DG53_HYDTT          SQEYLEVLAKERE--------GLLKEREALGQEVFYLEEKLNNLLIKKQ-----------
SMC_AQUAE             SKEYLKILEEKLL--------NVEDKLKELAEEIEYYEEKLNNLKLKEG-----------
B4U7R1_HYDS0          GEEYIEHLENKKK--------ELLEMLEPLKEEIKYIEEKLTNLELRKK-----------
C0QSN8_PERMH          LEEEIINLKKRQF--------EQENRLERTEKELSELERNISYIHKKKE-----------
B2V736_SULSY          IENEIFNLKKQSL--------ELESKIEEINKSIQNLNLMLSQVKDKKE-----------
SMC_PYRFU             VKEEIEESERKIQ--------EIEQKIENEKSELAKLRGRIQRLERKKE-----------
C5A612_THEGJ          LGEEIETAEETIK--------KLEGRIEEYRGEIAKLRGRIERLERKRE-----------
D1CC09_THET1          LQRRLNEANNKLP--------REKEQLHKLTEREKDIKARINQEREA-------------
D3TAQ9_ACIB4          LEKEKRNYEELRE--------SVRNEIEKIKSKIEDMEKEDANLRNR-------------
SMC_HALMS             MLESEDSLSKNKS--------SLDEELEELSTRFEEENAELADLKST-------------
Q6L0R1_PICTO          IEKGIQKLSFDED--------SLKLDLYKLNNEKSEIFNELKKISPE-------------
C1A7M6_GEMAT          LVSRLQELEQRMQ--------QLAQQADVLHARAGEADSDIDQAREA-------------
C9RN51_FIBSS          AQNRIEAAAQSKN---------SDAELAEAEAEVEKVEERYQTISDQ-------------
D1B5Z0_THEAS          LERDHQRLRDVIE--------DLNRRMSQEGRRVLELRAPRDPGEGE-------------
                                                                                  

SMC_FUSNN             -------LKQTISEIDSLNKQFSDTRILFLNNQSTIEQLEKDIHSKEIENVELQEEKEKN
E3H7H1_ILYPC          -------VIKLKDEIESIKNDFSDKKINYMNNKEKLKQIQRELYKEKDLYKEMEIQRNSL
D1AK68_SEBTE          -------KKEKIKDTGELTAKLNEISIESAILNEKFMNYKARYEEISSEYERLKNEKLEL
SMC_CLOK1             -------ITDLKEGLTSLKVKRAQISENILSSERELSRLDQEIKSMDIKNRSIVEEIKLS
D8GS00_CLOLD          -------IEKMKEKLLDFKVKKAQLDESILNKNRELKRLTDEIQELSVKKSRIIEQNKDC
Q97IA1_CLOAB          -------VLNLNEEIMSMKVDKAKSDEMLMSSTREIERYKVEMHNMENKKISLKNEIDDF
A0Q0Y7_CLONN          -------IADKNQGIVTLKIDKAKVDESIINLNRELQRLQEDIKAIEEEVKNLKNDINEA
Q895M7_CLOTE          -------LNKLKEGLTLKRIEKAQIEEVISNDLKELERTDTDVENLKNSLAGKYERLKAS
Q0SSA4_CLOPS          -------LSKYKDKLTNMKINKAKLQEVIEGREKEANRINSSIEEVENKLINITKYLEDI
A6LSM4_CLOB8          -------VNDSDTKLTEMKISKAKLDEAIENKKNEFLRIEKEIKDLEIKNELLNNENEEN
D9SLC7_CLOC7          -------ISERKDMLTSYKIEEAKTIEALSSKKSSFESLKYEIEEISERIKTKENEIILS
D7APA8_THEM3          -------LAILDKEITALKIEIAKIEQKLQNELHNLKDKRQEFDREKNNIVEKEKNIKEI
Q8R9W7_CALS4          -------LSIFEKQLTELKIEIAKVGEKLQNEVNNLKEKEREFKEVLKAIKEKEVQIESM
D9TN88_THETC          -------LNKLEAEITDLKIELARYEQNLQNDISKLNEKQLEYENTIKYISEIESSLNKY
C9YKI7_CLODR          -------YDKEKSEFDELNLSLVKKTEAYNSIVRDIKRISGENCELEEKNKQLEESLNYE
E3PS49_ACESD          -------FSDEDSELRNLDMENVRLNELLNSKQRELNSLNSLIEKNSKLLNDLESEIAFN
B0S1M4_FINM2          -------TEKLQEKYNSDKMNMISLKSEYSSNKRDLNIFNNQLNDAIIRKDYLEDNIKSN
Q3AC59_CARHZ          -------IYENQNYYQELTLQQVQLEKALENIFNLINEKSLQKKELFERQKVSAKKALEF
E4SF58_CALK2          -------YNFLDGKFTKAIEEKNKIEAEISILKHKLESKSYNMVEIENQKMYRSNEKVKC
SMC_RHOBA             -------LTAASEQLREVQSEAMSISVEAARSEQRVESLTIAADVARRDQSQREAANQEV
D2QWB0_PIRSD          -------REALESRREEATRRGASHRVTLARCEQKCESLRARQTQLEDDFRERSQAIEAV
D5SU17_PLAL2          -------LDQTALARRQLIEAINREQLELATQAERLAGWQKQSARLAEEVQSRLAQRDEA
SMC_KORVE             -------LDELRTARDNASHAASEARAQAAALEERHRAAASSLQRIESMVQEVSARIGKL
C1F1T5_ACIC5          -------VAELRATREGAQQDAARLSAELAGHEERRRGAEAAFGRIDRLHGDLERRLQQM
Q01Y77_SOLUE          -------MEKLEGQAATIAEEHAQTRAELAGLEERHRGERSAMGRLEQQFRETSNRRNAI
SMC_MYCPA             -------RQQIAAATDAARSAEVEARLAVRTAEERANAVRGRADSLRRAAAAEREARVRA
SMC_MYCTU             -------RQAISAAADRARGVEVEARLAVRTAEERANAVRGRADSLRRAAAAEREARVRA
SMC_MYCLE             -------RQLIVAAAEEARGVEVEALLAVRTAEERVNAVCGRANSLRRAAAAEREVRLRD
A4FMG9_SACEN          -------RDRLNAELTAVRQEEMDARLGQRTAEERARAVQGRADQLRRAARHEREARARA
C8XH72_NAKMY          -------RDELADSAAQARQREVEARLVHRSAEERANAAAGAGDSLRRAAAAERDQRRRI
D7GEI0_PROFC          -------RDELSVAARLARQTEMDARLALRTGQERARSLAGRADSLSRAAARERQSQAEA
Q2J6Z3_FRACC          --------DRLVAATSAVRAAEVEARLAVRTSEERVRGLQGRADGLIRAAANERAARAAA
A8L599_FRASN          --------DRLVAATSAVRAAEVEARLSVRTSEERARSLHGRADALMRSAANERAARAAA
C9Z3S1_STRSW          ------VRDRLAADGANARQTEMEARLQVRTHEERVKGLAGRADSLDRAARAEREARARA
D7CC86_STRBB          ------VRDRLAADGANARQTEMEARLQVRTHEERVKGLAGRADALDRGARAEREARARA
B1VYX5_STRGG          ------RRDRLAADGANARQTEMEARLQARTHEERVKALAGRADSLDRAARAEREARTRA
E4NHH3_KITSK          ------ERDRLALAASAARQAETEARLAVRTHEERVRNLAGRADQLDRAARAEREARARA
C7QGY1_CATAD          ------RRDTFAQQATAARTAEMEARLAVRTAEERARALAGRADQLDRAAQQEREARERA
A0LV82_ACIC1          -------RDRLAELVADARAEETEARLAVGTANERYRAALQRAEELSAAAQAERAARIRA
A0JXV4_ARTS2          -------RDELALAAAGARAAEMEARLSLRSAEEQLTATRNRALSLERAAAAERRAREEA
A1R7H8_PAEAT          -------RDELAAHARTARALETEARLALRTSEEQLGAISNRAASLERAAATERRAREEA
A6W7T9_KINRD          -------RDRLAEVARGLGRTETDARLALRTTEERARALAGRAEGLQRQAREELAARERA
D1BJA3_SANKS          ------ARDGAADDAAQARAAETEARLALRTSEERARALSGRAQSLERAARAEREARDQA
C7NGM6_KYTSD          -------RDRLATAAAQARAHETEARLAARTAAERLKAIAGRGDALAAQARGEVLARQDA
B2GFM7_KOCRD          ------ERNRAEGRAKAAREAETQARLALRGLEEQHRHIVSRAEAQARAARSERAARAEA
E1VVN2_GLUAR          ------GRAVLVDAAASARQQELEARLSLRSSEERAVALRSRIEGLRRTAAAERNHREVA
A5CQQ2_CLAM3          -------RDALVAEWEAAREAEIEARLQVETARERVRAEQERTVALERRLAAERAAAEEA
Q6AE90_LEIXX          -------RDTLSSELEAARETEVESRLAVETAKERVRAEQARGEALARQLEAERAAADEA
D1AB24_THECD          LGEDTTARDMLAERAQQARAAEMEARLAVRTAEERVRAIAGRAEALERGARRERQERARA
D6Y659_THEBD          VTTET--RDELAATCESARQAELEARLAVRTVEERLQGIAGRADALLRAAERERVERARL
D7BMZ9_ARCHD          -------RDLAHQATIVARSAETEARLTLRTHEERLRAIAGRADALDNTATNIEHRIAQE
D6ZIF1_MOBCV          -------LQAAIEAVSAAQTAKSDAHIAAHVARQELESLESRAASLQRNIAAEKAAAQAA
C7R311_JONDD          -------REALNGELRTVYDHETEAKVHLRALQEQRTAQQGKLASLTAAIDRERRAIEVA
D6ZV06_BIFLJ          -------ERTLERELNLTREHEVAAKIAWTEASRKGESLSRQAGLLWDNAREAAERRARI
Q7ZAJ9_COREF          ------DRDAASTALAQVRAMEMEARLALRTAEERAGQVRGRGDGLRRQAQQERQAKMRH
Q8NNW5_CORGL          ------ARDQANAELQQIRAMEMEARLAQRTAEERAGQQRGKGDSLRRQAEHERQAKIRH
Q84F13_CORDP          ------ERDKAAAALSHMRSMEVEARLSLRTAQDKAEHIRGRGDGLRRQAEYERQARARH
Q4JUZ1_CORJK          ------ERDAAALHLSQVKAMEMEARLAQRTAEERAQSTRGKAENLRRQARAEEAARKHH
C4LJD3_CORK4          ------ARDQAHEELTQVRAMETEARLALRSAEERASAIKGQAERLRRQAEHERAHRRRH
D6Z8M0_SEGRD          ------EQESVLGQQTSAALEELQARRGAAESEHAALRERAVAAKARNAELEAREQRLKA
C8WGU5_EGGLE          -------VVPLRKEAARLRDALSEAKLKAATLSERQTYTSRVVDARTRDLEAVASSDAEA
C7MMZ7_CRYCD          -------LAPVRSQADRAVANLAEAKLASATAKERTDYAARILIAREQDIKQARRAQLSL
C7N560_SLAHD          -------RAALSDDVQQASSKASESKLAFATSKERVSSLIREHGERRRDLDRARRACERA
E1QVK5_OLSUV          -------RSRVSHEESEESARLSEAKLKLATVTERRNHLAIREEELGRQVASLEKRRRQV
C8W740_ATOPD          -------HEDAIRAQGRANRELSDAKTDLTVAKERATSMVSRQAELERRLSQLDEQLVAA
SMC_RHOPA             -------LAAVRGDIDGRRRIAAQIRAEAQALAREAELADKRLQAIAAERMDWQKRKAGA
A7IGT2_XANP2          -------MARARAETAERRAAVSEARARLDAVRRDNTQRQRRLEAIIGEERSWRQRAGGA
B8EMM7_METSB          -------LELCRAGAARERAVASEARAALQAHVREAEARARRIEAIARERTSWLARSEGS
B8IQU0_METNO          -------LAAARQEAEARRQAAAEARAASLTLARAAEERRRRREAVAAEQVRWRERAARS
Q92RE8_RHIME          -------LSRRTAEVATDRAAAAEARAAHDGLARENDGRLRRLAAIAGERETWAARAASA
A7HQY9_PARL1          -------ASELRDQVASLRLELSEARAAYEGLRREAEARTRRLSTIAEESNAWQLRATNA
D8JUP9_HYPDA          -------LKTAQTEAEQARREVAEARVRVGSIERDRQIRAERIRHANADIARWKGRHESA
E3I0B2_RHOVT          -------LARLKERAAAARDVYTQAKAALDDIDRDIRARAFRLKQIGEERLRWLQRTKSA
SMC_RHOS1             -------LEDLKMAVEAARIAMMSRRSLHDELRREGEARVKRRQEVTKDLSGWKHRLETA
Q2W040_MAGSA          -------VNLLRASLAERRSVLVEARSALDGVAREGAERRRRLDALDGDAKSWRTRAEAA
D3P3X3_AZOS1          -------VNDQRAALAERRAVLTERQNALDRLTREAQARRQRLAAIQSETASWDNRSAGA
B6IR58_RHOCS          -------LAELRARLAERRAIQAERQNALDRLLRESEARQRRLAAIAQEERSWRTRLDGT
Q2RPA2_RHORT          -------VAELRATLAERRTTLLEARATRDRVAREAEGRGRRLGALAAEITSWRARRDQA
SMC_CAUVN             -------LAEARQAAAQAREAAGAARTALDVETRERAGRQRRLESLERDRADWSKRAEAA
B0T003_CAUSK          -------LAAARQAATAAREAAAAARSALDQETRETAGRARRLETLERDHADWAKRREAS
Q0AMJ6_MARMM          -------LDAARDTADTARSAAADARAALESLKREREQRRQRRMGFKRDHDAWAERCKSA
E0TC69_PARBH          -------LGRLNSERDQARQALGRLRGQRADLQRDRDSRQARLTQLIADKEGWERRAATA
C6XRC2_HIRBI          -------LEDLRADVRKLREEEREYHNSINNLEHEQSRSRARKSALERELKDWSRRADSA
Q0C0X5_HYPNA          -------LSAARNELTAARAAETESRGRLTDLTRGREQAAARRGALARDIDNWTARLGSA
Q1GQU3_SPHAL          -------LAAGEQAADRARANANSARDALAAHDRTLAALSERQAVVSAEIKSWKARAGEA
D4YX43_SPHJU          -------VAALQQGSEKARLAVSQLQADQALADRALASDRERVAAADAEARGWRARAGEA
Q2G9S3_NOVAD          -------LDAARARNDAARTSLQSASAAAASIEQQIAVGKERLAGIKGDIRAWQARAGDA
D5BSU5_PUNMI          -------ETSCRNMAEQARQTLNQAMQADTRLEEILRTADERLTSSSTEQTAWQRRLDGA
A5FVJ2_ACICJ          -------LDRARSALSESRRRDSEATQALQRLQTEADARARRLDTIIREQSDWAERARDA
C5B6I7_METEA          -------LEKARAAQQAARRTADEAKRLLDGLMAAQRGRRERGLAIVREVDAFNRRIAAA
Q937L3_DEIRD          -------DATDPAELESALWQARQQAETGRAAEREALEALALARELDTAWKTYRAAEARA
Q1J060_DEIGD          -------PLADPAALEAALLQARAVAEGHREQERTALEALALARELDGAWRAFRSARARA
L0A7J5_DEIPD          -------ELPELAPREEALAALRVAAQTAREAERASQDAFSGARELTARWNTYRAALERA
D7BH70_MEISD          -------PSG-----LEALFRERERLRQDLQEARELQMAWRRYREDLARYQEAQTRLAEL
SMC_THASP             -------LREREHAVREARALEQSAARELQEARFSERECAGKLEDIARNQQLAGEQLERV
A1K715_AZOSB          -------LREREQSLRELRTLEQAAARELQEVKFSERECAGKLDDIARNLQLAADQLDRI
C7RKG8_ACCPU          -------LEQAERALRDERDQINAEERELREAEFSQRECRNKLAELSSSRALAQQQLERI
Q3SJI0_THIDA          -------RDQADRAVFEARELQRAAERRHQEAGFALTTCSNKIRELGDALARIDQEIADD
SMC_DELAS             -------VLESERRLNESREQLRTLERQAQEATFSRRSLEARRGELSRTIETASQQARSL
D6CTE6_THIA3          -------VMAAQQALADARAQQRQLESQAAESGYAVRSLQQKRADLQREAQMALEQIARQ
SMC_BORPD             -------GEDLAAQAEAARARLRELERAAQEAEFAERGVQSRIADLQRNRQLAADQSQRA
SMC_BURP1             -------FESLDETLTNARQEARERERAATDARFAARQSANRIDELKRSIQVAHEQAERV
A4SYV7_POLAQ          -------LEMATQERDRLRESLRIAEMAAQEAAFASRSLQQRIADLQRDQSTARNQIMEI
D5CRW3_SIDLE          -------SNTQDGLLREQRDRAQKAQHELQEARFFAKTCAEKLADLEQNLKQHGETLTQL
D9SGR3_GALCS          -------AEDRQREFREQQERVRQLLLAKQEADFLQRTCADKITDAQAAIELATQALQQS
Q2YBB9_NITMU          -------RDTAEESLTGQRRLAQNASREMQEAIFHEKTCEHKIAEAENAIEGIERSVGEL
Q0AE88_NITEC          -------SQLSGQALVSQRSLVQRLLDKLREAAFSEQNCQSKVADCEQRIDMIIRNKVML
D7DI79_METV0          -------RQQTELAFNEARNQLQSLERAHQEKSFNIKLNNNNINELNNKINHLLEENTSL
C1D4R7_LARHH          -------RLDAETGLALARDKARELERQAQESRFQLASARQHVDELTRRQQDLEERLESL
Q7NR76_CHRVO          -------RLNAETRLELARNKARDAERVLHEIKLALHSAEQKVAELSRRGRELADRDEQL
A1KSF4_NEIMF          -------RQEQQGRLKQAQLALLEANRQYGLAEVAVHKLNQQKQNYRQQIAQLEQQTLDW
A1WY82_HALHL          -------QQDQREQLERAGERLREARERRYDLSGKLESARTALESVREQLRRAEEQRERY
Q0AAV4_ALKEH          -------RHALERAVDDAREQLRQCREARHEISLKLESASTARQALREGLDRLQAQHRRL
SMC_XANOR             -------RRQLTDARDQARDAARGVRDAMHALALTLESQRTQIASLSQTLERMDSQRGQL
B8GTL2_THISH          -------RDGLREKLDAARREAQARRDALHQIDLRMQSLKSTRESTAQGLSRMESQAGQF
Q3JAH9_NITOC          -------RDRLRASLNQLRGETGAAKDNLHRLEMEGHSLQTTLEATQQAVIQIRREYNEL
D3RSW0_ALLVD          -------RTRLRTQVAESRERERTCRDRAQSLRIRVESNRAAREATRQSQTRAQAQQTQL
B3PGR0_CELJU          -------RDDIRAGLDTARQRARHDKDKAHELAMRFQSVKTQLDAIRLGIGRLREQTARL
A6V7X5_PSEA7          -------RDALRERLDRIRQDARTHKDHAHQLAVRVGSLKAQHNSTQQALERLDQQSARL
Q0VR03_ALCBS          -------RDELRLSLDESRQKARQDRDRSHQLAMEVQGARTQADSLRQNLSRLEAQVQMM
C7RBE2_KANKD          -------REEKRAQLEAKRQQARQVKDEQHQLAIRVSAVKAEVNSTRAGFERVNSQIGEL
Q2SD45_HAHCH          -------RDDVRQKLDGLRTQARLDREHAHQMQLRASALSTRKESIRQALEKSDANLRRN
E4PL89_MARAH          -------RDTLRESLDRLRQEARHDRDHAHQLQLQLQTLHSQRDGLRQTIDRMQLQKERI
E1V8E9_HALED          -------RREARERLTSLRSQQRPLAEQSQRLALEHQRLTTERAGLAEQQGRSGEARQRL
D3SAL9_THISK          -------LEAARGTQGRARESVREARDAAGRARMAEQEARHRLEREQSEHTRLERQRAED
SMC_METCA             -------WLALEEAFAAAEAAEKSLHEEVRALRSRAAMLESNAALTAAHLQRLEQQHGQT
SMC_COXBU             -------RDHYRTQLIELREKAHQKRKEADELEIRLASNEDQLSLLRQTVARDQRQLKQL
Q5WTI1_LEGPL          -------KDTWNSVLVEQNKQVESVRALLHQSELEYDREVTKIQQITDRISREKERLQRT
Q12L80_SHEDO          -------WLSVSAQLRQAKAQRIEQDNIKRQHEHARQTLSTQVALQQQTLQQIALKRQEL
Q080K7_SHEFN          -------WQTSQAKLRETKVVRTDAANSVKQLQAQVQQHATQQALSEQKLKQQHEKQTEL
A4Y804_SHEPC          -------AQADLARHQALKVRLTEVERVLSTLSARLQSVSMRIAVNVEQIELQQVRVNEL
D4ZIY3_SHEVD          -------LDEQVDSVGVFKDKYQQVQQADRDLSQVCQTLTTKLALNEQSINQQRVRIEEL
B0TKB4_SHEHH          -------RALAAEKVAQLKPLRQQLDAKVTQTSLSEQGLHTQLVLIKQQVNQHEQRILEL
A3QFJ7_SHELP          -------LADRRAQHKALGRERQALALQSQQLQQSLQAINTEQALSRQQGEQLERQMKEL
A1S5R5_SHEAM          -------LIPARRMAEERRASVANIDKSVEAAKATRAELATSLALINQQMASGKEQLSKL
Q5QUJ9_IDILO          -------LESTVRAEDEQLQQLRSQQQQMTMQQQNLQAQAAQLQKLLQR--SEQRYQQLR
E1SMV2_FERBD          -------SETARGALRQRQLERDQHQQRLQQLQLTLQGQQARLQGLAARRSQANEAQAQW
F2GBA5_ALTMD          -------RESNERNTTELRARVDNLTSQNHELALKKQQLENHQNLYSQQVSRNLQQRDEY
Q15UZ3_PSEA6          -------REAFNNQLREQRHQVDNLKNQQHQHALTLKGQQAEVQNVQTIQARERAQLQNM
Q3IKC0_PSET1          -------RTHSDTNYSQVLVRLEQYKTQAHQATLAEQQSRSEWQLSQAKLSHAEQAHLSA
A4SKA4_AERS4          -------LQLAQERVTHAERAVEEARLRREQQQASCQRWQLEQQNQSQLISLREQELARL
D0KWM8_HALNC          -------QQTAEQTVQVLRRQAGEAGQALQQLERTVDRNQHQFEQAQQSLARDEAQMVQI
A0A2W1K6W8_ACIFR      -------TDTLRRRVDELRGIHGRVRGEYQTLELRQQRLQAESEAAITRAEDLQQQWDQL
A0A0J1A050_ACIBA      -------VEELTEQLEEQQQVLQQQQQEREILRRNSTQTTQQIELLEKDISFLQSQYQQI
B3E294_GEOLS          -------IEGQRLILATARETLTTQRVTVATLREQGEAHQRTRASLTAQLDEHERRIKNG
A1AU91_PELPD          -------LDACRAGLASLRERVTTIRVQVATLGEQREASLRGIDDLERQSRELVRRMTSD
B9M6F0_GEODF          -------WEARKEIIADAREAVTARKVKVASLKEKTDAINQDLLRVESLMTALKKQAGDH
Q39WG2_GEOMG          -------LTVRKREIDAAREAVTTLKVRGAQLREKKEAASRALKRTEELLSDLQARITRH
B5EFS9_GEOBB          -------LEGSRFEMEEAREMVTSLKVRVAALKEKGESTQRAYQRVEALCADLASRISSR
Q3A212_PELCD          -------LRVWRRGQEALREKVTSLKVVLAELRERQEGGRRQLQQLTVSGQDFERQLRQR
A9FIZ2_SORC5          -------AAEWRERVLGQQSVVTERKVKLARVRERAAAARGTVERLTRSCNELRGRIARL
D0LY52_HALO1          -------VTDGRERLEELTQMLTEARVRAAQMGEKRASIEAAVLRLEAGERELGQRVAKL
Q1D2R5_MYXXD          -------QESLRLRAETANGELTGLRIKVAAGSERGESARKELDSLVSQRQDMETRITRL
B4UDF6_ANASK          -------LEHTRARGDVLSAELMNLKVKAAADAERREGIGSALKRIDDTRREVDERRGRL
Q6MNS9_BDEBA          -------MNSVRLGFDGLQAEVTDLQVKSASKTQEYTGVLRQLEMVTKSLTDLEAQLARM
A9A0M3_DESOH          -------LATVSETYESLSQASMELRLKYTASHAELENTAKTLDRLKRFQTEGAARLEQI
B8FHS3_DESAL          -------VEQAEAELDGFSEKTTDLRVEISALSARLDNQKETFVRLAEFEEENQKRLEYT
E1QL74_DESB2          -------LDEAREALEDARTRESEVKLRAASRQSEADHAAQEAKRLERETAAAGQRRQSL
B3EFQ6_CHLL2          -------HHRLSHDVQACQSLHRDAELELEKLLFSLNASSQTLRAVHDDIRK-LERETAD
A1BDT4_CHLPD          -------HHQLSLELQKTQNIYRDSLLEVEKLDFRIGAAEQNRKLLLDEIKA-LASESAH
A4SG64_CHLPM          -------HHELGKEVQQRQSSYRDALQELDKLRIAIENCRIARTALHEEITT-LHTEAAS
SMC_CHLTE             -------SRALHAELQAQQGRYRDAQLDLEKHRFRASACQQTIVTLSDEIEG-MQHQIAR
Q3ATI3_CHLCH          -------YHQVGRDAQSCQSRYRDAELALEKLTISLNACTEQQRTTQHELRR-LHDDLAT
B4S519_PROA2          -------HKRLSKEVQNRQNSYREAQLELDKIRYKITSGLHNIASFAEESDV-MQQEIST
B3EM83_CHLPB          -------LSLHSQEVQRHVNKHKDSVLELEKLRLRIQSCEQNRSSLEREIEK-MQKETEQ
B3QRZ4_CHLT3          -------LVRSRDAMQERHLKQKDAEFALEKARTELWRNDQDSRNAARQQER-LTDEIAA
D0MFL5_RHOM4          -------YRATMEQLNQVQLQAAETRNRLDNLRREQQQLRQRLEGLQRRQQE-RAQQQKQ
Q2S457_SALRD          -------ERAAVDAFSEAQVAAVEARNRVDNLEQDLERTRDQIDEIDQQTGE-RTAKIED
C7PLU2_CHIPD          -------FNQANVQFNNQNLQHTRQQSKVQALRQELDFKRKQLSDLHTQITS-NKSQLED
E4TVF1_MARTH          -------LSQKSSAFNQENIEFHQQQNRVNSLEQEISYKQTAFESSKDRLEK-NQLELKE
B2KBE7_ELUMP          -------GEGLRTEISRVNADLYEVKLKKNNIEVDLRSTEFEYNNIIEADKK-RQDQITA
B1H0P2_ENDTX          -------EELIAPLMMSARSSWDKKAAELENMRRGQQYILDNISNIKQQIVY-AENRIRE
E4TEW8_CALNY          -------LSDLKVEYSTQLEKLNSSRKEQVHIDKEITSATTKMHHLKDRLTRLMTVDINN
D3PDY1_DEFDS          -------FTELMIENKRLEESLNAKKREQIYVEKDLNSLITQLKHKQERLTKLLTVDVTN
D4H2V6_DENA2          -------LSAYRVEMRGIQEKMNAVTNELHFIDRDLDESSTKLTAAKNRLSKLVTSDIVT
D6YSC9_WADCW          -------MEEKESVYQKAAVEKRNIEHQLNLLEVKNLESLQREKRLEEEILSIQEKKAGI
Q04TU9_LEPBJ          -------VLELG-------SERNSRLEAGKAIQLRKEEIEKRIQTAKDSIQNVISKKREF
E1R6H6_SEDSS          -------LEELRISRAQMDTQKEAMKESLAGLKRELNDLEKQLAAAEAEAQR-CKLNIEE
Q73ML2_TREDE          -------LEDLRVNRAKVDAQAKNAEDQVKLLERQLSSEKKILHDLENEFFT-EEKQLKQ
A0A0H3BKB7_TREPS      -------LESLRVDQARLRAEAEAGQKQAAGTRGEVARQRAVIKELEGELFT-EGERVAA
E0RSK7_SPITD          -------LEDLRLTSTRIATQAEALRETVNALLRDKEETLSLINQIQKEVDL-SNRRLDT
D5EMY0_CORAD          -------LAAAEQGLADERQTGSDLEDAIAHAREIRDQKREALSDVRLELAE-KKQRLES
B1ZZB8_OPITP          -------LTTAEAEAAAQREKIQQAEVRLNELRADRDVKRESLAQARLELAE-RRQKVEV
SMC_DESHY             ------KNRQASREMEQLQERLTQTKVQAAKWEQELKQAVERLAQDQALLGENKHLLERK
A4J682_DESRM          ------ELAKAREKKADMENNLYQEKVRQAELRQEMLGVQKIINRLEKEIEERKISLASS
Q67PF3_SYMTH          ------EGQQREESLGQRRRAVTDLQVRLAGLHEQLRSLQAQRRRAEADREALDRERLGR
B0TGW8_HELMI          ------ELERLRAAGEDDREDLTRWQLALARQEEEIRGIDQSLAALHTEIGKSEKE-IGE
Q2RJX0_MOOTA          ------ELTGCQEQLNACQQALAAVEQELAVNETRQQALAKAGEQLAARVEELARQKENW
SMC_BACSU             ------QKQTQSSTKESLSNELTELKIAAAKKEQACKGEEDNLARLKKELTETELALKEA
C5D8T7_GEOSW          ------QKQTEQTSKEALQTAMTEQKIALAETQQRLKNVQEKVEQFHNELADTEKQLQAS
D5DQR5_BACMQ          ------RKHTQQTSKETVQHELTEVKVLLAKKEQFLANQQEKYERVCFELDQTIQRLSET
B7IUK7_BACC2          ------QKSEQHSSKEKVQKEMTELKVLVAEKQQRLSNQKEKVERFTKEKEETDATLVKT
Q9KA07_BACHD          ------RLKQSQSSKEERQSQLTELKIQLATAKERYGNIEEQRARIAEQLAEEKEKLRER
Q5WFM8_BACSK          ------RLASEQQSKEEWQAKLTELRVARAETKQQLQYVDAQRQELTAALEKEQQELLQA
Q7ZAM6_OCEIH          ------EESLWKENREKLQDEYHHLQVQLAEQEERLKHQQLKTKELQNQYAEAIERKDDQ
D6XTT7_BACIE          ------SLKDKQVQEKTYQDKRNDLKIELASARENLRFTGETEARLTGEADDVKRSMDQR
Q81ZN4_ENTFL          ------EASQMETFKAQAQERLTTVQAEQAVAAEQCAHFARQKQDKQEQLDELLIRETAI
A0A0E0UX46_LISMM      ------SSKALESKRAADLESLSSLKAQIAAKREQLQSATEAVERVTTTLHENYEQKEAA
B1HQH6_LYSSC          ------VKLQSETEKDVLREQLAEKRSQLAVMQEQMSQVQIATADLALQLNKAQQKVENI
C6D303_PAESJ          ------RRKASETAKEELQVQLTDLKISVAKTDQEKQSFEDQAARVRADIQRAKQELASY
C0ZFN9_BREBN          ------KRQEQLESKEEMNQKITSLKVLNAQVKQEYQSRLEQTERLLEQKTQLQHEWEEQ
C8WWA4_ALIAD          ------RLAALESELAEAKERLTGLRIEVATLEQERENLAQ----RMAELRERKARLERV
D5WPA2_KYRT2          ------ERRAMEGQLEERRAIITELKVQLASLRERRAYGVQQREAKVSELRELERQIAAL
C4L5Z7_EXISA          ------EQAKSAESTGQLESMLRQNELDLQRHTLEEERVRYELDRLTTEQNRLQERSDQM
B1YIN0_EXIS2          ------AQSRGAVAVEELKQQQAEALLEERTVSMTHDQIDREVTRLRETLSHAKLERSHK
D3R1B0_MAGIU          ------KYQVATADQSEKRQLKQQLKLEEQRLDEIVRQAEAWLARLQNQENERETAKLKL
D2RLB2_ACIFV          ------GLVEQRTLLEGATRRHQDALIAVNAGQSQLEALNARIQSIDQLGEKTQQEITRG
D1BLY1_VEIPT          ------LTVLQKVQQEAYEAFTEARLTCDTLRHTIQERESQREQRNQSISSIIERLTPLR
A5UQ60_ROSS1          ------EEAVQRSADAADDEILAHLRTRLADAEGDVRTARAILHTVHQALARIDEQRAAL
B8G556_CHLAD          ------RYEQHVLVSRTVQERLANQRAALTAARSRQQMLTELRNRHEQTIAGIEQQQREL
A9B100_HERA2          ------QAETAAAASRASEERVAAARAAIVSSDATLQATQRAQRDQQQVIDGLVRRSRED
D1C6T1_SPHTD          ------LAALREAETAGPDARLQDERSALAGLVERRRGLIAQQQRLESEQQRVAAAIAEA
D7CMX2_SYNLT          ------GHEEMLREYEVLKERTKSYREFVAGKEHEIESLKQNLVQLEKIKASYLQALDKC
Q0AYV7_SYNWW          ------KMEVKRRDYEVFRERLLSYKKQLDMKGRELENIKKNLSQFEELRASYQQSRDDS
SMC_LACPL             -------LKDYQDQMKTVQQQQTDYESYQQTQTTKLQAQREQLITLQEHVKQTQRQLEQC
Q03RT7_LACBA          -------ITETEAAVKTLQAKIKQVTTAQAQQQSELTAKQTWLAGAKERQQQQRATVKQL
B2GD41_LACF3          -------LAEVKERTSRAQEQLTALQSNAASQNEQVHELSQWLAVEKTRLEQDESHRSEL
A5VKP1_LACRD          -------LTQVVAKIKQILTQIDELQNDESTQARQLAQMQQKIAVAEERLQQYQRQSQEY
Q03FW9_PEDPA          -------VQQIKENTTAKQDELALLDDDVDERQNRISELRIELARLKEQTSQHQHEVNTL
A0A249N2C3_LACRH      -------IADAQAKIDQLKEAAVAAADSSSKQAAAVNGLKTKLAVIANDLQTLHDQQQQW
Q38XR7_LACSS          -------LTQLKADLDAANEQLQHFDQSQEQIRQQQTALETKLAVAQSEQKNVQEKLTDA
Q1WU99_LACS1          -------IDSLEQLITQKAKAEEHNSYSIEKQREEISSYKQREAVIIEQLRGLKLQLQEL
Q04GL1_OENOB          -------NDQLSSEINTLEVSLLDARSSAKQQNSRLLTSRENLAAIKVQIQADSKQAGEL
Q03VW6_LEUMM          -------KLDQEQLTAKLAHDLETASIKSQSTNEEKATLQTQFATVGAQLDSINGQLSLL
A0A0U5K8Z4_LACDE      -------ADQQKRDLASLQETIQNYTDLNQGVQEKLAELDPQLAVLANKQENLQARKAEL
E4SKB3_LACAR          -------GKEQRTAMNQLQERIRNFNSLSQKVQDQLSKLDPDIAVYTNKLENLRSQENEK
Q74IP9_LACJO          -------AQTQRAKMDQLKTDLTDFDEAYQKLQAELSNLNSDLAVVKNKLENITTKKSEL
A0A0T8KIP4_STREE      -------KQNLEAEIEEIKSNKNAIQERYQNLQEEVAQARLLKTKLQGQKRYEVADIERL
A4VVL7_STRSY          -------KLALDQQINQVRDNRDSIQESLQKLQTQKGQLTLEQAELTSQLRFEQTDLRRL
C0MCR5_STRS7          -------KSALTSEIEQIKENKDTIKQKKDQLSQELSQARLKERDLLNEKKFEAANQRRL
A2RLZ7_LACLM          -------KAEIEKQLEEVKTNSQAHKALQSEKISALNQAQLRQSEVASELKFTKADEKRL
B9EBB4_MACCJ          -------LSELTDKIKLYQNNAQNKKSLLENMQHEMQGIHKSINKLEADIHYYQKVKRDL
SMC_MYCHR             -------IETVNSTIQQVKIEANSINSKLNILNEELNNLKLNASEIFKEQQEDQE---SL
E0TKT8_MYCHH          -------IETVNSTIQQVKIEANSINSKLNILNEELNNLKLNASEIFKEQQEDQE---SL
Q4A770_MYCH7          -------ITRESVFLQQININLNDLEQKFSNSENELIEIKAQNEGLEESLNQKDDLNLSL
C5J708_MYCCR          -------ISELATNINNLDIKLSNLNFSLSELKDKLYKIQIENKEYLNIQSQHNDSDSII
A5IYM7_MYCAP          -------RRICLELESQLKNQLANIITQKSAEQKILDELNLKLKNISN-KELEIKTESIS
D5E4P4_MYCCM          -------RSNIYQYNSEIQKELSALIEKRVNTQNKFAELQSKFASLSK-EELKFDNES--
Q6KHN4_MYCMO          -------KNIDFNLIQEYNRNLIKSKEQLFYLRDAFEKLKTQYESTTN-KKIDLESTI--
Q98PK8_MYCPU          -------KYELTNVVSEFSVEAAKVYEKLSNDQKSFDSLTAEYQTISA-KDLGESSSS--
D1J8Q8_MYCHP          -------QNKETSLLTNISLERAKIDNLYRTTLDKFDSLREQYRSASQ-EEYEAENNK--
Q4A588_MYCS5          -------IQNISNLISVKKLELSSENESISATENELKQYQMFLDDSIDTSLSGESE----
SMC_MYCGE             -------LDEMNRKLKYEELLQAKFIERIVQIKKIILELKMEYEQLTNTTFDGK--KAVA
SMC_MYCPN             -------LNELNKKLKYEEILLEKFNERVNHTNKAILSYKIEYEQLTNESFDGT--PHSF
Q7NBU0_MYCGA          -------YTKKDKEFNEQKIAIQRYQDLIVIEQKKLDDYKIQYEQLTDKTFDGK--DVKW
Q8EVS6_MYCPE          -------IIDLDSKVRERKINLGIYFSSEKTLSEEIVKLKTEYQKSTKKNFGDSEANLAK
Q9PR04_UREPA          -------WQEYYNSEQIINGILNNLITTNNSLSDNLNNYKSQYEALSATKLSKE--EIES
Q6F1N4_MESFL          -------REKLIDDINQASSNIRIGKNSINILNSSLVELSDNYKIITGKDLLNNQTTSSF
Q6MTD2_MYCMS          -------NDSLRDQINDLNGTIRNAKNNLFNWTENLKEFSDEHKSLTGRDLFTGVYSKS-
E3GP81_9FIRM          -------EAEMEQDDTGSAEYIEVVRGAIEGLNRKISEGRIKLARDNEGIRSLEQQMAMI
SMC_HALOH             -------VEELEARHENINDEITRLKINLAQLNEKRESLRKEEEKSNKELIEL-AEKNEE
E4RL35_HALHG          -------ITLKSAELEELRPELKELELDGARISEKRENAREKLEEKESKLSEL-ENELKE
D9QRN7_ACEAZ          -------IERIEAKKEEYNEEITDIKVKIASIEQEKNNLKQEADRLQDQIQKA-ESGISN
A8MHB7_ALKOO          -------LVDKKQELDRISNILTGHKVKLATSEEQKKSSLVEIQRLQNSIKNN-EDMILN
A6TRT3_ALKMQ          -------MHGEKQKVEAISSEITERKVKYASIEEQKKSVLQEIETVQDVIRVS-EEGLVE
A3DDY2_HUNT2          -------NKEEQSVRDALHNDITDYRISVNSILESMEGVKETLERLVNEKNSL-VKAMER
D5X8N2_THEPJ          -------FASLEVHRNEVTGKVTAKKIELARLRQEEISCRQTLDRVRQEIDEL-AGQIRV
D9R048_CLOSW          -------LEKARTDREQYSRNLSSIQLKASGLKQKDDFELENIRRIKEEIHRL-EEELTG
C4Z0E6_EUBE2          -------LEAKKAELDKANDDIENLKIRFSSVEQKTAFIQENIIRINSEIAAL-ESEEAD
C4Z924_AGARV          -------LEKQGVLEQEASHKAAAISLELANITKTAEFAIENINRINSEIEKF-DEQKES
E0RV40_BUTPB          -------LEGLHEIEETENEKVAKWDIEYEKIAQKQEFAQLNIDRITDDIENE-QKALDE
A9KLR0_LACP7          -------LAKERATKQGSMDEASSILVESSNLEQSIQYVLENMRRVRRDIETL-ELEEQE
D9S347_THEOJ          -------IAESKKSKDELETEINDLRAVLNSLRQQELGLKYQIQNLEQNKEEW-QKEKRE
B2A2N3_NATTJ          -------FKQTSDEYKKLNEQKLTFEVNVGKLDERLKNISEDRQETYEKTRYYREEKLPQ
A8F8R1_PSELT          -------LSHERNILEEISTQFSELKAELTNLLERRVHYESELRKLKDEKQKLSEESTQL
A5IN04_THEP1          -------LEKEKRILDELNEKIFTLRAEVGNLLETKDRYEKEMRDTRKTIERIARETEDI
C5CIS4_KOSOT          -------LKEEKKKLEEIQNQIVDRKLKLSGLYEKQEQYTKELSAISQKKRENSEAIIVL
A7HMD4_FERNB          -------LDEHRKKLEQLNESIATYRAEVKNLFERKLQYNAESDRINSRIEEIKDELINA
B7IHN5_THEAB          -------MFEDKEKLEEINEKYMELQSEIRTLHERKLQYEGEITRALKRKDEIEVEISTF
SMC_THEEB             ----ALEASPSHQQWQQVQAQLQAQEKIHASQVAALQAVDQALGDRHRQLEQL-ERDLKQ
Q2JHS4_SYNJB          ----QLEGSPVNQHWQQLQQTVQQQESRLAELQQQLTQLERQQQENSGQQHLK-QAQIQH
SMC_SYNP6             ----ELEDSPIHGEWQQRQTLLQQQEALLQQQETALRQAEQQLQQLQTDQKRL-QERAIA
B0C9C4_ACAM1          ----ELEQSQTHGEWKTLQNQIQGQESIVAGREQALREVQQHIQELTSQQERL-QEKQEQ
Q115J3_TRIEI          ----ELEKSHTHSEWQQLQTMIRSQEVVLQEQEATLRSAEQKLQHLENQQRLL-QEKVEA
B2J925_NOSP7          ----ELEASQTPSEWQQIQATIKIQEQHLQQRETALREAEQRLKNLENQQQRL-QEKIQE
E0UKI1_GLOV7          ----ELEASQTHSQWLEIQAEIKATEVQLQQQEQAVRQAEENAKDLQTKTQRL-EEKILE
B7K4Q6_RIPO1          ----ELEQSQTNSEWQEIQTLIKTQENSLQEREQELRKEEERLKDLDNQCQRF-REKITE
B0JSN6_MICAN          ----ALEANHTHSEWQQVQGIIRSQELQLKTQENHLATVREQLKDLQSQQIRL-EEKSQE
SMC_SYNY3             ----ALETSQTHQQWQTIQIQIRTVEAEYQRQLQALRQGEDHLKDLQNSSQRL-EEKIAQ
Q84EC7_SYNP2          ----RLEAQQTHREWQEIQQEIKAQEVTLQAAAQTLNSTQQTIQDRDAQLIRL-SEKLTN
D3EQ04_ATETH          ----NIEKSHSHSEWQEVQVLIKDQENHLQDREIELRRGEEKFQDIKNQIAGI-EYKIHE
SMC_GLOVI             ----KLEQSDNHHRWQQSQQHLRELETEVRRWELQLRHAEADLQKSHLDEQLA-QEKRQN
A5GQT1_SYNR3          ----ASSDSADAARWGELQQELEQADAALSAARAQRDGLEAAQRDRGLVLARL-NSQLEA
A9B9B9_PROM4          ----LVKSDEHSENWRKLQDDLEAADAMLVEARAERDDLLNDKRQRELVLDRL-EDQKNS
A2BNJ6_PROMS          ----ANYEKNQKSSLIAFNDDFNNLDKKLELLIKERNTLLDKKNQFALNKERI-NNSLKI
Q46EX0_METBF          ----GLEAKLADSPLPEINKKIEFVDEELRRLDGRIRDTEATLNALKLEKEYA-EQKIAE
D7EAF5_METEZ          ----ELEEELADSEIPELNEKADNLNEEIQRLEGRIRDTDSNINSLNLDLEYA-NKRISD
D1YW78_METPS          ----KLEEELKGSEVPALTEESGRIEDEMKRLDGRLRDTESAIASLKIEQNYV-RARVEE
A0B8B9_METTP          ----KLERDMQGSRIPEMMERAEQLEGEIRRLESRIMDLDSEIMRCRLKEENL-RNRLDE
D4GT30_HALVD          ----DIEAELADSEIPELTARADDIRADIDDLEDRMSTLDGRLNEIQLEKQYA-EDAVDD
A7IAD8_METB6          ----GIKKKLDDTNIPALTDQMEKKKKEIEEAERRLRNKEADMNDASRERQHF-TARIGE
A3CWK7_METMJ          ----DLKKKLDDTEVPVLTERYESIRKAVEDIERRLRNKDADITDAKRERQHF-ANRIEE
B8GG37_METPE          ----GLKKRLEGTEIPELTEQLEKQRKELEETERRLRNKESDLADLQRERAYF-IKRVEE
E1RII6_METP4          ----QLRKRHDDTDLPALTESYEQLKKRYEEADRRLRNKDSDISDLQRERQHF-QKRVEE
Q2FLH3_METHJ          ----DITDHLSETGIPQLYEQREEAERQITEIQRRLHNKEQEINEIRLEIGFA-QKKVEE
A2SS75_METLZ          ----ELRSVLNEDEFNLLTDKLQKAQSSYNDTSRRYENKVNDLSGLNLERQHF-KQNVEQ
D3RYW2_FERPA          ----KIEKQLRGSEVPKLTEELEKLKSEYEVRAETLRRIETQAEKLTFVLSEK-NNSVKE
O28714_ARCFU          ----EIERMLRGSEVPKIVEELDKIKEEHQRNREILISIEKKIESLEFKREQL-ESSMQE
D2RFP2_ARCPA          ----ELESKLKDDRIVKLNTKIEEIRGEIERLKDLKSVLSSKQSSLVAKREQL-IKAIEE
SMC_THEAC             ----DLYDRID----PEFFKNIGDLSNEINEVRSEIDAVASELNQITSRRDIL-SSERKH
Q97AI9_THEVO          ----DIYDDLG----QSIIDTIENSMRKLEDYRKKISAITADIEVKEKRVSFL-DKESNN
SMC_METVO             ----RIVNEIKSYENSELSKRIKEIDHKIRENESSKNTLENEIKKGAILVKEVLIPKISE
A6UQ42_METVS          ----RVSEEIRSFENSEYSKRIRRLEENIIVFEKKKNELENEIKRDVILIKEVLIPKISE
A6UVP1_META3          ----RILKELKSYEDSSMIKRIREIESKIEKLTKEKDTTENDTKRNAVLIKEVLIPKISE
SMC_METJA             ----KIINELKEYESDENLKRMNEIEGELKILEKEKAKLKNEIDKGLTLVKEILIPKIEE
C9RFQ3_METVM          ----NVIKELRKYESDENLKRIKEIEEEITKLEKQKIGLKNEIEKGLTLIKEILIPKTEE
D5VT24_METIM          ----EINKRIEELGVQEKINKLKEIEKKIVELNNEKLGLEKEIEKCKSLNK-LLLERIKE
D3SQ87_THEAH          ----DILQHYRSSGIEELRQHYERERKRIERKREEIFSLKLKLQQLEAEIQTL-EKEIGL
D3DG53_HYDTT          ----SILEHYRESGIESLRESYERELKNLDKLKEHLFSLNMKLKDVQKDLQNL-QMEIKR
SMC_AQUAE             ----DIKRHYSREGVEEKRREYSKVRKQVSEIEKSLNEIERELNKKTYELEYL-EKEIQE
B4U7R1_HYDS0          ----DILSYYTSKEIKELKDTIEYYKKLHLDKTKELNTIELKKNDISKNIEYV-KSSVDQ
C0QSN8_PERMH          ----DILQRMESEGLHQLRKEWEEATKNVYSLREKKNEIENEIEKLTDRLENNLKVRIFQ
B2V736_SULSY          ----KMLSRMESMGLNKLRKEWEETTQKVYSLRDKKKELENQIEKLKSKVESH-KIRVFQ
SMC_PYRFU             ----KLKKALENPEARELMEKIRIIDGEISSLKEELSRIESRIESLESRLNEELLPRKAS
C5A612_THEGJ          ----KLKRALENPEARELNAKIREVEGQIAKLKEELSRVESKLESLDSRINEELLPRKAD
D1CC09_THET1          -------LGEYESSISEMEANLLRLSSSLETLDRELVKTTHNLHENKARITKIDSEVASR
D3TAQ9_ACIB4          ---------MNNLIPEKLSNEIKELRNMVDSLRSNLQNVEKDIVKVEGEINGLKEKEDEI
SMC_HALMS             -------YETEREAYMEKQVEINTFKERVSGIQSQIEDINSQMDKQTARIASNKELIEKY
Q6L0R1_PICTO          ----------DLEIEKSMQKNLDELNNEYNNAKNEISILMNDIDHLNERINDLKSRISSY
C1A7M6_GEMAT          -------LSIAEREQEQAREARATWQVAQAQAQARLSVAIDREKRLSEEDSTAAARLESL
C9RN51_FIBSS          -------LGENETMLREKEEDVRELERSAQDKTSRLKQNQNRVVAIADQMEFLDNTIRNR
D1B5Z0_THEAS          ------DLEELKSQLESLREAHREASMRLALGEERLSGARALVDRMAAEMDRLKGRLAQL
                                                                                  

SMC_FUSNN             SKIVIELSHNIEELETLEEE--------------LQSQIEEHTKIYNSENRDIETLNERE
E3H7H1_ILYPC          SERVEKLYKGKEELSEKLDY--------------LEKSFENENLRYEKEFLDIKSKKNRY
D1AK68_SEBTE          DSFFSENRNLKEELSVKNKE--------------ILDTINKKDKENSKLLEEIKELELEI
SMC_CLOK1             EKIIHKNELNMYSNEKEVKD--------------LKQYMEKLQESIEKSHVKTIELKQKI
D8GS00_CLOLD          ENNIHNQELKVNENKEKIQV--------------LKKSIEILKNNIEENDKELIKLKDSV
Q97IA1_CLOAB          ENQVKILKNKIEYNNGKVVQ--------------IKQVIEELENSFKDSEVERSKLKGNI
A0Q0Y7_CLONN          DKEIGDSLRKISCNKNQILN--------------IEETILKFEEKFKDIEIRRIKIKEEI
Q895M7_CLOTE          KIKLQEYIENLDSNKGLTEE--------------VEKKLTLIEETFKEEEIQLLKLKEDK
Q0SSA4_CLOPS          KTNKEESKKEIVLCEKFIKE--------------EEVNIITLEENFKSFELKKGKLKENI
A6LSM4_CLOB8          KKNIESLNLDIKAKNKNIEE--------------NNINISNLEVNFKDDEILKEKLKQEF
D9SLC7_CLOC7          KSAIEAMKEKIKNNNNILES--------------INSYIISKNKFFEEIEGKKLGFRERQ
D7APA8_THEM3          ESLKVNLSLDREKLQGEIYK--------------LQQEVEKIQKDISSLEDNIFQEEEDL
Q8R9W7_CALS4          KRSIEKLQIEMEESEKALKS--------------LTVEVEKSREYLSSLEEKLFEEEKGA
D9TN88_THETC          ESYKITYEEAKQKSIEENVA--------------LNDKLKLTSNKIQKLEDMLNQKVDKN
C9YKI7_CLODR          EHEIIKLQDSIATEEKEKEN--------------LTKQLGDSNRNLETRKIAKDDLKNSF
E3PS49_ACESD          EKLKNQMIDDNASLDEEVNK--------------LSEQIIIVKDKIYVCSNQEDTVKKAL
B0S1M4_FINM2          SIKIDEINKNISQYTINRND--------------IESKTVDYDDVISKLNSEILDMKSSL
Q3AC59_CARHZ          KNKILNLKKDFLTLERKIAA--------------HGDLLSVSKKYFETVKNKHEELKDKL
E4SF58_CALK2          EENIKEIEGQIFQTSEEIEE--------------KKQKAEEFKNNLQRLEKDYSELSDRY
SMC_RHOBA             RDAMTRTRERITEIETRILE--------------ADNRLAELMIAMESADAKLQVLAAEA
D2QWB0_PIRSD          RLQLASAVARAQAADLAWLA--------------TGQQLAHLYLAKQETAAELRTFEARH
D5SU17_PLAL2          ERRVQEALATRSELTLQMLN--------------ASALTDESMIEIESLAITSSRLEHQK
SMC_KORVE             KGQVESAAAEKQQRESENET--------------IAEQLVTWTAEREAAEARDRELQTES
C1F1T5_ACIC5          EQQMAAAAAEQQQRQQENEQ--------------LAVRREELSNTRTEAMKQVAELTQQA
Q01Y77_SOLUE          APEISRLGEQRSRLLADNIE--------------LDQRAAELAAQITALDTQVNEMATQD
SMC_MYCPA             QQAREARL-RAAAVAAAVAD-------------SGRLLATRLNAVVAAASRIRDALAAER
SMC_MYCTU             QQARAARL-HAAAVAAAVAD-------------CGRLLAGRLHRAVDGASQLRDASAAQR
SMC_MYCLE             QQAHAARI-RAAAVAAAVTD-------------CGQLLASRLTQAVDLAARHRDALATER
A4FMG9_SACEN          EAARRARE-RGARVAKAVVE-------------GSEKALERIAASLRTATQERDTAQAQQ
C8XH72_NAKMY          AAANQRRV-LQAAVATRVAE-------------LGERVAQRLSVSLAEAAAEKDTCAQRR
D7GEI0_PROFC          AARRERVR-REAAVAGAVHE-------------AAQWLAARVEELTVAAQSERDEAERAR
Q2J6Z3_FRACC          ARRHEVRE-RQAAVATAMGD-------------AAQVALDRLDHSLARAAAGREEADALR
A8L599_FRASN          ARRREVRE-RQSATAAALAD-------------AAGVALEALERSLAAAATERETAETAR
C9Z3S1_STRSW          EQRRARLR-HEAAVAEAVAS-------------GARQLLGHVEVSQARAEEERTAADAAK
D7CC86_STRBB          EQRRARLR-HEATVASAVAS-------------GTRQLLAHVEVSLVRAEEERDAAERAK
B1VYX5_STRGG          ERRRARLR-YEAEVASAVAS-------------GARQLLAHVEVSLVRADRERTAAEAAK
E4NHH3_KITSK          AERRDRAR-REGATAGAVAT-------------GARHLLGRIEETLAAAETERAAVEADR
C7QGY1_CATAD          IERAERLA-EEAEVARAVAH-------------GFEQVIRHLEQSLALAQERREAAERAR
A0LV82_ACIC1          ARQREVRR-REAVVAAAVAQ-------------ASRVILRRLERSLTEADAERRVADDDR
A0JXV4_ARTS2          AQRARRRR-LQARRAAAVSA-------------AVEQVIGFMDVSVELARHSRDLAEEER
A1R7H8_PAEAT          ARRAQRRR-AQANRAAAVAS-------------AVEQTLRFIDISVDLAGYDRDLAEQKR
A6W7T9_KINRD          AARRARRA-EQVRVATRVRE-------------GAAVALAAWETSAAQAATLRRAAEAAR
D1BJA3_SANKS          ERREVARR-RQVVVAEAVRD-------------GAASAARYCDVSIGLATVRRDEAEADR
C7NGM6_KYTSD          ARRAGQRR-RAAEHARGIAE-------------RAEALVGRLEAVREQAEAGRQTAEAQR
B2GFM7_KOCRD          ARRAERRR-VQAAVARAVET-------------AAAHLRESAEASAREAAAERDEIETRR
E1VVN2_GLUAR          ARLAEQRK-AQAANANRVEQ-------------AAERVLRFIEVSTSMASQERDELSVKK
A5CQQ2_CLAM3          ARRQVIRR-RQIARAASVAE-------------ALPAVVRAADRSTAEARLVLARAEEAR
Q6AE90_LEIXX          ARRAVIRR-RQLDAAQSVVD-------------ALPAVLASADRSVSQARVELASAEAER
D1AB24_THECD          AARRERRR-RQARTAAAVLA-------------GARAALERIEVSLRAAVAEREAAQQAK
D6Y659_THEBD          AAERARRR-RQAETAAAVVR-------------GAQTALQAVERSLALAAEEREAAERAR
D7BMZ9_ARCHD          QRAAQRRK-EAAQIAHNVHE-------------IAERAAEASRRVVTELTDERAECGRAH
D6ZIF1_MOBCV          ASRALVRE-RRRKRSVYVME-------------QAESAQQLAHAAAARAQAQRQASTASR
C7R311_JONDD          QQLADQRA-RQRQATSEVAE-------------QAHALVIHVERSERDAREQLALLEDAY
D6ZV06_BIFLJ          EALNDRRR-EQAAHLQGVAD-------------DARAVAAMVEHTLHDVAAKRDELQAAA
Q7ZAJ9_COREF          EQAVAQHR-RRIDLATTVQR-------------GARDVAERVSVALARATEDRDACNQEK
Q8NNW5_CORGL          EQAMEARR-RRTQLAAAVQN-------------GARDVAERVSAALAQAAIERDQHNRDK
Q84F13_CORDP          DQAVARQR-RKAEIASVVAQ-------------QCLVVAERVDDALARATQWKENAIAQR
Q4JUZ1_CORJK          QQQQARRA-AAREMATCVRE-------------QSQRIADRIADALATAEANRSHTEQAH
C4LJD3_CORK4          EEAQRARR-RARQRAAHIAQ-------------WCESLAKRVDTAVHKAAEERDTLHARM
D6Z8M0_SEGRD          AQEEALRQERARLRAAAAHA-------------VAVRLGDRAQTVCEAAQARHERLRRRV
C8WGU5_EGGLE          RESLVKKQ-VAQRRIEPLLA-------------LFEELVASARRWTRDLEEAATAAQDSS
C7MMZ7_CRYCD          SEGIQRKG-IAASRIDPLLT-------------SLETLCAAARSRAARLETASVASQEAT
C7N560_SLAHD          DGDIRLLS-AAEARIAPLHA-------------IFASLRESAQAYVDDLAGKAALEQSSS
E1QVK5_OLSUV          EESARALD-VMRLRIDPLHE-------------RYAAIRDHALSWAARLKDRSKLAEADS
C8W740_ATOPD          KQATHALE-VIRLRVDPLYK-------------RYDALHQKALEWASRLKDRASLAEADS
SMC_RHOPA             ASQIATVE-ERVAELTAERA-------------ELENAPEVFAEKRSAVITEIEFAEADR
A7IGT2_XANP2          GDRLAAVA-AREAEARAELE-------------TLEDAPSEFIRRRRALMNALEAAEAAR
B8EMM7_METSB          GGQISAFE-TRLAEAQEEFE-------------RLAEAPDVFLSSRRTLLGAIEAAEAAR
B8IQU0_METNO          EAALDELS-ERLAAAEEEQA-------------ELAEAPDGFVLERRRLAAATQEAEGTR
Q92RE8_RHIME          EDHIATLR-EREAEAREEVE-------------ELLDAPDEFDDKRRALMNELQKAEASR
A7HQY9_PARL1          ERQIGTLE-QRKAEAEAELK-------------ALEGVPAEIEQKRHVLLTLIAEAETGR
D8JUP9_HYPDA          EQQVQALE-ARLTETRGEIE-------------ANADLPARIAAQRETLLSALSRADEDR
E3I0B2_RHOVT          NAQINSLA-ERLDGIRAELA-------------EAEELPAKIADRRNKILMEIGQAETAR
SMC_RHOS1             EKRSAELA-ERKAETEEALR-------------EAAEAPEEIAARREELAEAIEAAEERR
Q2W040_MAGSA          KAHVEELA-ERREEIALEME-------------RLASLPDTFARRRSDLLERLEAAEAAR
D3P3X3_AZOS1          GGRVAELR-QRAGEAEGEIA-------------TLSGRPAGIAAERQDLLDRIALAERDR
B6IR58_RHOCS          GGRLEELQ-ERAEETRAELE-------------RLAERPAAIETERGDLLDRIAEAERLR
Q2RPA2_RHORT          ADQEAELT-RRFAAAEATLA-------------ELVGRPEAIAAEKAALVEALRAAESDR
SMC_CAUVN             AKRAESLE-GDRVKAAAALE-------------AAREAPAALQEKLVALLDEFAAAEARR
B0T003_CAUSK          ARRETSLD-ADRVKAAAALD-------------AAREAPTVLAEKLVVIIEQFAAAEDRR
Q0AMJ6_MARMM          EARLAEIA-NERSEAEARLE-------------TARARPEVIEDQLFELASKLRAAEVTA
E0TC69_PARBH          VDRTGSVS-DTLNALVDQLA-------------AAERRPEDLATRRTSLFEAVDRAEADR
C6XRC2_HIRBI          DIRLTDLH-TQRTGVRRQLE-------------SAKAQPDDIADKLSTLNSKLEAANATR
Q0C0X5_HYPNA          DERLSRLS-ERRADVAATAL-------------NARQRPQALNEEIDGLSRELDMFENER
Q1GQU3_SPHAL          ARRVTEMD-KRADALAAEAA-------------KLADAPARLAEQRAAAEAEQASLREKV
D4YX43_SPHJU          AKRIAAMV-ERGEAIAKERA-------------EIADQPDSLAAAIAALSEQGDTLTQAA
Q2G9S3_NOVAD          AKRLAEMT-GRREELEAERA-------------VSAVKPAGFIAEIEQGETIRQRLATDL
D5BSU5_PUNMI          ASRVAELE-TRFENGKQEQQ-------------RLEQMPADIEKRRLEMGDRLEAANTAR
A5FVJ2_ACICJ          NDRRTDLG-ARLHEAEASLE-------------TLGADGGARE-RRAEAGAELEAAESDH
C5B6I7_METEA          RERRSDLS-VRRAAAVEALA-------------LVDQGP-APAGAVEEAQEAVEVAREAA
Q937L3_DEIRD          AALRERLR-VNADSAAAQQG-------------GLDAAAAEVARREAALGTLD-EQEFPR
Q1J060_DEIGD          ADLREQLT-ANAGALQAQQA-------------HLAAAAAEVERREAALGTLD-EHELDR
L0A7J5_DEIPD          HAIDVRST-ELGQATLHQRQ-------------LVQGARAEAARRRADLGGFD-EGEVER
D7BH70_MEISD          IQRKHALQ-NERQGIEARLR-------------EITLQETDLAAQEAELGLAALEADLRE
SMC_THASP             VAELAARAAELDATDDHRSA---------------EALQEALALRGRR-EAALAARRDAL
A1K715_AZOSB          VAEQASRRQELDATDDARSH---------------DALQEALGLRSSR-EAALAARRDAL
C7RKG8_ACCPU          SDDLARCEESATAMQAEDLE---------------PGLQVALNHRVAR-EHALAQARDAL
Q3SJI0_THIDA          ETRLAQAREELARLPADALD---------------VELQAALMTRTEA-EAALAAARDAL
SMC_DELAS             ADEQQRAQDELTRLTDAAAQ---------------GGLQDALDLKMQR-EQAVAARRSEY
D6CTE6_THIA3          TSAREAAQAELARLSEQGAQ---------------TGLQSALAEQQSA-QAVLGARRSEA
SMC_BORPD             AVELEQLQADLADLDASASQ---------------AGLQDALEVRAER-EEALSRARQEL
SMC_BURP1             AASLEDARAELETINEQTAH---------------TGLQDALEVRAAK-EQALGAARAEL
A4SYV7_POLAQ          QDKHDQATQELQALSDEEAQ---------------DKLQGLLLARSAR-EAALANARTEQ
D5CRW3_SIDLE          EEALTHSRNELANLSEGDAD---------------RQLQGALQQRQVH-EQALAEARNTL
D9SGR3_GALCS          ELLMCKHRADLSSGADEISN---------------EALQAALATRETA-ENTLSELRNRL
Q2YBB9_NITMU          KAHLEKLQVEQDSFDEGELV---------------GVLEERLTLREQR-EQKLAEARNAL
Q0AE88_NITEC          TENMQKLQHTRADLDESSLA---------------ADAAHWQIQRHQH-EQALMAVRHEL
D7DI79_METV0          KLRCNEVEATLAATKMEALK---------------ANLETAINNKQQQ-ELTFVNARNQM
C1D4R7_LARHH          AERLESLVLEAEQYLDDDLE---------------DRLHEALYAREQA-LESVTQARDAA
Q7NR76_CHRVO          QERLETLVGEAETVDEAVPE---------------EALQMALAEREAR-DGEVSAARDRL
A1KSF4_NEIMF          QERQQELVLAYETEFQNDEQ---------------HIKLDELTESVHTLDEEYIAVQEKL
A1WY82_HALHL          ARRREELASALAGDEDPVAE-------------LTEKRETLLARRSEA-ETQLAEARSQA
Q0AAV4_ALKEH          LDRREELAEGLEGLADPGED-------------LEAERDELLQRRHQL-EQGLAEARNHV
SMC_XANOR             DTRLEDLVAQLSEGDSPVET-------------LEHEHQAALSERVRT-ERALGEARTLL
B8GTL2_THISH          DERLEALRAAMQDGDAPIKE-------------LTTELDGLLAKRVEV-ERALGEARTRV
Q3JAH9_NITOC          LQRREALEVTLASGETPLQE-------------LQTQLETHLQQRMSI-ERQLNEARERV
D3RSW0_ALLVD          LDRRDELIAALEEGVEPLAE-------------QRERLDEHLVRRVEV-EDELQEARQRR
B3PGR0_CELJU          QERREQLVASIADNRDPVEE-------------FKLELEASLAKRLAV-ESSLAEARRAL
A6V7X5_PSEA7          NERCEQLNLNLEEGAAPLEE-------------LRMKLEELLERRMAV-EDELKQARLAL
Q0VR03_ALCBS          AERKALLEEQTNEGDEPGTE-------------LQMQLEEKLEVRLEA-EHKLAEARREL
C7RBE2_KANKD          TSRKVELENRLSSEQDPTED-------------YQIELEQALEKRLLV-EEELKQARNKL
Q2SD45_HAHCH          RERMQWVEESLQTLQNPDDA-------------LQARLEGYLELRMQQ-EDILTRERNRL
E4PL89_MARAH          DERLEILRESRESAEEPIED-------------LQMQLEGLLDRRLAE-EEKLGAARDAL
E1V8E9_HALED          EQRCSELEEEREGLHEPDEE-------------RRERLDELLHRRERE-ERELNEARSRA
D3SAL9_THISK          RERFEKLQQGLAGREGPLEQ-------------WRGDLQAAAEQRQQA-EERLTRARSDL
SMC_METCA             ADRLAAIVQRLAESQTPLED-------------ERSRLDALTEERGVL-EAEMARQRRRL
SMC_COXBU             TERREMLSQYLSEGDKPLEE-------------LNEKLQTQLEQRLIL-ETELREVEKEL
Q5WTI1_LEGPL          QMRLEELTQHYLQSVAPEAE-------------FKNQLAALLIKHGEI-ELMLTLSREKV
Q12L80_SHEDO          NHSLAQLEQASRQQQSSQEQDQQA--------LLEQNLATLLQTQAQQ-QGLLNDTRAKQ
Q080K7_SHEFN          VSQLTQLQQMLLDNQQQQGQHDLS--------QLSTQLAQALEQQQAL-QQQLQQNRSQQ
A4Y804_SHEPC          IQSQETVSAQLAMAAEQSGVDNSH--------QLTDQLTSLLKQQQMQ-QQGLKAVRMEQ
D4ZIY3_SHEVD          TLAKSALEHQLVEQNVASEDGQLS--------SLKEQLGQALAQQQTK-QVELARLRQQQ
B0TKB4_SHEHH          EQNERQLHKQLDAKDSAQEEGQSQ--------PLREQLDQALQAQQIK-QEALTVLRRQQ
A3QFJ7_SHELP          AQELSELQGQLEGQDKLDGKLQAD--------AMAAQLNDALARQGEV-QAALDALRLQQ
A1S5R5_SHEAM          LTQKATLDAELKAQSEHSGDADRE--------ALSMKLREQLATQQTR-QTALAENRSRQ
Q5QUJ9_IDILO          QERSEQQTNETD---ENQSA-------------LDDQLTELLDKRGEV-SEQLQEQRQQL
E1SMV2_FERBD          QERCELAREEQEALTEPLME-------------FEESLALELEQRALL-EAELTERREAL
F2GBA5_ALTMD          IENKDRLTKELAQLTSPQEI-------------QEAELQTLLETKAEL-EQLKASKQRAL
Q15UZ3_PSEA6          LYKKEQLNNELSLLSTPLDE-------------QAGALQAMLTEHKQL-DDKQQTLNTAL
Q3IKC0_PSET1          EQGAKELHDQLTQLLIPEQE-------------LLEKIAQLLKQHAQG-EKNLNTLQNKL
A4SKA4_AERS4          GLELAELKEPGATP--------------------GQDLSPLLVEQRNL-EALQLACHQRL
D0KWM8_HALNC          DQRLAQFADRLDGLITQQSE--------------RQAEFTALSARQHEIAQAEKAALALV
A0A2W1K6W8_ACIFR      AATVAENEGELLRLQAALPE--------------MLKARDAVGALRAGRSVHLEVLQSAA
A0A0J1A050_ACIBA      TAQMEQAKKFVDPIQLELPN--------------LESEFQQQFAQTEKLQKTWNEWQIEL
B3E294_GEOLS          ADEQEQSENNRQELHNRIES--------------EEIRLAALLEQQRRQDELLLLVRKQY
A1AU91_PELPD          RDELEQGASERTRLQEFISS--------------ATERLELLLHRQEAGARFLEEARQAH
B9M6F0_GEODF          AAEVEKSILDREKLVLSIQQ--------------SEESLKALLEKQASFELSYSKLKEEY
Q39WG2_GEOMG          REERERCAQERERLVASLAG--------------GDGELKSLLARHAEAEGASATFKREF
B5EFS9_GEOBB          GNELEGSGAERTRLIDAIAA--------------GEEALRDIVKQQLRSEQALLLVKERY
Q3A212_PELCD          EQGQQQAAAETARLQAEGKQ--------------LQTELEVLYARRQEQQERLDRLKDSF
A9FIZ2_SORC5          DQERTESAVGAGKAAATIMI--------------AREALVRAVAEAHAAQAALTEARRSL
D0LY52_HALO1          QTDIVQSGERAELLRTESAA--------------LEAELVGVREELARNTAANEEGRSAY
Q1D2R5_MYXXD          QATVVEGGARVEELARRTTD--------------TEGGLSQRAEEHRLAAEGLEARRAAH
B4UDF6_ANASK          FAALSEANARAAELRGRLEG--------------TRVDLGRLGQDLAAVREELARARAAH
Q6MNS9_BDEBA          SEEAEGYNSQMTDTQVTLEE--------------KKIEFERLLDEVETLKLQAARAKDEY
A9A0M3_DESOH          TIDIRVKREKATAICNDIEK--------------QEALLREHYVVLKGLEEALAENEAAY
B8FHS3_DESAL          EREAARRRSSSGQSSDKIEE--------------LESRLTDAYTELSQAKEALEKVEISR
E1QL74_DESB2          DDEIAGADESVRSLLARRQG--------------EQTRLGGLYEQLDSLEAAYNQARQGH
B3EFQ6_CHLL2          TTEKINRTELTVTGLKQQLE-------------SHLLSAAAGQESLEKLESVCRELQSGN
A1BDT4_CHLPD          LTDKAEKLECHHAKIKRECE-------------ELLIRSAGEQEQLKTLELDYREMQSAN
A4SG64_CHLPM          AAENLTLCNEAAATLKKELE-------------TRRIRAAEHQKKLNEKESRYHQQQAQQ
SMC_CHLTE             AEKEVAELGQSIAQATAEHE-------------QAVVVSARQQEALNELESSYRDLQTKN
Q3ATI3_CHLCH          AERKQRNLQEQQAALQQQLE-------------SARHQNAEEQQRFDSAESAYREAQAQH
B4S519_PROA2          AQDSVTRIRAEVESCGKELE-------------CMLVESAKRQQQSTELEARYRECKILN
B3EM83_CHLPB          TDNALVATAAKIQTHRNELE-------------ACLVSSGAEQQKLNEMETRYNECKIAN
B3QRZ4_CHLT3          AQAEIFRLTGELETMNENLR-------------RFYNEKDAAEKVLAEIEFNYNALKGDF
D0MFL5_RHOM4          LATRLAQDQERRRTIEAERN-------------ARSAELPPAEAEVQRLRQQLVALRTAF
Q2S457_SALRD          LEATIEAALDEQTELDEQIE-------------ALREEREDRDESVEAAEAALQETKAEI
C7PLU2_CHIPD          AVANIAAAEEKLGTAEDGLI-------------DLFRKKEEEEKELNEKDQEYYNFRNQL
E4TVF1_MARTH          NEEAIKGIIDTAETNDDELL-------------GMYDEKEQIEIGVNDVEKDYYAARGQI
B2KBE7_ELUMP          GNERIKALSEEKLTAQAQLS-------------TQREDLKTLELDQTKLASELQALKKDF
B1H0P2_ENDTX          NSEKLLELLATQETEAVKMH-------------QLYEQQTQKEAEMRISLTDKQTLQDAL
E4TEW8_CALNY          WMNLLKMNREKLNELEKNRL-------------ILMDEKRLLEQYIIDKNEQLRSINSDL
D3PDY1_DEFDS          WKNALVEKSEILKQLQKKKL-------------ELIDLKEATEKEILEYEEELNRLEDKI
D4H2V6_DENA2          LKDNLEKKRIDYQNVIKKRQ-------------SLNDEKLRLDHQIAEMEKQLEDFGRDI
D6YSC9_WADCW          QLNRA-DYEQKIERVEQALL-------------KVQEKCRELDESVGARQGDVEEIEKRS
Q04TU9_LEPBJ          EREVS-ELEQQIESSYNEFL-------------DMSRVLESEKESLRNILKEIQNLKHDI
E1R6H6_SEDSS          NSAKIKALDRERVELDQQEA-------------KLKKELTNLEAGINDRNKELLKKEDNL
Q73ML2_TREDE          TEEDISELEGEINSLEYEGR-------------KISAELEKLENEISIKNSDLASKRGKV
A0A0H3BKB7_TREPS      LEERLLEVEGEIGQLEQRGV-------------LLTKSLENCEGEIRVRNAAVTSEEHAL
E0RSK7_SPITD          VKASLHALEREQKALLQEEA-------------SCREKIVEIERNIKEKNFAISSHENEI
D5EMY0_CORAD          MDRALGEVQRQTASLQERIL-------------RRNQEVDTLNEQIQKLRQSAGAEAEKS
B1ZZB8_OPITP          LDRGLGEMERRRGQLSELLI-------------QRQQEIETWSEQIGQLERESAEQRERS
SMC_DESHY             RKDLQDLEESKARLAFEQGDWE----------SRRREAGEQQQQAQEVLIA----LRKER
A4J682_DESRM          QELLQQMDKRKGELQEQLSQVG----------MDLKRLQQEHQMAMGNLKA----EQAKQ
Q67PF3_SYMTH          EQEQAAVASRLEQTAAEQETAR----------AEAEEAAAARAALAAERDE----AQARK
B0TGW8_HELMI          KEERCRMANGEMVACAEEQIYM----------EKELAAAVAEEACALEQVR----LRQEE
Q2RJX0_MOOTA          RRQQAELAARMTAAATATNELQ----------ENREKLAREEEWLAGAIQQ----AEEGL
SMC_BACSU             KEDLSFLTSEMSSSTSGEEKLE----------EAAKHKLNDKTKTIELIAL----RRDQR
C5D8T7_GEOSW          KQELASLIEEMNSSHFGEEELE----------KMRQKKSQDKQKTIELIAS----RREQR
D5DQR5_BACMQ          TDDLSLLTSEITSNDSGELQLE----------EAAHERIKEKTETLKLMDD----CRSER
B7IUK7_BACC2          KEDLAFLKQEMTSNSSGEEQIT----------NMIEKKAYDRNQTSELIRS----RREQR
Q9KA07_BACHD          KETFQLLETELSQSTSGELSLD----------EQIEKSRQEKSELSEHVAH----LQTKR
Q5WFM8_BACSK          KEHLALVTSSADEQAHTSQSLA----------EQIAAGKQEKQALAAKLAE----LEEKE
Q7ZAM6_OCEIH          VAELTNLDEIHDSEES-EEQID----------EIIEANRKSKQEASTEIAE----QREKR
D6XTT7_BACIE          MSELKKQEDVL--NQGTKESAA----------EELEQWRQNKQTATAYIKD----LRTKR
Q81ZN4_ENTFL          RQQLQQLSSHSSDHQLTEEGLA----------AQVAQLAEKQTALQTSLQT----ARSQR
A0A0E0UX46_LISMM      EQKLASLKTNLTSVHTSEESAR----------KSIEELRKDKAETSEKLTQ----TRQTR
B1HQH6_LYSSC          SQEILWLQSDESTNYLSDEEVD----------EQVMTWKARRDELQQAISQ----KKEEK
C6D303_PAESJ          RTLFSQQDAEMERHGGETVAQI----------EQLNHLRLKKQECAEQTDL----KRSAR
C0ZFN9_BREBN          NANLASLDELERTNESSGLELD----------QRISELRQDKDRVAGLIQE----RRSER
C8WWA4_ALIAD          HAEMAKEEARDEAEAARLAAAR----------ESERAEALRLAEELDTLEQTLAAARQAR
D5WPA2_KYRT2          EVEIGELEKRRDETRGRLITIS----------EQLEEGQSLAAERLRELQE----AKGAR
C4L5Z7_EXISA          ERELKRLESG---EVVSSMELE----------ATLATAKLDFTEIQERLQE----VTATL
B1YIN0_EXIS2          RRDLKHVLEGF--DEAKIDALH----------TEKTQMQQEQTSVERELTH----VTAEI
D3R1B0_MAGIU          RDETDQIARETAELEERAAGLE----------KEAAELEQRQTDLQAATEK----LMAER
D2RLB2_ACIFV          EEETRQLETTIAGCEKNRAALE----------KKIAGLEAELAGSDSARQQ----FLDAR
D1BLY1_VEIPT          NLLVSTTQRYEEDIPLAQEVAE----------QELTSATAEVERLRALRDE----AYDKT
A5UQ60_ROSS1          AERIEHLHRERATLIDELTQTA----------AEHQALLAQIDTLRAQIEP----SEAEL
B8G556_CHLAD          EAALQALQTERAQRETTYATGL----------ARQQHVLAELNSLQAQIDP----AETEL
A9B100_HERA2          QQRQHELVEQLALAEAQSVLVA----------ERRQQAQLQREAVYAEQAP----LLERL
D1C6T1_SPHTD          ERRAGEIATAIAALDAEVESLT----------AERERIAALLAAAEEQLGP----ARAAR
D7CMX2_SYNLT          AQEKKALAVEMDRQESLQLELK----------TRCDGFQEKMGQLRGEMET----LVRAI
Q0AYV7_SYNWW          RQLMQSLQLEIRQEESRMEQFK----------KELENKTEDLARLSAESRQ----MQEKE
SMC_LACPL             QATLAQNEETKKQIQADLTAIKTTLASQQMSVAERDTVLKTAKAKQAAVEEQRKTCEQQL
Q03RT7_LACBA          QADIAAAQTDQATATTKLAELDR---QQALTPADAQAQLAQAQADRQTIEQKLATTNEQL
B2GD41_LACF3          LKQQSEVQAALAETQGALAQLSKQDQTMDAEHESSQVALEESRAALKDHQAAVETVTDQL
A5VKP1_LACRD          NRQRREVEESLEKVTIAIAELTTQSASQSTSEQSTQTALKDAKEEQAKAKVQLEDNSVAL
Q03FW9_PEDPA          QTTINDVLERNDEIKIKIQQLDEELIPEND---LKHLDIDDIRNQLAEQNQLSAQLQNNF
A0A249N2C3_LACRH      QAQAIDAQTQSTEFQQRIAHITATAKETAAEKESRTATIASLKKELTQLKADQTKLTQEK
Q38XR7_LACSS          TQLANDLKQQLETSQQALAALQQADSEDAMTQKERRTQLKATKALIQKLTAELATKRTAR
Q1WU99_LACS1          MTQEENISELLKKQQDAIAKIKNKEKIALSAKEDIKDKQEYIRNTIDSIKKKLKDAQEER
Q04GL1_OENOB          SDQKNRLGNELSDNQEQIDLLNNQLEVLDNTLKNTGN-AEQISDNLKSVNLNRDQFVEKK
Q03VW6_LEUMM          QNQRNELQREHSTVEENLKNLQKQLAIAQGNVANQSI-IDDMSHQLDATQEKYDNINTQI
A0A0U5K8Z4_LACDE      GRQKAAIQKQIGQLEEKLAALDNSSQLSARKKEELGLEKDRLLAEQKDKQADLDAASQLL
E4SKB3_LACAR          KQQIRNNQEQTADLTHKLQDLTQSGERSVQKNTDLKKQKADLKQQTEDLQTKLNELSSQL
Q74IP9_LACJO          EEQLENTNSRLKDIEEKIKALSLS--QNGQSESEIEEQVAKLSKQKKQMQEALAEINKDL
A0A0T8KIP4_STREE      GKELDNLNIEQEEIQRMLQEKVDNLEKVDTELLSQQAEESKTQ--KTNLQQGLIRKQFEL
A4VVL7_STRSY          QEEKVVADKEISLLEDMIDQKLEALEDTSIEILEEQLQAASDK--QNQTNQILIRLKFEL
C0MCR5_STRS7          ETMIAQGQKELADLEAVLSHQVSQEAIDQLPHLENQLTEANQR--KIKTQEHFIQVRFEG
A2RLZ7_LACLM          LTDLSALTEEKNQLTALLNPV--QFDETERNNFSKQLTEVEGR--LSQINVRMVSLKFER
B9EBB4_MACCJ          LDKIETIEGELKHLSQLEHAIDREKLQKEIIQLEKSVDEDKEK--KSFLHRQIEDLQQAV
SMC_MYCHR             NLSFDS-------------------------------EKLNIEKQISTLTIELNSKKDRL
E0TKT8_MYCHH          NLSFDS-------------------------------EKLNIEKQISTLTIELNSKKDRL
Q4A770_MYCH7          NRTLK--------------------------------EKIELENVVLELENQCKILKTEK
C5J708_MYCCR          EKSFE--------------------------------AKLQLENKISFLEIDLKTQNEKL
A5IYM7_MYCAP          IHSSEA-------------------------------DLEVLSSRKSALEADFRAKNERI
D5E4P4_MYCCM          -GKNVE-------------------------------NIEILESQLRATSADLRAKNEIF
Q6KHN4_MYCMO          --NYKD-------------------------------TIEELKYEKSNLFAEANAKREQN
Q98PK8_MYCPU          --ALDQ-------------------------------QINEIQAKKVILQAQIRAKKESI
D1J8Q8_MYCHP          KIDIVA-------------------------------AIQQLMLERSDLSAKKSSQEDIY
Q4A588_MYCS5          LLTLFN-------------------------------KINELKNQIQQNKFSNSLLNQEK
SMC_MYCGE             SEAE------------------------------LIHSLNSAWAKRDEINSKLKLNQELK
SMC_MYCPN             DETR------------------------------LVESLNRAWAERDELNSQLKLNQELK
Q7NBU0_MYCGA          DDKK------------------------------IKDKLFSLETKKATLVQDLKINQEAK
Q8EVS6_MYCPE          DIKE------------------------------ITDRLNSLNNSKEKVTYELNTNENTK
Q9PR04_UREPA          KISD------------------------------NWNEYNKKKNELINLKQKIQTLKANL
Q6F1N4_MESFL          DESESIR---------------------------LAREIAKLETERNEISIKVNALSDSK
Q6MTD2_MYCMS          DESESII---------------------------LAKQISELEIQRDEIQIEINSISFKR
E3GP81_9FIRM          HSQIETCISREKKVESEIRACRESSALHRTRCEVLKVETEELQAAVDEKRAALESFSTET
SMC_HALOH             FKERYNKILSEIKGINNKEG-------------QLNELKVKLSGEIEKLKNDLNLTEKEV
E4RL35_HALHG          LVVKLDDLDSDLNRIKQRQL-------------KLNQKKDDLEAEALKLKKTKDELKVLV
D9QRN7_ACEAZ          KKSEIEELRKRKEKLADQKI-------------DFREDQNELKQQKKELEAKLADLKEKK
A8MHB7_ALKOO          KKNQLKEEQGFHILLTNEIH-------------ELKDEFDNLWRSISVYEDELKKYKEEK
A6TRT3_ALKMQ          KDKEVKGSREKFADFEKELK-------------QGKLSLQELNKELKETENRLSITRKEK
A3DDY2_HUNT2          KKAEKARNEQEIKALQEKNE-------------GLDKLIKKYEEEKSGKTFEIDRITEEK
D5X8N2_THEPJ          KSEEIDFIGRQEGNIAVENS-------------KLEKLITTLVEEKMGMEERISALKNHR
D9R048_CLOSW          LSNGTNGSNSIIEEKQKEIE-------------ALKSRIQEEMKRSEELEGIISEKSSQK
C4Z0E6_EUBE2          IRQRKESLSSEVEDKNAQIE-------------KLRSDIHKAKNQIEDCNTKITALRKDR
C4Z924_AGARV          LVEGAAAAKDDIKKKQADID-------------AITQTILASKDNNSKLDEELRESLTKK
E0RV40_BUTPB          IVENLNNNALSLEQSKKDIE-------------EIRLTIEASTNVHDETSKELEDKKKQK
A9KLR0_LACP7          LRREAESSTEQKNQREEQIT-------------ISLNKKQEDLERLHILEEKITKASEQK
D9S347_THEOJ          LEQNMDAIREALESTVEKMR-------------ELQLRLEDNARDEANLHNALIEMKKQK
B2A2N3_NATTJ          IKEELKELSEKINDTINEKK-------------DNHTKIEELRTKQRELSNTLDNLKQER
A8F8R1_PSELT          NSQIKEIEGEIDRLKQILLD--------------NQREIETIKKETENLFETMKMQRSDK
A5IN04_THEP1          KLQMTSLEEEMENYRKFIRE--------------HEREIEHLKKEMDNVFEAMKLHRSGK
C5CIS4_KOSOT          EREIEELENEAEKLRKQVAD--------------QDRELQSVKRETEALFSSIRDQRQGK
A7HMD4_FERNB          KSVISKLEEDIDETKKFLLE--------------NEKELETLRNTSQELFSGIREKKAGK
B7IHN5_THEAB          SKEAKSLRDEIDSIEENIKE--------------LEQELNTLKSETEALFKSMNEDKSGK
SMC_THEEB             TEQEIQRLCQAQREMRCQQQ-------------ALDQTLGDLATQIERTQAALRELDSRL
Q2JHS4_SYNJB          HQERLQESKQRQAYLQEQIV-------------QAQATLGQIQQHLAEQRQQMSQIEARL
SMC_SYNP6             ARTQVSQLRQQQGEQLNRLA-------------QLDEQQRQQATAIAQLQQRQAQLEAQL
B0C9C4_ACAM1          AEVTLQTLQTQTETQATQKA-------------ENQDQQQQIEATIATLRTELAKLEERL
Q115J3_TRIEI          ISRRCSEYQEQELDAYNTIK-------------EVKSQILVVDEEVGKTREGMAKVEERL
B2J925_NOSP7          AETRITEYETQQISCKDAIH-------------HVFSQITTINEQITQTRLSLAQMEQNL
E0UKI1_GLOV7          AQQRIEGFHQQTLTIDEQKA-------------EIQQQLLKSEANIAETEQLFQQLTEKL
B7K4Q6_RIPO1          GKQRIETDKSQAINLKKEGS-------------EIETKLVEIKQKIEELESLLEQLNIKL
B0JSN6_MICAN          SADRIIEIEKIITDAVNQRN-------------IGNLEIEKLDQHILEINQALQQLSRQL
SMC_SYNY3             AQEKIAQHQAQDLTLAQEQE-------------QLKIALAEMNGAIQTTEAQLAKLSEKL
Q84EC7_SYNP2          DEQRLQETQTQLEDLQGQIA-------------VIQTQLDQIDTEIQTTETLLAELSAQM
D3EQ04_ATETH          DELKIKLNKQQISDINNQQV-------------EIEGKLKNLNIEIGKLEILLEELTQKL
SMC_GLOVI             LLSRRLDWEDQKVEFGQREE-------------ESRTRLAEFDRVIAELAAQVAELEERL
A5GQT1_SYNR3          VAAEDQRLQASTAALTAEVQ-------------ELRDQQLADQARRAELQQQQQALQERF
A9B9B9_PROM4          LIAEQDRLQESIDLLTKQHI-------------KWREQNQALGVHRKELEKEKQNLETHF
A2BNJ6_PROMS          TLLQEKNLQESIKQLAIAHS-------------EWIEKRDQFKKELSDLDNQKNSLEKNL
Q46EX0_METBF          AKELIREIDEKKASRMEKVN-------------SLKIKIKECEEKLEEKKAREIELSNEL
D7EAF5_METEZ          DRELIEELDEKKSSHQGRIE-------------SFKEKIKELEDSLASKQEREKELGDEL
D1YW78_METPS          NKGRGEKVDENIASLREKIS-------------QNEAAIGEFNGKIEDLTKREKAIESEL
A0B8B9_METTP          LARTKELLELKKNDAIQRRS-------------SALSSMEDLRAALDELSRKEKDLDREL
D4GT30_HALVD          LHDTIEAAQNRKAEARESIS-------------EAESTIEEREDDLEAKREAVAELEEEL
A7IAD8_METB6          LTEERARFDERNKQIDAEVA-------------ASNDQITSLKSVIVGLEEKQKQFSGEL
A3CWK7_METMJ          LAAERSRLETKNQEIDGEIT-------------ATEEQIEDQRRLIVQFEARQKEFSDEL
B8GG37_METPE          LNRDREQAISRNLEIDGEAE-------------GAGEQIARYREEIARLEEEQKSFSGEL
E1RII6_METP4          LDLDREKLETGISSFEEEIS-------------SCRQAIEENKEIIEDLEDKRMNFSEEL
Q2FLH3_METHJ          ERQQMERIREQMKRYEEEIR-------------ECHDEIAKKQQDIKDAETTVAKFSQEI
A2SS75_METLZ          ITRERTTLEGKNVSIDQEIA-------------DCYAAIDTAKSAITAFEDEMKAFTGEI
D3RYW2_FERPA          KEEEIKEIERRVEEIRRKLE-------------EKEKRKIELEKLLKSYEEEVSKLEEEA
O28714_ARCFU          KQVYLDEIKDRIDEIRRTIE-------------EGKARVEEINSELEELRKEERELGKEL
D2RFP2_ARCPA          YKSSLNDLEKKITERLNGIE-------------DAKAKILELERRLESLREEERRINKEV
SMC_THEAC             LEDQMIDTKLQENSIAAEID-------------DLNGKKRELEEKAKKYQYALNDLEGRY
Q97AI9_THEVO          IVQQNIELEIQRKAVEDEIH-------------NIEIQKRSMEEELKKHELFLKQLESSH
SMC_METVO             LNSNIKSLADKKNMFKNSVE-------------IYKSNIESNSSILSDKRGKYEELTKGL
A6UQ42_METVS          LNTTIKELGEKKSILENNIQ-------------FYKVNVEKNFEILKNKRERYEELTKDL
A6UVP1_META3          TMAKIKELEEKNKLIEQNIK-------------FYKSNIEKTVKQLREKQDRYIELTKDL
SMC_METJA             LNKKVSELINKKVILEKNIS-------------FYKESIEKNLSILEEKRKRYEELAKNL
C9RFQ3_METVM          LNKKISELINKKSVLEKNIS-------------FYEESIKNNLKILNEKKKKYNELAKNL
D5VT24_METIM          IEEKIDELERKDKAIITNIG-------------VYEDNIKKKELELMKLKERYEKISEKM
D3SQ87_THEAH          REVSLEEVSSRWNSLEEEEV-------------ALITERDRLEEQLRELNSTAYEMYRRK
D3DG53_HYDTT          KMAFLESAAGAVKEAEERIK-------------KLKEEKAKLEESVKDLERTAYELYSKR
SMC_AQUAE             KEREREYLTERIKSLKKEIE-------------NLILFKEKTLQEVKEAEVKVYDYIKQK
B4U7R1_HYDS0          KKQELIGAHSQIKSLEQELT-------------SLDLELKSAEEELKESNAMFYKLYEEK
C0QSN8_PERMH          IENDRMKLEDSLKIKNRQIE-------------ELKNRIEEYSRELSDLWKDLKDREKER
B2V736_SULSY          IESEKSALEKEFHDKKSEIE-------------NIKSEIDSLTKQLSELWKGLKGQEEER
SMC_PYRFU             LEEEIEGLVNKINALKNNIS-------------ENEKALELLNKELEKLKSIEENIKGEI
C5A612_THEGJ          LEEEIEGLINRINALQANIK-------------ENEEAIKRFESELEELKKAEESVKDEL
D1CC09_THET1          QSELDDIHRRIECLSPQVSH--------------LTKQLDVVSKEISSLQEKIDEDSNQI
D3TAQ9_ACIB4          TKNIENAKEEIKNMEKDIEN--------------SEKVMEDIHLERRKLEEVVRKEEEKI
SMC_HALMS             NEEIETTNDQIDTLESSNQE--------------MASELSERDDVLGIMKDDLTQLLLAM
Q6L0R1_PICTO          NNEIASKSSNIKNLNDKKES--------------MEFELNKKNLMLSRLESSFKEVFNQI
C1A7M6_GEMAT          ARELSTLSDADQHLVTQLDT--------------WRAELETERKSLADADGRLGEAERAV
C9RN51_FIBSS          REEIEKNTVSIEKFETDCNK--------------LADEAQVKDNALRELERNRDLARERY
D1B5Z0_THEAS          EASTSDRDGRLASALGELRG--------------LGVRWLEAWRELSELRARRDQVMEAS
                                                                                  

SMC_FUSNN             QNLSNEERELSKDKSKLETDSLHANDRF--------EKIVEVIEKIKVDILNINEKLNEL
E3H7H1_ILYPC          SELEKEERELIKQVKNIENKIVIENNKL--------SQEFAKRENLEIGIENLKVKLNEL
D1AK68_SEBTE          RKLESGEKELISKVKDVETKIILNKNEH--------VKYVENFTKLTKELEYLGQEYEEM
SMC_CLOK1             NVSNEKVDNLTLIINKKETSFHKIQLE---------------LTKLNSQKDNIYSRLKED
D8GS00_CLOLD          KKCNEKLESLTLLINKKEEKLHKVQVV---------------LARLNSEKENMCLKLKNE
Q97IA1_CLOAB          ENKRNSLQGINLVLQKLETEKHRYEIN---------------LAKIETESENLYERLNSD
A0Q0Y7_CLONN          KINNSDLETISIMYNNIDKNKNSLEIN---------------LARYETEEKSIYTKLNDE
Q895M7_CLOTE          NKIQGEEENIIDIKGKKEEVFHKYDIS---------------MTKLQTQRENLYNKIMEY
Q0SSA4_CLOPS          SSAENILEVLSVEIAKKEEEVHKNDIT---------------YTKQENEKNILNKRLLEE
A6LSM4_CLOB8          KEKDNVISGILDEVSLKEMEVNKREVI---------------KAKKENDREHVYKKLNEE
D9SLC7_CLOC7          KKVNDQLEIINDTINSREELKHRQEVA---------------IAKSETEYENILNKLNEE
D7APA8_THEM3          QKRKEKFSILQQEFTNINEEFHKVEME---------------MQRFQIEIDNIKNRLWEE
Q8R9W7_CALS4          QKDREKFLALQEEYTSLKEKVHHVEMN---------------MQKFQMEIDNIKQRLWEE
D9TN88_THETC          NDAKNELIILEKEHSKRLEKERGLDLN---------------IQKIEMEIENIKNRLWED
C9YKI7_CLODR          DEINKELKTIDRQHIELKESLFKVGGR---------------LERLKTSQDTYINKLFEQ
E3PS49_ACESD          VQKREDYRNLEKDLISLQAKISKLDSD---------------KAKIDFQKNSIIEKIRDD
B0S1M4_FINM2          NDFKASLSSIEQSIYDSNASVQKTEINNN------------SLIEKALNTTEKLNNIKID
Q3AC59_CARHZ          SEMQTTLTKTQKLIQKHFAEISRLETE---------------QRNLLQEINRLKLLLNEK
E4SF58_CALK2          NSEQKKLNEALNKIQEIEKKLGQIALE---------------KHDVENYMKNIKEKYFET
SMC_RHOBA             NQEREATRRVQTESQAAIKAVAKATEAV--------ATISSARDAAALKQSTLADRIAED
D2QWB0_PIRSD          QAIERERSTASGELQKLLRRLRTIDEQL--------TEEQLATGQIQQRQESLASRLRED
D5SU17_PLAL2          QSLRSSRSQTLQLELKLRQQERKLDDER--------QAIVMRQRDLEHALAAIAERLQEE
SMC_KORVE             EQVRARIAEIEEELKTARQALDAARDRR--------GELHASVARLQSDGEHMAETCVQE
C1F1T5_ACIC5          ATLRSELAQVEQSLKTLRAENNALREKL--------TAATAREARCSADKQHLEETCMQD
Q01Y77_SOLUE          AGMREALRAGEEELKGLRTAAQETQERR--------TQIEIDLVRKQAELKYLDETSRKE
SMC_MYCPA             QQRATAMAAVRDEVNALSARVAALTDSL--------HSDEVANAQAALRIEQLEQMVLEQ
SMC_MYCTU             QQRLAAMAAVRDEVNTLSARVGELTDSL--------HRDELANAQAALRIEQLEQMVLEQ
SMC_MYCLE             QQRSVAIAAVRYEVNTLRVRLATLTDSL--------HRDEVANVQAALRIEQLEQLVLEQ
A4FMG9_SACEN          SEHEQALGAVRARVRELSGELEKLTDAV--------HRDEVVRAEQRLRIEQLEVKIIED
C8XH72_NAKMY          AEVDAVLHEARARAAELQSQWDKLTDAV--------HSGEVLRAQQTMLAQQLADRSVDE
D7GEI0_PROFC          SQADAHISAAREEVRQRSQEIESLVEGA--------HREELARIEQQMRVEQLTEKAMSE
Q2J6Z3_FRACC          KAAETELVGVRDQGRALATELAALRDAA--------HRDELARAEKRLRVETLEAKALEE
A8L599_FRASN          RDTEAELGTVREQVRGQATELAALRDAA--------HRDELARAEKRLRVETLEAKTLEE
C9Z3S1_STRSW          ARREQELAQARAEGRDLKAEMDKLTDSV--------HRGEVLGAEKRMRIEQLETRALEE
D7CC86_STRBB          AERERELVAERNHGRELKGELDKLTDSV--------HRGEVLGAEKRLRIEQLEAKALEE
B1VYX5_STRGG          GERERELAVERDRGRGLKGELDKLTDSV--------HRGEVLGAEKRLRIEQLETKALEE
E4NHH3_KITSK          AVREAELRQFREHGRALKAELDRLVDAG--------HRDEVLRAEKRMRIEQLESRALEE
C7QGY1_CATAD          VEHDAGIQVVRVRVRELSGELEKLTDSV--------HRDEVARAERRMRIEQMEEKALAE
A0LV82_ACIC1          AAREAELARVRDELRAVGDELEKLTDAV--------HRDEVARAELRLRMEQVTGRAMEE
A0JXV4_ARTS2          ELRDRELVEVRSQNDSLGRELAELTDSV--------HRDELARTQQRLRIEALELRSVEE
A1R7H8_PAEAT          EQLEKELTEVRSANDALARELAELTDSV--------HRDEMARTQQRLRIEALESRSIEE
A6W7T9_KINRD          AGFDEEVAGARRTVEALKTEQQRLGDTR--------HADEVARAQQRWKVDQLRQRSLEE
D1BJA3_SANKS          GARDAEVVRARQRQDALAEELRSITDVA--------HRDEVARAQQQARVEALRQRAVDE
C7NGM6_KYTSD          AELRQELAARRTRIAELTERVRELTDAV--------HRDEVARAEMRLRVEALVQRATDE
B2GFM7_KOCRD          AGLDEAAQRLRTERDRVGAELAELTEKL--------HRAELDLAQRRARLEGLEATSLEE
E1VVN2_GLUAR          TELESMIGSQRTEAEQLSAELTRLADAV--------HRDEMARAELRMRIENLETKALEE
A5CQQ2_CLAM3          AGRNAELVVLRREEAELRARLHGITEDV--------HGLELQIYEKRLQVSQLLERAASE
Q6AE90_LEIXX          ASQNEELQTVRREEGLLRERLHAITESV--------HGLELQIYEKKLHLSSLLERAGSE
D1AB24_THECD          ADREAELKVVRAQVRELSAQLEKLVNAA--------HGSEVARAEQRLRLEQLTERAMEE
D6Y659_THEBD          EHIETELKTVRGRVRELGAELDALVNRA--------HGSEVARTERRLRLEQLEKRAMEE
D7BMZ9_ARCHD          AQREADIVAARKTLEKALADQRYLDDRR--------HQHELLLAEITLTYKQLADSALSE
D6ZIF1_MOBCV          EQLQTEMETLRAAVDDLSRQRTDLKDAS--------MRDEVALAEVNSKLARLLEQAQQE
C7R311_JONDD          LAANEHISGLRNKERSLSERHDEAKDHL--------HTIDLEVSALHAEHTRLIDRAMAE
D6ZV06_BIFLJ          SSHDEELKALRAQRNQIEPKVTDLTGRE--------HALDVNRERLAAESGQLMQKVSDE
Q7ZAJ9_COREF          AAVTAQLARARDAVSAARHQLDRLHDNA--------HALELARSQAQVRMEEAVAKITEQ
Q8NNW5_CORGL          ALLTSHLARAKDAVSAARQHLNRLSDNA--------HSMELARSQAQVRMEEAVAKITEQ
Q84F13_CORDP          GVISARVSAAKDTVSALRTNANRLTEKS--------HAAELSLGQAQVRLEEAHEKIVEQ
Q4JUZ1_CORJK          KQWQSTMAQQRDKVSALTSHLGRMNDNA--------HSAELARTQAQVKIEQAVAGAMEQ
C4LJD3_CORK4          SEATAQRGRARDALSAITTQREHALKTT--------HDADIKREAALVRVEQAEKHIVEQ
D6Z8M0_SEGRD          AEQIESMREGQSQVAAARDRLAAAERAA--------HAAELAATTAEERSKAAETEVIER
C8WGU5_EGGLE          TGLHNAVNEARARARAAHDAFDDANARL--------SAARVDKGRLEVQVDAAVNAIVHD
C7MMZ7_CRYCD          AALHEQINVAREEVRKAHDAFDTANEHL--------SDLRVEAGRLEMRVEAAISTIVDE
C7N560_SLAHD          AGLNDAIGAARTASRDAQKQLDDATQRL--------NDIRVSKGKLEVQVEAAITTIVDE
E1QVK5_OLSUV          ESLKRTIADAREAVDVASGELDRARGVA--------SDVKVELGRLEVQVENAIAAITAD
C8W740_ATOPD          ETLRETISEAKDAASEAALAVEKEKDAA--------NQISVEIGKLEVQVQNAIEAILAT
SMC_RHOPA             RAAADALAAAEQAMSETDRLAKASLEQL--------SSAREACARAEERMEAARRRLEDV
A7IGT2_XANP2          RDAADRLAEGEAALAAADRAARDALEAM--------SGSRAEAARADARLEAARQRRDDL
B8EMM7_METSB          KEAADRRAEAETALAAADKAARIALDAM--------SAAREQKARAEAWIEAARTRRDEV
B8IQU0_METNO          RASADRLAAAEAGLAEADRRARDALDAL--------SAAREGRAAAIAAHEALARRVAEV
Q92RE8_RHIME          REAADRLAEAENHQREADRQAATALSEL--------AEVREKRGRAEERLVSARERRVEI
A7HQY9_PARL1          GEAADALAEAEKLLSETAKHAKEVQHNL--------GETREERARIDGLVDGGRERRAEA
D8JUP9_HYPDA          KSAADALATVEASLRAATEGLRAAQTEV--------SSAREANARIETRLENGRLRRQEA
E3I0B2_RHOVT          KAAADQLAAATNGLREADRSLRDAQSGL--------STARETRARIEARLEAARERRAEY
SMC_RHOS1             ARASDALASAEAALRAAQEAEREAERQA--------GESREARARAEARADAATEALQLA
Q2W040_MAGSA          KAAADALIGAEQLLGEADRRMREAEALL--------ANAREERIRREAAVSAADQACRAV
D3P3X3_AZOS1          KRAATALAEAESRLAATEQALHDAEAAL--------ADGREARAHAEAAVSAALQQERTL
B6IR58_RHOCS          RRAADELVALEVQVAEVERELKAAETQL--------ADAREARAHAEAAVAAARQAMQTL
Q2RPA2_RHORT          LAARDALSAAERRLSEAGRTLKEAERAE--------AQAREVQLRGEATLDQARLACQAA
SMC_CAUVN             AKASDALETAETTRLNADRAARAAEQAA--------GEAREKRAALVAHLDGARQRFAEV
B0T003_CAUSK          AKASDALEAAETARLTADRAARAAEQAA--------SEAREKRAALVATLDAVRARFAEV
Q0AMJ6_MARMM          EDARQAASANEGEVKSADSAARQAEAAA--------SAAREGRAAAEATLTAARERLAET
E0TC69_PARBH          RRAADALAEALALQEQADAAARLTAEAV--------SVAREVKAREEALRDAARDRLSEM
C6XRC2_HIRBI          TEASNALSQMETQLREAETQARQARDAS--------AKARETLIRSETRLEAAQRREEDI
Q0C0X5_HYPNA          KAAADALAVKETAIREADAAARRASAAA--------SQAREQLAGWKVKLETSEARLVEV
Q1GQU3_SPHAL          AAAEAQERAAEAALREAETALNAIRERV--------AAARETRAGAAARSENAELRRVEM
D4YX43_SPHJU          DTARREESEAEAALRTAEQRAAQAGEAL--------ATAREARATAAARAEAADEKRVET
Q2G9S3_NOVAD          AAAETALAEAESASKQADSALSAANEAL--------ATAREARAGATARAENEDARRQEM
D5BSU5_PUNMI          QEASDLLIKAETQLGEVETAQRIAEGAL--------GEARESQIRAEGAQERGKALLHDI
A5FVJ2_ACICJ          HAAARDLASAEEAARRNSAAARAAEQDL--------ARAREARIGAESAVREADHAWGTV
C5B6I7_METEA          AAVQRDLEEVERRNAEAERLVRETAALV--------DRLKEDRAGRIAEIATARQQLADA
Q937L3_DEIRD          AEAARE--AAALAYANLIGEQNKVRGRL--------DDLRVLIARREGSAEPIPDGCS--
Q1J060_DEIGD          AEQERD--AAAQAYTSLIGAQNKTRARL--------EELRLLIARREGSLEPLPDGCS--
L0A7J5_DEIPD          LEQRRS--QVTQRYTSLIGRQNRLRAEL--------EEVRLTLARREAAVEDVPPGAL--
D7BH70_MEISD          ARQATR--ALADEESRLLSRTNAVLAEL--------EQSRITRARREATLEALQTEQSEL
SMC_THASP             AEAAAALKQVEELRLRTEHEAAPIRARV--------AELRLALQAAELAVAQFEERLVEA
A1K715_AZOSB          EHAAALLRQTEEMRLRTEQEAAPARARV--------AELRLAVQAAELAAAQHEERLREA
C7RKG8_ACCPU          EAAANGLRALDEGRMKVEQSLDPLRDRI--------GELKLREQAASLNFEQLASQLAEA
Q3SJI0_THIDA          EGLSAQLRTHDESRLACEQGLDPLRRTI--------EQLKLKDQEAMLTQSQFELQLREA
SMC_DELAS             DDLTNKLRASDERRQQLEKALDPLRQRI--------TEFQLKEQAARLGLEQYSTLLEEA
D6CTE6_THIA3          DDIAQQLRKQEEARLTLDRDLDPLRQRI--------TELQLKEQEFRLQAEQFAQQLAEA
SMC_BORPD             DNLSALLRGADEERMQQERALEPLRARI--------TELQLQEQAARLAEEQFTEQLNAR
SMC_BURP1             DDLTAKLRAADEARLAAERSLQPLRDRI--------TELQLKEQAARMTGEQFAEQLATA
A4SYV7_POLAQ          DALLHQLREADEARLQVERSLQPMRDKV--------VDLQLREQAARLNFEQFATLLSDA
D5CRW3_SIDLE          EHATMNLNRMEQERMACEQKLNPLREKV--------SEITLKEQEARIQFEQWAEQLQGV
D9SGR3_GALCS          EAVTMQMQRLDQARLSCEHELTGIRERL--------AGLALKEQEARLYFEQWAAHLQGV
Q2YBB9_NITMU          EALATELRQIEQERMASEQKLHPLREAI--------NHMRLKEQEARITENQFGEQLQGC
Q0AE88_NITEC          ENTNNTLREMEQARMQAEQQLHKCGEAV--------GQARLREQEAGMTEAQFAGKLAES
D7DI79_METV0          SDCEQALQQQERMRMQNEQLLHPLRDKL--------EASRLSEQEARLYFEQCQAELSAS
C1D4R7_LARHH          HEAEARLRQYTRARTEAEAGLSPVREAI--------SQMLLKAQEARLAFERFDEELREA
Q7NR76_CHRVO          NQLTERMREITQRQHEANAALPALREAR--------SDWLLKHQEARLAMERFAEELAQA
A1KSF4_NEIMF          TQIQEQGREQYARVQTLQTQLPQLQAAT--------QTALLQQQEALINAKRYHQNLTER
A1WY82_HALHL          EHLDHQLREQEQARTEAEQRAERLREGL--------EALRLETGELRVHRSHEADALAEL
Q0AAV4_ALKEH          ANLEQKLRDWGERRQTAVQETETLREEL--------EGLRITAQEYRVLQRREAAELEQL
SMC_XANOR             DSIDSELRSFEQTRQQRDEQALAQRERI--------SQRKLDQQALVLSAEQLSAAVVKA
B8GTL2_THISH          QSIEAQMREHDQRRIAVERQAEEIRGKL--------DNLRMAWQEIQVRRQTLREQLAET
Q3JAH9_NITOC          TRLESQLRTDEQKKHEIGRTLESQRTSL--------ERLRVDRQAIWVRAQTLKEPLQAA
D3RSW0_ALLVD          ETLEAEVRTLEQSRQRAEQAVQANQRGL--------DTVRLERQERLVRQRTLEEQFAEL
B3PGR0_CELJU          ETVEQELRQSEQARHRAEQEVQAVRAHL--------EQERLTAQMFEVQRAGIAEQLAEE
A6V7X5_PSEA7          EDADRDLRDVEKRRSQAEQQSQLLRGQL--------EQQRLEWQGLVVRRKALQEQLAED
Q0VR03_ALCBS          ETVDHEMRNLEGQRGQFERQAQEVRSTM--------EQKRMQWQDLSTRRQTVAEQLAEQ
C7RBE2_KANKD          SEIDDKMRSLERRRHESEQQAQGVRSRL--------EKLRMDWQEAKTRQNTQAEILADA
Q2SD45_HAHCH          ADLEQSMQGDESSRQRNEMVIQNMRSRI--------ESLRMQHRETDIRKNALRDQMAED
E4PL89_MARAH          EEIDREVREKEQGRSGTDHRIQEVRSRL--------EKLKMESQALEIRSGNHVDQLKEL
E1V8E9_HALED          AALVERLREDEQARQGHERQLEGIRERL--------QESRMQVQALALKAESQDEQLREL
D3SAL9_THISK          EACDARLRELATRASELDSRVESQRSTC--------EELRLDQRERSVQIDQLKAQFQES
SMC_METCA             SELEADVRRVAGERQRAEHELAALRESI--------GQMKLAWQTAEVRRQGIEEQFAEL
SMC_COXBU             EEANQLLRHLEEKRVSTQKALNEAQAQL--------EELRMQRQTVSVRQTTIKEQLSEN
Q5WTI1_LEGPL          SQLKLQLEDQEKLILNYDQEVKRIQELM--------NQIQMEKQALSVRASSIQETLDEA
Q12L80_SHEDO          AQVQIELDNVLLTQKQQLGIIEGLTQKI--------GALKLRREGFKGQADGQQQLLDEH
Q080K7_SHEFN          AELQTSLDRLVLMQKQQLVVLQDLTQKI--------STLKLRREGLKGQANGQLQLLQEQ
A4Y804_SHEPC          SSLTETLNSIGIKQKQELGRLEGLTQSL--------STLKLRREGLKGQAESQLAALQEQ
D4ZIY3_SHEVD          TKLQESCDSSGIKKKQQLGKTEDLTQSI--------STLKLRREGLKGQADSQLMQLKEQ
B0TKB4_SHEHH          AELQELCDSAGTNKKQQLAKLEDLTQSS--------STLKLRREGLKGQIDSQLRLLNEQ
A3QFJ7_SHELP          AELQNQADEIGAKQKQQLGKLEHLTQAI--------SALKLRREGIKGQIDSQLAQIRSQ
A1S5R5_SHEAM          AQVQEQIDALLLKQKQEVGKIDHLTHTL--------ESLKLRREGLKGQGDTQLGQLAEA
Q5QUJ9_IDILO          SRLEHDLQQITQGQSAIQVKISQAKEAM--------QSTEIEQAKLQERSQAVLETLAET
E1SMV2_FERBD          EEVNLTLAGLADSQRGQQAQLQAVVADL--------SRHQLEYEGLRVQAQGQLDLLAES
F2GBA5_ALTMD          EDIEQWLREAEKGHQSLGKDIQARQTNI--------DKLAIDIEGYRVRANTILEQLDET
Q15UZ3_PSEA6          GELEHQLAVIEKGQQSINAQIQQMQQDV--------QTSQLACEGYRVRAKSVIEQLSEA
Q3IKC0_PSET1          NQAKESLSTKQASLKSSQGELVALQEQH--------QKLSIEEQSLLIKAQLALEPLEEL
A4SKA4_AERS4          AELERQLTELEQARSVDHKQLLTLQEKL--------ATLRLERERNLTRRQGLHEQFEEL
D0KWM8_HALNC          HEHTQAVQTAGVERHETQVALEKARAAV--------QALELQRAQLAVREDHAGEALTLA
A0A2W1K6W8_ACIFR      QTAGQQIREHESQRHALDKGLRALQKSE--------AAVEQQLAGLQARLDELQQRAAVL
A0A0J1A050_ACIBA      NSVQEKQQTLTDQRHQYQQQDEKLREQL--------EAKRLAWQAAKSDREHYQEQLKEL
B3E294_GEOLS          ETAAAELTTAEHDARLRRDEREAIRQLH--------ADLSLKVSSLTLQREHLEQSLQDR
A1AU91_PELPD          ETALNELAVAEARAKRAREESDSVRQDQ--------AELNLRFSTLSLQLEHLEQALRDR
B9M6F0_GEODF          EFEISAHREDEAKQKKLRELVVTSKEAI--------SNHTLSATQLSMQLSQLETQVLDK
Q39WG2_GEOMG          DGQAEAVRVEEGALRELRVLAEQAKNAV--------ATDRLRQSELTLELNHLVTSLMEK
B5EFS9_GEOBB          ETEAATVQEEELRLKGTRSEASLLRDQL--------NAKSMRLTEVSMRLSHLEETLREK
Q3A212_PELCD          GQQQQQVDAHEESLRVVRGQLQQAREQF--------SSLQMRVREIDMEIAHLCQDIEVR
A9FIZ2_SORC5          DEARQAHGVREADLRGLRQELAEVSERL--------RKHELALERLRVEHDHLIEGVRER
D0LY52_HALO1          DERMVALQADEVLVRELRGRAEGLAGEA--------TQLEVKLGNLEANLYALGETIEDR
Q1D2R5_MYXXD          TTASAEVREQDATFRELRGRVDELMQGL--------SQISLREREIALELEHLAAGIRER
B4UDF6_ANASK          EGLVAASRGREAEARELRGRAEAVRQAC--------AEAALTAREHALELSHLEEQTRER
Q6MNS9_BDEBA          EVMSESIRAIEDEASASQRARNERQHKM--------NDSQLKLEQAKMKEQYLIDQVRER
A9A0M3_DESOH          ENIAAKIVESDRRFAEIRSQRDENAEKI--------RYLEMEQTDRRLQREHLERRIEER
B8FHS3_DESAL          QQIENSLKESDAMQARIKNERESHREKV--------RDLELSQSQRKVRQEAVASRILEK
E1QL74_DESB2          GEIQARAMALEAEIKAARAGQKSIEAEI--------QAHEFKRRELEMRRDQLREQVLER
B3EFQ6_CHLL2          QQSRTIQRELRRKHEVSRELVDQLVQQQ--------SQAEQQLDHLLTSIQVRYGCELKT
A1BDT4_CHLPD          HDAHSKLRDLRRQHEISQQILASLHAEE--------RETAQSLDHLITAIKVKYNTDLTL
A4SG64_CHLPM          QDARNTVREMNRKLDVGRQLQTALATER--------STMHQELERIFTSIKLKYNCELAT
SMC_CHLTE             HDTLSNLRDLRRKHDLSQQMLAEFNNRK--------AKLEQEIAHLQATVMERYGVELEM
Q3ATI3_CHLCH          HTTLATLRDMRRKQEVSRQLLDTLLREK--------RELEQSLDHLLTETRIKYECDLAL
B4S519_PROA2          QETRNAVRELRRSHEIGLQLSAELQQKQ--------MELERGIDNLITAVQTRYSCNLQD
B3EM83_CHLPB          QEKRNSLRELRRKHEVEQQIHDELRRSA--------AEIEKTIDSIFTSVETRYNCSIDA
B3QRZ4_CHLT3          NKNESDLRQAQRQREITSQMIFEFQQQA--------SRLEMKIENLQSVIKSEYDLTLEI
D0MFL5_RHOM4          ERAERQLRDLRRAYEQEQQQERQYQVQL--------AETRTRLTALAEHAREHLDVDDPS
Q2S457_SALRD          EEVESRLRSIRQEREAALEQKNEAAVAL--------TKVETRTQDLLDSMAADFDRDLAD
C7PLU2_CHIPD          QEKETTLRARQRAKEQLEQSLTVIKDKV--------NELKLQLASMKERLSVEFKVNLDE
E4TVF1_MARTH          DEIEKESRNIQRNKEQVDELLMHIQNNL--------NETKLELNSVKERLSVEFDIDLDK
B2KBE7_ELUMP          DEKSTKLNEYKKRQSDMQLRAHDLENAL--------TNYRRQRTTIVNHLMESWNITPEE
B1H0P2_ENDTX          DAKIKEWRGLCGKVDGLNSEIKNMQSDI--------KNFEYQKNNLKKRLAETYGKNYED
E4TEW8_CALNY          EDKMKLVKKIEQELQNIKIRIAQIKTST--------ENLEKIYLEKFNLSIRDEYAEFLR
D3PDY1_DEFDS          KSLRFEFEDCEKQIYNNEIKLAGIRAKF--------DNIREKYFETFHEHIDENYMRYIN
D4H2V6_DENA2          DKMNLHIKSIEDDIFDAEKKMERYQTEV--------SAQTEAFLEKFNDDITSFEMDL--
D6YSC9_WADCW          KQKREDIRRLERELHEQGLQRAQIDSAR--------QALETEFTERFQMSMRDAEFRAKE
Q04TU9_LEPBJ          QKNQNDFKNLIPILTEKERTVSGLKVQI--------DSFTEELYNDYSISEQELVSEFQN
E1R6H6_SEDSS          KQQMDQLGKIQSQVEQLQVNLAGLNAEV--------RNIYDNFRDRHSRDLNEYDSRMFE
Q73ML2_TREDE          DKLNAELSKANSLLEKFHLDLAGIEADI--------RNTKENFREKHSRELMEFEERMFT
A0A0H3BKB7_TREPS      QEARVELAQVGRQLEQAHRELMQCETEI--------RNLREHFREQHTRDLSEFEDLIPG
E0RSK7_SPITD          KQKMGELSRLQEDVERLQVEVARYEEEI--------KALETYFKDQHGRTLREF--LQME
D5EMY0_CORAD          AELEKTLQVATDELEKDRTELKGMDEQI--------AEVDGTLTGRRNQSRTMDQELTKL
B1ZZB8_OPITP          TQLAETLTVAQQQVETVRAELVELERAI--------SGLEGAQISLHTQSEAAHDQLSAH
SMC_DESHY             EVLSKELMDQESLAQKKRQEQQTLEQKL--------HNLELKTARWDAEWETGSRRLLEE
A4J682_DESRM          GAVSENLGNLEKRLQEKQQLWLQTSQKV--------HAMELQQTRIQTELELLKTRLREN
Q67PF3_SYMTH          LAAQEQVNARERE-LRSLRRALSDVQHR-------CQQGQVEEARLAQEQEGLVTRLAEQ
B0TGW8_HELMI          QAEADRGYKETMERRKAVAAEVQPLREK-------VHQLEVQLARLDAEKDTLTQRLAEQ
Q2RJX0_MOOTA          QRLDNDGSACSQQ-QEELARELEELRARKGKIAAHRQQEELNLARLETTLEGSRAELEER
SMC_BACSU             IKLQHGLDTYERELKEMKRLYKQKTTLL--------KDEEVKLGRMEVELDNLLQYLREE
C5D8T7_GEOSW          LQYQTKLEHLEREWKEKKRQHKQLADIV--------KDEEVKLNRLDVELENLLSRLREE
D5DQR5_BACMQ          LKAQNKLEDEERIVKELQRQYKQIADAL--------KDEEVKINRIDVELDSRLQQLTEE
B7IUK7_BACC2          VSLQERVEHLERNLKETTGKHKYIIEML--------KDQEVKINRLDVELENRLQHLRET
Q9KA07_BACHD          KELGGQLEAEEQLLADLGRKRAYMSESS--------RDAEVKVNRLDVELDNRLNQLRDE
Q5WFM8_BACSK          AALNDRYKQLEAETKSAQGEHSYLLEES--------QKLEVRVNRLDVDLDYRLNRLREE
Q7ZAM6_OCEIH          MQQVHYLDQLDEQLKKENHQLEEINERK--------QQAEVKSNRLDVELENRLSQLEKE
D6XTT7_BACIE          FDKESGLEAKEGELKGLNQQVQYLSRTA--------QELEVKINRLDVNLDTKLTTLQEQ
Q81ZN4_ENTFL          QALQEEVDELDTKLAEENKRQQQYLADK--------TQIEVLKNRAEMQLDSSLSYLQEE
A0A0E0UX46_LISMM      AELQEKLELLEAELTQKNNQISFYVEQK--------NNAEISIGRLEVDITNRIDRLQEA
B1HQH6_LYSSC          VGQQNELSTLEAQLKELQRIHKGYLEAI--------RGNELKRNRVEFEMDNFTEQLEEN
C6D303_PAESJ          ADRVKELEQGESDTKEQRGQLRQVEDQM--------RQTEIAANRLDVELDNLLRKLSEE
C0ZFN9_BREBN          ATLFYKQEQVEQQVKEIRREVKSLEEKL--------HQEEVKVNRNEVELDHLLNKLSEE
C8WWA4_ALIAD          HELEAEARELEEDVRRKRRAAEEQEATL--------QRALVAVERADADLSHALAKMGEQ
D5WPA2_KYRT2          LRGAEAVQQAEAAVAARRQGLHRLEQDL--------HTWTIRRERLQVELRHALDDLAEN
C4L5Z7_EXISA          KTNEEAYRIIRQRVDQATEARRQAEAVV--------RKLETAKQEFELKRQWKLDALEEN
B1YIN0_EXIS2          QQAAENLRLLRIQEAKLAEARQATTQRL--------DQARLTQGRLSTRLETRHETLEEM
D3R1B0_MAGIU          KEYEAAKTAWQEERRILRERQNNIRLSA--------ERLSSKVERIEEQRDTLLNNVWET
D2RLB2_ACIFV          EALLAQRQQLTQQGVILQGQEASIRQKL--------HNCEMDQVKKAAEAQHSRQQLQEA
D1BLY1_VEIPT          STGREEMESILSEQDRLNQRYKVVQGRL--------VDMEGKITRHRMDCERFVEELQE-
A5UQ60_ROSS1          SALEQQREAHEVRVQALTTALIDAEAAC--------NRATVDAQRARDRLEVLRERAAGD
B8G556_CHLAD          KTAEAELAELEAAESRATAELLAAEADH--------SRFVREAQRAADRLETLFERAVAD
A9B100_HERA2          NQANLALQHAELQERAASQAFVQAQTSL--------SRAESQLATANTRRDHVWERCAEE
D1C6T1_SPHTD          EDAAAAERAAREAVAGAEQRVRDAERER--------DRATLELERRRDEVNLLRERAAHD
D7CMX2_SYNLT          TGLEEDSRGIEKKLTEERQCCRQLEEQS--------RVVELRIARREADMENQIKLWVDS
Q0AYV7_SYNWW          KGNWALIEKYRQEMIPARESLARLETGV--------RNLEVAAARLEVELDGFKSRWREK
SMC_LACPL             ATLNDQVEELSTQQVRLQQLAAAATDDY--------RRLELSQTKLTGEVDHATADLAEK
Q03RT7_LACBA          TTVNDDLAAAETANQRTSGLLQLANDEL--------QQAQVSQTQLAALIDQQQNQLSEK
B2GD41_LACF3          DQVEADLRQASERAQRLQDLLKVALSDQ--------TRLAAEQAHLETTIDQGLNRLSER
A5VKP1_LACRD          EELEQKLSQAEAHYNRLQELQRAALDDR--------NNLNEERVKYESMVDQALNRLSEQ
Q03FW9_PEDPA          EQNQVQQDRIIADYEITQRQLHQAESQL--------KEIEGSLTLVQSRIEMAIDKLTQE
A0A249N2C3_LACRH      AANRGKLSDISARITTTYDQQHQAMATS--------EQQAVALNRVKLGLDSRLNTLAED
Q38XR7_LACSS          ETLKATQQTLQANATRVYQLQRNSLAEQ--------EQNAVALNRVKINIDQRLTTLRED
Q1WU99_LACS1          KQLHIEVKEAEKQLTRANELQRSAYEEQ--------KKLSIRISQCDTILDRNLKDLSEN
Q04GL1_OENOB          QKLNQEENSLKVEINQLQLELRQLLDRK--------NR---FDTKLATVKSRLDENLQDL
Q03VW6_LEUMM          VALTNSITDLEEQFATQQETLRTLIGSQ--------SQSAAHLARLQTQIENLQTQLLTQ
A0A0U5K8Z4_LACDE      GQLNGQINQLEAVATRNYDLRKDAASEQ--------EELSVKLATVKGQLKQHLDSLRED
E4SKB3_LACAR          GQFDAQINQLDQVASRNYELRKDAAIEQ--------EGYSVQLAKFNSAINQRLETLRDD
Q74IP9_LACJO          GKFDAQINNLDQVATRNYNLRKNTAAEQ--------EEYSARLGELKSQINQKLGILSEE
A0A0T8KIP4_STREE      DDIEGQLDDIASHLDQARQQNEEWIRKQ--------TRAEAKKEKVSERLRHLQNQLTDQ
A4VVL7_STRSY          EDIDGQFEDLEERLQQARTKNDDLIRKQ--------AKLEADCEQAGDKLRTLLGNLTEH
C0MCR5_STRS7          EDYDARLEELEAQLLKEAKKNEEFIRQQ--------ARLEADLEQVIGRLRQHARSLSEE
A2RLZ7_LACLM          EDLAAQMEDLEHHNQDFIQQTQELNTKK--------TRYEMQLEQIEGQLMTLQETLNSE
B9EBB4_MACCJ          EEYIEQEAELEMQSKELVRQINGIENGI--------GDLKVQHSRLDVKLENYLEHLSFT
SMC_MYCHR             TNLISEQGKGETKKQELDAKLRKLNTQH--------SDSITEQNRAKFLVEQNQKRLSEH
E0TKT8_MYCHH          TNLISEQGKEETKKQELDAKLRKLNTQH--------SDSITEQNRAKFLVEQNQKRLSEH
Q4A770_MYCH7          KQLDNQISELTVLVQELNQKQRKINADL--------NQNQNYKDKYEFLITNLRNNLSQK
C5J708_MYCCR          DRINEQINQLSILNQQLGNQQRKTNNAL--------NEKKNDLNKVELILDNLNIRLTQK
A5IYM7_MYCAP          NALAQEINSGQVLKSDFESTLRKLLESF--------SEKLSEKEKSKVFLEQSRERLASQ
D5E4P4_MYCCM          DNLNAEINSLSISKNDLEKNLRDLNSSF--------SKKIAMQERAKIYFEQSRERLISH
Q6KHN4_MYCMO          ESLIKEISYLNTKKFDQEKQLRNFESTH--------SASENEKNKFEILISSLQKRLGEH
Q98PK8_MYCPU          LSLNTDFSKVTLEKNDLEKSLRILNDSF--------SKKITEKNKAEFYLDTNQKRLSEF
D1J8Q8_MYCHP          HNLKQELQNLTNQRFQVSEELNNLIKDN--------ANKIAEKAKAETIIQNAKQRLSEQ
Q4A588_MYCS5          EQIVAKLDDISILLKSKQKDLDKLRQSF--------SKNEVKFEKNKTYLENHKSRLLEE
SMC_MYCGE             LQLAKTIKQSEEKIVDLRALLDEQRAKL--------VSAREGKIRFENTIQNITEKINSV
SMC_MYCPN             ETLAKSIKLAEAKTADLRALLDEQRSQL--------VLAREGKIRFENTIHNITDKINGG
Q7NBU0_MYCGA          DMYQKQVNQLEKDVTLFYKEIDEDKNDK--------LKRREQLTKHENTIYLAKSKINES
Q8EVS6_MYCPE          RELKKTINDLETNIDQNRKLLNESTDVI--------VELTETEVRSKSVLEVSKQKLNDT
Q9PR04_UREPA          NTANLNKNELEITYNKELEDFYNLDKNI--------TSCESNIDNLNYSIQNVQTRLVDN
Q6F1N4_MESFL          TKTTDRQHELNKENKEKRETLNNWKDEL--------ANVKSDLTILESTNIQILKRLSEG
Q6MTD2_MYCMS          NQSMEKQKEMNSKNSKKRDELDELKTHA--------GSINTEYNVLLQRRITIIDRLSNG
E3GP81_9FIRM          REQTAISEALEQEIKDLNHQLILQNETK--------NNAEMAKNKLEMQMTHWEENIFES
SMC_HALOH             EEKQQRIDMLQREVSDLQTRLDKKKDEK--------HQIELKITRLENRNERIVEILEND
E4RL35_HALHG          SELEDEVEEKESEIKEIQASLNELKDDF--------HKLDLNYNKLKSQLESIEKILEED
D9QRN7_ACEAZ          EGLTAEIKEIKEKSQGIRKELEEIQTEH--------NEYEVKEAQLEMELESIEEKLVDS
A8MHB7_ALKOO          EIHQLKESEYKKLLKQIETILLELQDSM--------HKLDVKRTRLEMQQQGYYTKLWEE
A6TRT3_ALKMQ          IDLLQHASQQQEALENIERVISELLDSI--------HKLDVKRTRLEMQQQSVYNKLWDD
A3DDY2_HUNT2          KIREEESAGIIDQITEINKNILLLQEEY--------SRIEVKKAKLESEMESIQNRMWDE
D5X8N2_THEPJ          DHLAGQIELKETSAKNANRQFASLQNQI--------HSLEVKKTKLEAEMENEQNKLLEE
D9R048_CLOSW          EASSREQKALFQKREELTGRISLLDKEL--------FRLQSQKEKLEEWMESHVNYMWNE
C4Z0E6_EUBE2          DIINASHKTFFDKREKINEQIVLLEKES--------MRLHNQQEKLEEENDSIVDYMWNE
C4Z924_AGARV          EKMSEDYRGFFAKQEEVSKKQADLDKEL--------FRLNSQREKLKEASETQTNYMWDE
E0RV40_BUTPB          GELTEAQKEFFGKTEELNNQMSSLDKEV--------TRLTSKKEKCKEAIESQINYMWDE
A9KLR0_LACP7          DIMSQNHKQFVKIREELQNRISLLDKET--------FRLQNQKEKLTEILDAQISYMWEE
D9S347_THEOJ          EEVEGKIQAIQKDLERLQREEKKAENAL--------GEYRVSEASLKIEIEHIEARLMEK
B2A2N3_NATTJ          ENTRETLSEKETRQKELAKQEKEIDQQS--------SQLKMKKSRIETELSNILERLDEQ
A8F8R1_PSELT          DQKFNKLNELEKKMQQMKEDREKLRDYL--------HHLELSIQESQAKIDQLINEVDRE
A5IN04_THEP1          EEKMRELQEVENRMNELKEEKEGLRNHL--------HQIDLALQETRLKIANLLEEFSGN
C5CIS4_KOSOT          EERLNALQELESEIEALKSEREQKREKL--------HQFDLLIQESKMRLEQLEKEL-GE
A7HMD4_FERNB          EEKLQKLEQLEKELRDQKTEIESIKERI--------HETEMRLQEISFRISNIPEEYRTP
B7IHN5_THEAB          NDKVKELKEIEEKMEKLREETEKIREKM--------HSLELEIQAKKMKIENIDEKYRKL
SMC_THEEB             GHLKGDRDRHEYQLRQQQKNYQQLEWQY--------QKASETLT---TLQAQLQELSTIE
Q2JHS4_SYNJB          SHLRQERDRQEFQLRAQQQQIQRLEWER--------YNALTQQQEKEALLAQLQTQLQAV
SMC_SYNP6             GQEKVDRDRTERQLQEQRSQRQNLVWQQ--------EKRQQQQQELQQQLTDLEVQLQAE
B0C9C4_ACAM1          GSEKQERDRVEKHLQERTAAHQQLLWQI--------QKTQDKQQEHQDLIQQLQTQLQAK
Q115J3_TRIEI          GTEKQKRDEAEANLRELYLAKQGLEWQL--------QKLQESQQGRREQLVPLQILLEEQ
B2J925_NOSP7          GEEKQKRDATELEVRSHLLRQQQLQWEI--------EKLKETQEKRREELIALQSQLRDM
E0UKI1_GLOV7          GETKKERDRTEAALRSLQTQQQKTSWSL--------EKLLQTQQERKAALESLEQQLENQ
B7K4Q6_RIPO1          GQTKKDRDRKEETLQSLQKNQQQKAWQL--------EKLETTQQERKEALITLEEQLESQ
B0JSN6_MICAN          GETKQKRDQLETVLRQQQNQQQQAIWQS--------EKLVNNQEERQALLTTLQTEISQL
SMC_SYNY3             GSTKQERDRLETQLNQLRSQQQEQQWQW--------EKLQTNQQEYQENLTQLQTQLEAL
Q84EC7_SYNP2          GDVKKQRDQAEVQLKNLQKQHQDSQWRL--------EKLQTQQQERAQQLEKLQQHLQAQ
D3EQ04_ATETH          YVTKNKRDSLEEKIKVLEKEYQDHIWTL--------EKLQAKQKEKQEILSTFEKDEKEA
SMC_GLOVI             VDIKRERDRLEAHGRALQQRQGQLNLQR--------EQERLHQGQRAAALAAAQERLDEL
A5GQT1_SYNR3          GEQRRARDAAEARLAGLRQQQQQREWEL--------QRLAEQIEALAEERRALGERLQQQ
A9B9B9_PROM4          GQKRQERDKAEADLANQRQKLQDLQFKF--------ERLKEEILSVNEELRHSHIRLNEL
A2BNJ6_PROMS          GLLRRKRDELNSSISNKRQEYNNYLLKL--------EYLERDMHSLKEEMRSEKIKLENY
Q46EX0_METBF          IGLQQEREKVQAEHNAVKRRVSISSTTL--------EKAKQQVLTLKATKNALLDQEKQF
D7EAF5_METEZ          KELQDERANKQTEYDNLKKDYNSIKSKF--------ENASNRLQALESTKSSLKEQIDEL
D1YW78_METPS          AGMKKQRDEMSDALTAADHDLYDARRSL--------ERLTGMLNSLEIAREESLDKIKVF
A0B8B9_METTP          HGLKGERGSLMESIIGKEREIGGMERSI--------ERLDARLTAVSGAREEISISMQSL
D4GT30_HALVD          VDLKEDRTELQDDLREARSARDEKKDRV--------NAVESKLESMRSAAERLEWEIDEL
A7IAD8_METB6          DELRKKRAGISDSIHASETKLIKFDSDK--------ERFTIQLSALEERATALANEIASL
A3CWK7_METMJ          AGLHEKRDRILEEIRVLDQRALELSGAM--------ERIRMQISALEERERSLLAELAVL
B8GG37_METPE          EVLQEKRSGIATQIQESEHRLIEFDTGI--------ERVKLQITATQERVAVVSSEIAVI
E1RII6_METP4          NALHEKRDDLNEKILGVEKIVITFEAEV--------ERKDLQIHSLGEKEKEVLQNIDEL
Q2FLH3_METHJ          EDLRSERSLLSNKADSFDLEIREFSGKK--------DRVLLKIESMEEKLSALKSEIAEL
A2SS75_METLZ          EQLTEERNKAQHAADEAQLRIVTLQGDE--------ERCNVQISAFDEKSASLALEMSEI
D3RYW2_FERPA          KDLRAKRDEIFERMRKREAEKKEIEYRI--------VALTEKLKARKEVEEKLKAELATY
O28714_ARCFU          KGLRKERDELIKQLRNAEEEKRKIEAEI--------DRLEERIKLQKERLEIAESEIAEI
D2RFP2_ARCPA          GDLREKRDELLKEIDKLEKEKSQKTLAE--------KLLEERIKDLKEKLADVEKTLESY
SMC_THEAC             GNLSAQVREADKQIREMENGINDAKASI--------DLKNDLMNDLKVKAGILEGNLSSI
Q97AI9_THEVO          SDIASKIKDMENEMKEIRSKIEEINSDV--------EIKRSILSELKVKRSVVADRNSAI
SMC_METVO             KDLTDKKECYELEIENLQNNKEELREKA--------TDIDNQVNVINVDRAKYETRLEEE
A6UQ42_METVS          RELTEKKECYENEIEKINIEKRKLYSKI--------NQNETQINSLSIDRAKYETKFEEE
A6UVP1_META3          KELTEKKEKYEQEIENNNNTKRELEEKI--------NNINSEINSLLIDKTKYETLLEEE
SMC_METJA             KELTEKKEQLEKEIETLERERREILRKV--------RDIENRINELMVEKAKYESKLEEE
C9RFQ3_METVM          KELTEKKEKIENEIETLEHEKKKLLQKI--------KEIENEINELNVEKAKYESKLEEE
D5VT24_METIM          KELNNKKRSLEEELRELEIKREELLREI--------RDIEKEINKLHIEKAKYESKLEEE
D3SQ87_THEAH          DALEDELRQLTSFLGMLRMEREKKEEEL--------HQMDKEKVRWEERYEEIKGRLREL
D3DG53_HYDTT          DKLEDVCRDLQASIGGLRMQEETKREEL--------AKYEMEKAKLEEKLNETTKKLRDL
SMC_AQUAE             EELEKEILNLKSKLGKLKIKEEELKEKI--------FEKEKNLKVLEEKIENLNEELKEY
B4U7R1_HYDS0          ELLEKEQKNLQSELGGLKLEHERLLEEI--------GSLSNDITRIQTKIESINEALKEK
C0QSN8_PERMH          DELIEEIEERKEELKSLRYEEENINKEI--------TYLLEDKGKLEQKVEDLKDEIEIL
B2V736_SULSY          EKLINTISNLKDQLKNLRYEEDNINRQT--------TLLLQDKAKAEQKIADLEEEIILL
SMC_PYRFU             RTLREKRKKLEEDISKLREKKEVLQRKL--------QELEIEANTLKVRDAQLNAQLEEK
C5A612_THEGJ          KELRERRERLRNEIAELREKKDELSSKL--------QELRIEANTLKIRIGQYEAELEEK
D1CC09_THET1          ESLRESLITITNQIASSNNELSSLNDSL--------QDACTLLEHLERQKSDLIHACQRE
D3TAQ9_ACIB4          KDLVDERDKLVKNKERIVKEISKKEGDI--------KVKDSLKIHIIAKLNEEQGKYEEA
SMC_HALMS             QEREDEVKELSKKIAKNEKDITEYELKINQWQNDEVEVVKNIFEKYQIDLREAIGGFLEY
Q6L0R1_PICTO          ESKKRYYYELEKRQKEIDDSINENNIII--------VNMKSRMENISLKINEINSSLNGD
C1A7M6_GEMAT          AAANAALDGCETALDEARRRASALGEQL--------HGAQLRHTELSGRREAIRQRLETE
C9RN51_FIBSS          DLVSGDLEGWRDEVNRLRDDMIEKMKEL--------NDVGRRQESLQNNLDRLRERITNE
D1B5Z0_THEAS          TDLRGRLERVRGRMASAMEALGGVDMAL--------EGLSREEGALCRELEELISSHEES
                                                                                  

SMC_FUSNN             V------EITAQVI----------------------------------------------
E3H7H1_ILYPC          V------EAESKVV----------------------------------------------
D1AK68_SEBTE          QSEEINDEEYEEIS----------------------------------------------
SMC_CLOK1             MNITCDGDIEYDVQI---------------------------------------------
D8GS00_CLOLD          IKITYEEALKYKKDI---------------------------------------------
Q97IA1_CLOAB          FKLTYSEAAEFKEEI---------------------------------------------
A0Q0Y7_CLONN          MELTYAEALEFKIQN---------------------------------------------
Q895M7_CLOTE          EVNSYEEALEYKKPI---------------------------------------------
Q0SSA4_CLOPS          FNTSFEEEKNRFKPI---------------------------------------------
A6LSM4_CLOB8          LELTYAEALDKCEPV---------------------------------------------
D9SLC7_CLOC7          FNLTLAEAYEYKVEN---------------------------------------------
D7APA8_THEM3          YELTLDRAFEEAEE----------------------------------------------
Q8R9W7_CALS4          YNLALEEIIKEEKE----------------------------------------------
D9TN88_THETC          YEITIGNAKSYLID----------------------------------------------
C9YKI7_CLODR          YDMTLVQALEIKDE----------------------------------------------
E3PS49_ACESD          YSMELDDAIKLLDD----------------------------------------------
B0S1M4_FINM2          INELYDINIDTIDSN---------------------------------------------
Q3AC59_CARHZ          YDIVLGD--EEVLKL---------------------------------------------
E4SF58_CALK2          FNEEINT--SNREVF---------------------------------------------
SMC_RHOBA             YQIDLRNDEPPEELAEIEDR----------------------------------------
D2QWB0_PIRSD          YGIEIAELCASSTAEELEQR----------------------------------------
D5SU17_PLAL2          GHPQPAELAASEHSALKNYR-EQRLSAHHETASSEE------------------------
SMC_KORVE             LSVTRPDLMAIEELPRLTGD-EL-------------------------------------
C1F1T5_ACIC5          LGMEASALRAEEGIAPLEGE-AL-------------------------------------
Q01Y77_SOLUE          LGCPVEELGARDETVP-DGE-AI-------------------------------------
SMC_MYCPA             FGMAPADLIAE-----------YGPHIALPPSEL--------------------------
SMC_MYCTU             FGMAPADLITE-----------YGPHVALPPTEL--------------------------
SMC_MYCLE             FGIAPVDLIAE-----------YGPQVALLPTEL--------------------------
A4FMG9_SACEN          FGIGLDDLVDE-----------YGPTVPVPPSPA--------------------------
C8XH72_NAKMY          FAIPADELIAA-----------YGPSNPVPPNPQ--------------------------
D7GEI0_PROFC          LGMQADALVDE-----------FGPDKPIPVLTR--------------------------
Q2J6Z3_FRACC          HGIDADDLVAE-----------FGPDTLVPPDEP--------------------------
A8L599_FRASN          HGVAADDLIAE-----------FGPDVPVPPDEP--------------------------
C9Z3S1_STRSW          LGVEPEGLIAE-----------YGPDQLVPPSPP--------------------------
D7CC86_STRBB          LGVEPAGLIAE-----------YGPDQLVPPSPP--------------------------
B1VYX5_STRGG          LGVEPAGLVSE-----------YGPDQLVPPSPA--------------------------
E4NHH3_KITSK          FGIAAAELLAG-----------YGPDQPVPPPPP--------------------------
C7QGY1_CATAD          HGVEADVLVAE-----------YGPEVPIPPTV---------------------------
A0LV82_ACIC1          FGVDADTLVAE-----------YGPHVPVPVAAE--------------------------
A0JXV4_ARTS2          LGLSPDQLVAD-----------YGPDQLVPVPAG--------------------------
A1R7H8_PAEAT          LGLSAEQLIAE-----------YGPDQPVPLPPG--------------------------
A6W7T9_KINRD          LGTDPDVLVAE-----------FGPDQLVPPSPP--------------------------
D1BJA3_SANKS          LGTDPDVLVEE-----------FGPHRLVVDAEV--------------------------
C7NGM6_KYTSD          LGMEAEVLVAE-----------YGPENEVPVLDD--------------------------
B2GFM7_KOCRD          LGMTPDFLVDH-----------YGPHLPVPDADA--------------------------
E1VVN2_GLUAR          LGYTPDHLIAH-----------FGPDQLIPEALD--------------------------
A5CQQ2_CLAM3          LGLGEEVLVAE-----------YGPDVPVPEEAPLPPRQRPRAPV---------------
Q6AE90_LEIXX          LGLVEEVLVAE-----------YGPEVPVPVD-----RGR--------------------
D1AB24_THECD          LGLEVDVLIAE-----------YGPDQPVPPPPDA-------------------------
D6Y659_THEBD          FSLDVESLIAE-----------YGPHVPVPGDP---------------------------
D7BMZ9_ARCHD          TGMEAATLIEE-----------YGPHRMVPDTDG--------------------------
D6ZIF1_MOBCV          CGLDETTLLAQ-----------YGPHNLVPVFDE--------------------------
C7R311_JONDD          FGFDAEQLIDQ-----------YGPHQYTPNYRE--------------------------
D6ZV06_BIFLJ          LGLTLEELVSD-----------YGPEQPVPVLDDE-------------------------
Q7ZAJ9_COREF          LGVPVAELLRD-----------YTPD----------------------------------
Q8NNW5_CORGL          LGIPVAELLRD-----------YTPD----------------------------------
Q84F13_CORDP          LGIAISDLMRD-----------YTPH----------------------------------
Q4JUZ1_CORJK          LGLTAEQLLAE-----------ELP-----------------------------------
C4LJD3_CORK4          LGLNPEDVVAS-----------QDL-----------------------------------
D6Z8M0_SEGRD          FGMTPADLVAE-----------FAEED---------------------------------
C8WGU5_EGGLE          CKVPLDRALET-----------PELE----------------------------------
C7MMZ7_CRYCD          CATPLETALSL-----------PELD----------------------------------
C7N560_SLAHD          CGVPLDVALET-----------AEPE----------------------------------
E1QVK5_OLSUV          -GYLLEDALEL-----------PEPE----------------------------------
C8W740_ATOPD          -GASLDEALTL-----------PEPE----------------------------------
SMC_RHOPA             EREIRDMLEV-------------EPQAAAQLAE---------------------------
A7IGT2_XANP2          LREISDILEG-------------PPELAREQAG---------------------------
B8EMM7_METSB          ARQIAAELDC-------------GPEDLPALAK---------------------------
B8IQU0_METNO          TRSIADTLDT-------------NPEGLRPAAG---------------------------
Q92RE8_RHIME          EARILEALSC-------------APHEVMRLTG---------------------------
A7HQY9_PARL1          EARIREVLEC-------------EPAEALAQAN---------------------------
D8JUP9_HYPDA          ARHIRETFEV-------------APEDCLAIAA---------------------------
E3I0B2_RHOVT          ANAIRDTFEC-------------QPPEILSAVG---------------------------
SMC_RHOS1             AERIREETER-------------TPQQLLEALA---------------------------
Q2W040_MAGSA          AVRIGERLDM-------------TPEQLREVAG---------------------------
D3P3X3_AZOS1          TERIAERLDC-------------RPEDTRAAAD---------------------------
B6IR58_RHOCS          RERVQERLDC-------------EPEKVLDVAG---------------------------
Q2RPA2_RHORT          AAAIAEKFDC-------------APEALAGQAG---------------------------
SMC_CAUVN             ASAIREQARM-------------EPEELGRHVA---------------------------
B0T003_CAUSK          AGHIREQARM-------------EPEELGRHLA---------------------------
Q0AMJ6_MARMM          TERLQDATGE-------------APGTLSTRFD---------------------------
E0TC69_PARBH          ASRAHELHEG-------------DPDGLLTVAG---------------------------
C6XRC2_HIRBI          SENIKARFELDFDALEKLNA-SFSPENLTAENDQDI------------------------
Q0C0X5_HYPNA          VEVARNHFQR-------------TPEGLLAIAEGHL------------------------
Q1GQU3_SPHAL          GRLSGERFEC-------------PPPLLPQKAG---------------------------
D4YX43_SPHJU          NRLSGERFEC-------------PPPVLPEKLG---------------------------
Q2G9S3_NOVAD          AGISGERFQC-------------PPPLLPERFG---------------------------
D5BSU5_PUNMI          KDRIHEKLDC-------------TPDQIAEIAN---------------------------
A5FVJ2_ACICJ          AEKMLERLGV-------------DPALPAVAD----------------------------
C5B6I7_METEA          LERVRERFEG-------------RVDELASIAG---------------------------
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          PPVEGE------------------------------------------------------
SMC_THASP             RADEAALAPLLAAEP---------------------------------------------
A1K715_AZOSB          QADEAALAPLLTPDL---------------------------------------------
C7RKG8_ACCPU          NADEESLAADVVGA----------------------------------------------
Q3SJI0_THIDA          AADEASLESGLADSP---------------------------------------------
SMC_DELAS             GADLAAVSQSIAEAN---------------------------------------------
D6CTE6_THIA3          QADIEAVRASLP-TD---------------------------------------------
SMC_BORPD             EVDREALAQELAAMP---------------------------------------------
SMC_BURP1             EVDEAALKEKL--MP---------------------------------------------
A4SYV7_POLAQ          EADLIALEANFSSDL---------------------------------------------
D5CRW3_SIDLE          D--EEPLLPLIEGAK---------------------------------------------
D9SGR3_GALCS          D--ESALLPQLAKAR---------------------------------------------
Q2YBB9_NITMU          EIPEEELINSLGKTR---------------------------------------------
Q0AE88_NITEC          GEITSEMLQQSINES---------------------------------------------
D7DI79_METV0          QLSEAELTEHLTANG---------------------------------------------
C1D4R7_LARHH          GADEAALVALLPEAK---------------------------------------------
Q7NR76_CHRVO          EADEAALLADLNEGV---------------------------------------------
A1KSF4_NEIMF          AADLDALEALAKESP---------------------------------------------
A1WY82_HALHL          GESEADVAERLAEDA---------------------------------------------
Q0AAV4_ALKEH          GEHLEVVASRLPEGA---------------------------------------------
SMC_XANOR             GFVLEDVVNGLPESA---------------------------------------------
B8GTL2_THISH          PFSAEELLQALEEGA---------------------------------------------
Q3JAH9_NITOC          GFSPEEILREMSEES---------------------------------------------
D3RSW0_ALLVD          GASQGAILESLDPAA---------------------------------------------
B3PGR0_CELJU          ELNLDIILAEMPDGT---------------------------------------------
A6V7X5_PSEA7          GYELHTVLANLPLDA---------------------------------------------
Q0VR03_ALCBS          NFDLDTVLENLPDEA---------------------------------------------
C7RBE2_KANKD          KANVETLLEELPEEA---------------------------------------------
Q2SD45_HAHCH          QYDLENVIGLLAEDA---------------------------------------------
E4PL89_MARAH          DVKLQDILAQLPEGA---------------------------------------------
E1V8E9_HALED          GHDADALAESLDPNA---------------------------------------------
D3SAL9_THISK          GFATETLAEGLAEDA---------------------------------------------
SMC_METCA             GAAPAAVVAGLPEDA---------------------------------------------
SMC_COXBU             DFDLEQVMAELPEEA---------------------------------------------
Q5WTI1_LEGPL          NLQAQSLLERIPSGV---------------------------------------------
Q12L80_SHEDO          KVDVSAVARQLKPDV---------------------------------------------
Q080K7_SHEFN          QIQLQQVIADIPEHA---------------------------------------------
A4Y804_SHEPC          QIVLSQIINTLPAEG---------------------------------------------
D4ZIY3_SHEVD          DIELEQVKSSLDLKK---------------------------------------------
B0TKB4_SHEHH          RVDVELILSTLDDKK---------------------------------------------
A3QFJ7_SHELP          EVDIAEVQATLDLTV---------------------------------------------
A1S5R5_SHEAM          NIRLNEVLPSVPPHA---------------------------------------------
Q5QUJ9_IDILO          GLTLKNILEELSSDA---------------------------------------------
E1SMV2_FERBD          EMQLKGILESLSAEA---------------------------------------------
F2GBA5_ALTMD          KQSLKTILETLPDEA---------------------------------------------
Q15UZ3_PSEA6          KVQLQPLLEAIGENS---------------------------------------------
Q3IKC0_PSET1          KQNLKQVLDELPETL---------------------------------------------
A4SKA4_AERS4          GVRLVDLDQAVLIAA---------------------------------------------
D0KWM8_HALNC          LDQWRDDQQSLDAEAIKR------------------------------------------
A0A2W1K6W8_ACIFR      AQDLGDD-----------------------------------------------------
A0A0J1A050_ACIBA      NAELQTGLKIDLTEH---------------------------------------------
B3E294_GEOLS          HR-IGLSEVRERLGEQTL------------------------------------------
A1AU91_PELPD          HR-LAMDEALVRLEAVRF------------------------------------------
B9M6F0_GEODF          FR-TGIADILPKYGNIEY------------------------------------------
Q39WG2_GEOMG          YR-LEMLPLLPKYADTPF------------------------------------------
B5EFS9_GEOBB          HR-MEIADALLNYSKVEW------------------------------------------
Q3A212_PELCD          FR-LDLSQGDAVVPDEAF------------------------------------------
A9FIZ2_SORC5          FRGLELARVVGDYHKRPP------------------------------------------
D0LY52_HALO1          YQ-VNIAVDLFDYHLRPP------------------------------------------
Q1D2R5_MYXXD          HQ-VELANELHKYHMLAA------------------------------------------
B4UDF6_ANASK          CQ-AELRWEVGRFHLEKP------------------------------------------
Q6MNS9_BDEBA          YM-LNLPDVVEKYVNREG------------------------------------------
A9A0M3_DESOH          YGTAFEAAAGQYIPLLAE------------------------------------------
B8FHS3_DESAL          LGRPLTQARNDEGLPDVS------------------------------------------
E1QL74_DESB2          CRVDLAQDLATHLPAGPF------------------------------------------
B3EFQ6_CHLL2          VEPSELPHD---------------------------------------------------
A1BDT4_CHLPD          FETPPPEEP---------------------------------------------------
A4SG64_CHLPM          MERPIKEEP---------------------------------------------------
SMC_CHLTE             M-PAHVPEG---------------------------------------------------
Q3ATI3_CHLCH          MEEPPIART---------------------------------------------------
B4S519_PROA2          IDTEPPLD----------------------------------------------------
B3EM83_CHLPB          IDIEAPEN----------------------------------------------------
B3QRZ4_CHLT3          KAFSDDDE----------------------------------------------------
D0MFL5_RHOM4          R-LPEPPAD---------------------------------------------------
Q2S457_SALRD          D-PVSVPEA---------------------------------------------------
C7PLU2_CHIPD          IIDEQRS-----------------------------------------------------
E4TVF1_MARTH          IMNSQEEEVE--------------------------------------------------
B2KBE7_ELUMP          AAMKFTNKE---------------------------------------------------
B1H0P2_ENDTX          IKNDFEGVD---------------------------------------------------
E4TEW8_CALNY          DTININE-----------------------------------------------------
D3PDY1_DEFDS          ESFSQKR-----------------------------------------------------
D4H2V6_DENA2          TDFQPNK-----------------------------------------------------
D6YSC9_WADCW          LEESMEK-----------------------------------------------------
Q04TU9_LEPBJ          RNLERTK-----------------------------------------------------
E1R6H6_SEDSS          IREDAKD-----------------------------------------------------
Q73ML2_TREDE          ITSSVND-----------------------------------------------------
A0A0H3BKB7_TREPS      IEKTASD-----------------------------------------------------
E0RSK7_SPITD          VQENPGD-----------------------------------------------------
D5EMY0_CORAD          EVRLAEERSQIGFIQTAAQD-EYQMDLGGINWKAELWEADLEFE--KRVNLDEMDD----
B1ZZB8_OPITP          EVKLAETRQRTQFLVEEVTR-EYQTDIGTLDWKQQLWHADDEPEGVKPIDLDEDEDEAGE
SMC_DESHY             FDLTWDEA----------------------------------------------------
A4J682_DESRM          -GIEDPSQ----------------------------------------------------
Q67PF3_SYMTH          YELTAAEA----------------------------------------------------
B0TGW8_HELMI          WDLSPEQA----------------------------------------------------
Q2RJX0_MOOTA          FGPGWQEV----------------------------------------------------
SMC_BACSU             YSLSFEGA----------------------------------------------------
C5D8T7_GEOSW          YMLSFEAA----------------------------------------------------
D5DQR5_BACMQ          YEISFEAA----------------------------------------------------
B7IUK7_BACC2          YTISFEAA----------------------------------------------------
Q9KA07_BACHD          YELSYDLA----------------------------------------------------
Q5WFM8_BACSK          YELSYEAA----------------------------------------------------
Q7ZAM6_OCEIH          YTTTYERA----------------------------------------------------
D6XTT7_BACIE          FEITFERA----------------------------------------------------
Q81ZN4_ENTFL          YSLTFEAA----------------------------------------------------
A0A0E0UX46_LISMM      YLLTPEQA----------------------------------------------------
B1HQH6_LYSSC          YQLTFEEA----------------------------------------------------
C6D303_PAESJ          YELSFELA----------------------------------------------------
C0ZFN9_BREBN          YEMSYDLA----------------------------------------------------
C8WWA4_ALIAD          FGMTYEWA----------------------------------------------------
D5WPA2_KYRT2          FHMGFERA----------------------------------------------------
C4L5Z7_EXISA          G----LVA----------------------------------------------------
B1YIN0_EXIS2          G----LVA----------------------------------------------------
D3R1B0_MAGIU          YNITLLQV----------------------------------------------------
D2RLB2_ACIFV          YGLTEETA----------------------------------------------------
D1BLY1_VEIPT          LGFTLEDA----------------------------------------------------
A5UQ60_ROSS1          AIDVESAA----------------------------------------------------
B8G556_CHLAD          GVDLTKPP----------------------------------------------------
A9B100_HERA2          NIDIEQLDLR--------------------------------------------------
D1C6T1_SPHTD          LGEEVDID-A--------------------------------------------------
D7CMX2_SYNLT          YGEEYVPG----------------------------------------------------
Q0AYV7_SYNWW          FAAEAAFP----------------------------------------------------
SMC_LACPL             YQLTVAAAQADV----SGL-----------------------------------------
Q03RT7_LACBA          YQLSLAAAEKDI----SDL-----------------------------------------
B2GD41_LACF3          YQMTLDAASQDM----ADL-----------------------------------------
A5VKP1_LACRD          YSMTIDEARQQM----SKL-----------------------------------------
Q03FW9_PEDPA          YEQTFESVQNVII---QNI-----------------------------------------
A0A249N2C3_LACRH      YQLTYEAAKAAVAA--DHA-----------------------------------------
Q38XR7_LACSS          YQLSYEAAKSALQA--SDL-----------------------------------------
Q1WU99_LACS1          YGVTFEEVEHQI----SEK-----------------------------------------
Q04GL1_OENOB          KDIGEPDISKLDLL--EKE-----------------------------------------
Q03VW6_LEUMM          YDVGDVEALYQKVA--DM------------------------------------------
A0A0U5K8Z4_LACDE      YSLTYEAALSQAKLENTEE-----------------------------------------
E4SKB3_LACAR          YSLTYEAALAQAEGENDED-----------------------------------------
Q74IP9_LACJO          YSLTFEAALQLSEGQNTTD-----------------------------------------
A0A0T8KIP4_STREE      YQISYTEALEKAHELEN-------------------------------------------
A4VVL7_STRSY          FKLSFEAAQSQAKEVEN-------------------------------------------
C0MCR5_STRS7          LQLSLEEAKEQASPINDT------------------------------------------
A2RLZ7_LACLM          HQISFEEAQATAKIVDD-------------------------------------------
B9EBB4_MACCJ          YEMTYEAAEDYIFEHRLTVDD---------------------------------------
SMC_MYCHR             YKLTLEAA-SEQYSLDLDI-----------------------------------------
E0TKT8_MYCHH          YKLTLEAA-SEQYSLDLDI-----------------------------------------
Q4A770_MYCH7          YSLTFESA-AQKYELEIQE-----------------------------------------
C5J708_MYCCR          YNLTFEAA-SQNYILDIEI-----------------------------------------
A5IYM7_MYCAP          YKLTLESAEAQGYKLEMSY-----------------------------------------
D5E4P4_MYCCM          YKITVENA-IKEYKLSISI-----------------------------------------
Q6KHN4_MYCMO          YEMTLEIA-RQTHVLEIPI-----------------------------------------
Q98PK8_MYCPU          YNMTYEMA-KDNFSLSIDI-----------------------------------------
D1J8Q8_MYCHP          YGMLFEVA-KQFYNPDIDF-----------------------------------------
Q4A588_MYCS5          YGLTFEFA-RDNFKLNIEI-----------------------------------------
SMC_MYCGE             YKMTMEFAIANH-NKPVKLS----------------------------------------
SMC_MYCPN             YKLTMEFAIANY-NKPIKLS----------------------------------------
Q7NBU0_MYCGA          YNMAIEFAIENY-NKPLPIS----------------------------------------
Q8EVS6_MYCPE          YKMTIENAIEKY-SQPLEIS----------------------------------------
Q9PR04_UREPA          YKLSVENAIETYQNQEIDMS----------------------------------------
Q6F1N4_MESFL          YNLSLDAIREMH--FDEIEN----------------------------------------
Q6MTD2_MYCMS          YQITEETALTME--VENIED----------------------------------------
E3GP81_9FIRM          YDMNFVMVGDIYEALSQED-----------------------------------------
SMC_HALOH             YDVKPEDGFDD-------------------------------------------------
E4RL35_HALHG          YDLTAKEIDESQLM----------------------------------------------
D9QRN7_ACEAZ          YEVEIEAEIDD-------------------------------------------------
A8MHB7_ALKOO          YELTYAEAMNF-------------------------------------------------
A6TRT3_ALKMQ          YELTYNKAIEI-------------------------------------------------
A3DDY2_HUNT2          YELTYTNALEL-------------------------------------------------
D5X8N2_THEPJ          FGLTYEEALLQ-------------------------------------------------
D9R048_CLOSW          YELTYSTAEELRN-----------------------------------------------
C4Z0E6_EUBE2          YELTYSYAAELRS-----------------------------------------------
C4Z924_AGARV          YELTPHAAAELRN-----------------------------------------------
E0RV40_BUTPB          YEITLTDAAELRD-----------------------------------------------
A9KLR0_LACP7          YELTVSTATEYQE-----------------------------------------------
D9S347_THEOJ          YSMSVKDALGLK------------------------------------------------
B2A2N3_NATTJ          YDMEPQEALNHK------------------------------------------------
A8F8R1_PSELT          TAMNTEELSGDV------------------------------------------------
A5IN04_THEP1          EE-DVEELGEEK------------------------------------------------
C5CIS4_KOSOT          VEGEIPVLSDEE------------------------------------------------
A7HMD4_FERNB          ID-----VEPEK------------------------------------------------
B7IHN5_THEAB          IR-----ISEDE------------------------------------------------
SMC_THEEB             PPPLPQPLPEVPAELS--------------------------------------------
Q2JHS4_SYNJB          AQELPDPLPNLPATLT--------------------------------------------
SMC_SYNP6             QQELPQPLPDIPEMVQQ-------------------------------------------
B0C9C4_ACAM1          ATELPDPLPEIPEDLT--------------------------------------------
Q115J3_TRIEI          KAELPDPLPIVPEKIK--------------------------------------------
B2J925_NOSP7          GAELPNPLPEVPDKVD--------------------------------------------
E0UKI1_GLOV7          RSELPEPLPELP------------------------------------------------
B7K4Q6_RIPO1          QNELPEPLPEVPLL----------------------------------------------
B0JSN6_MICAN          ESDLPNPLPEIP------------------------------------------------
SMC_SYNY3             EQDLPDPWPEIPLL----------------------------------------------
Q84EC7_SYNP2          EAELPPDLDPTHLLVEVVP-----------------------------------------
D3EQ04_ATETH          QCNLPNPLPEIPLL----------------------------------------------
SMC_GLOVI             GPPAEDVPPPPEDL----------------------------------------------
A5GQT1_SYNR3          VAELPDPLPEISDELRE-------------------------------------------
A9B9B9_PROM4          EANLPDPLPDIPEEVRI-------------------------------------------
A2BNJ6_PROMS          KKDLPNPSPEFGEYEG--------------------------------------------
Q46EX0_METBF          VEEILKRGIEETDEVPN-------------------------------------------
D7EAF5_METEZ          RSELEQRGIEETEEVPN-------------------------------------------
D1YW78_METPS          EKVVQERGVMPSEDVPP-------------------------------------------
A0B8B9_METTP          RSEIESAGIDPSEAPPK-------------------------------------------
D4GT30_HALVD          QSQV---GDYDPDEIPD-------------------------------------------
A7IAD8_METB6          K-AIVGEVSTDLT-----------------------------------------------
A3CWK7_METMJ          R-EQAGDVETDLD-----------------------------------------------
B8GG37_METPE          R-EQASGVETTLT-----------------------------------------------
E1RII6_METP4          S-EAAGDFETDLS-----------------------------------------------
Q2FLH3_METHJ          V-TEAGECRTDLS-----------------------------------------------
A2SS75_METLZ          KGSISEEIVCDLC-----------------------------------------------
D3RYW2_FERPA          P------EVEPKMKK---------------------------------------------
O28714_ARCFU          G------EVEVPENLPP-------------------------------------------
D2RFP2_ARCPA          -------DIEIPKDLPS-------------------------------------------
SMC_THEAC             ERELSSYSGCEAV-----------------------------------------------
Q97AI9_THEVO          EAEMQSIPEPTMI-----------------------------------------------
SMC_METVO             ERKLYLCDTLENIEDIS-------------------------------------------
A6UQ42_METVS          ERKLYIC---ENIEHIS-------------------------------------------
A6UVP1_META3          EKKLYLC---EKVEELP-------------------------------------------
SMC_METJA             ERKLYLC--------EK-------------------------------------------
C9RFQ3_METVM          ERKLYLC--------EK-------------------------------------------
D5VT24_METIM          RKELYIQ--------EE-------------------------------------------
D3SQ87_THEAH          GFEGEGFEV---------------------------------------------------
D3DG53_HYDTT          EFFGDVQDV---------------------------------------------------
SMC_AQUAE             EDLKLGAD----------------------------------------------------
B4U7R1_HYDS0          EYDGTIYEEQ--------------------------------------------------
C0QSN8_PERMH          KEEYEGEPV---------------------------------------------------
B2V736_SULSY          KEEYSGEPI---------------------------------------------------
SMC_PYRFU             KYQLTHYDKNLI---KS-------------------------------------------
C5A612_THEGJ          RAELKHHDPKLV---KS-------------------------------------------
D1CC09_THET1          TGKAPSTDIQISD-----------------------------------------------
D3TAQ9_ACIB4          KREYESYGIDVKNVE---------------------------------------------
SMC_HALMS             DQDDFDDLIDTRQMHFMETENGLVTIEKQ-------------------------------
Q6L0R1_PICTO          IKEYNKSI----------------------------------------------------
C1A7M6_GEMAT          WRRSLDDLLAGFEEL---------------------------------------------
C9RN51_FIBSS          WSVDLDNPENVERVE---------------------------------------------
D1B5Z0_THEAS          YPYPSVVPPIQG------------------------------------------------
                                                                                  

SMC_FUSNN             ------------------------------------------------------------
E3H7H1_ILYPC          ------------------------------------------------------------
D1AK68_SEBTE          ------------------------------------------------------------
SMC_CLOK1             ------------------------------------------------------------
D8GS00_CLOLD          ------------------------------------------------------------
Q97IA1_CLOAB          ------------------------------------------------------------
A0Q0Y7_CLONN          ------------------------------------------------------------
Q895M7_CLOTE          ------------------------------------------------------------
Q0SSA4_CLOPS          ------------------------------------------------------------
A6LSM4_CLOB8          ------------------------------------------------------------
D9SLC7_CLOC7          ------------------------------------------------------------
D7APA8_THEM3          ------------------------------------------------------------
Q8R9W7_CALS4          ------------------------------------------------------------
D9TN88_THETC          ------------------------------------------------------------
C9YKI7_CLODR          ------------------------------------------------------------
E3PS49_ACESD          ------------------------------------------------------------
B0S1M4_FINM2          ------------------------------------------------------------
Q3AC59_CARHZ          ------------------------------------------------------------
E4SF58_CALK2          ------------------------------------------------------------
SMC_RHOBA             ------------------------------------------------------------
D2QWB0_PIRSD          ------------------------------------------------------------
D5SU17_PLAL2          --------------------------------------------ETAPLTSSDLALEDIT
SMC_KORVE             ------------------------------------------------------------
C1F1T5_ACIC5          ------------------------------------------------------------
Q01Y77_SOLUE          ------------------------------------------------------------
SMC_MYCPA             -----------------------EMAEYEQAKERGEQ-----------------VFAPAP
SMC_MYCTU             -----------------------EMAEFEQARERGEQ-----------------VIAPAP
SMC_MYCLE             -----------------------EMAEFQQARERGEQ-----------------VTSPAP
A4FMG9_SACEN          -----------------------EIAEYEAAKERGEQ-----------------VSEPPP
C8XH72_NAKMY          -----------------------EMAEYEAAKERGED-----------------VAAPPS
D7GEI0_PROFC          -------------------------PDGSALTEDDE--------------------QPDP
Q2J6Z3_FRACC          -----------------------DG---------------------------------TA
A8L599_FRASN          -----------------------DG---------------------------------VP
C9Z3S1_STRSW          -----------------------AEGEELPEDPE--------------------HPRNQP
D7CC86_STRBB          -----------------------AEGEVLPEDPE--------------------HPRNQP
B1VYX5_STRGG          -----------------------AEGEELPEDPD--------------------HPRNRP
E4NHH3_KITSK          -----------------------ADGAEPAAEDAGDGGDGG-------------DAGDGA
C7QGY1_CATAD          -------------------------------------------------------EGDIA
A0LV82_ACIC1          -----------------------TDATDGETDAV------------------------ET
A0JXV4_ARTS2          -----------------------TSDDKWAALRAPVDEQGAP----------VVEG----
A1R7H8_PAEAT          -----------------------ATTDKWAELRAPVDENGEA----------IIEG----
A6W7T9_KINRD          -----------------------AP----------GDPEPQS----------PPEP----
D1BJA3_SANKS          -----------------------AAQQRADHGAGEGDDRPGQ----------PADDEPVG
C7NGM6_KYTSD          -----------------------DGEQTRDEEGN-----------------------PAT
B2GFM7_KOCRD          -----------------------AIEAAQTAEESGGSAQLA-----------LPSMTDPG
E1VVN2_GLUAR          -----------------------EDDKWGSLRQNVDEDGNP-----------IGT-----
A5CQQ2_CLAM3          ------------DDGVGDAAADPDDAAASAETSVPSAEPSGTADEAAEMDADGDAPPVPT
Q6AE90_LEIXX          -----------------------DDEPLAAGEELPTV-----------------------
D1AB24_THECD          ------------------------------------------------------PEDAVP
D6Y659_THEBD          -----------------------------------------------------------P
D7BMZ9_ARCHD          -------------------------------------------------------DEPTS
D6ZIF1_MOBCV          -----------------------------------------------------AGETIEH
C7R311_JONDD          -----------------------------ALKKGGDS------------------VLEMT
D6ZV06_BIFLJ          -----------------GNPVPLDETEAEAETEEGETGGETGTN--------GDSALFKT
Q7ZAJ9_COREF          ------------------------------------------------------------
Q8NNW5_CORGL          ------------------------------------------------------------
Q84F13_CORDP          ------------------------------------------------------------
Q4JUZ1_CORJK          ------------------------------------------------------------
C4LJD3_CORK4          ------------------------------------------------------------
D6Z8M0_SEGRD          -----------------------------------------------------------P
C8WGU5_EGGLE          ------------------------------------------------------------
C7MMZ7_CRYCD          ------------------------------------------------------------
C7N560_SLAHD          ------------------------------------------------------------
E1QVK5_OLSUV          ------------------------------------------------------------
C8W740_ATOPD          ------------------------------------------------------------
SMC_RHOPA             -------------------------------------------------------IVEGA
A7IGT2_XANP2          -------------------------------------------------------IDPDA
B8EMM7_METSB          -------------------------------------------------------LGADE
B8IQU0_METNO          -------------------------------------------------------LAPGE
Q92RE8_RHIME          -------------------------------------------------------LGSDE
A7HQY9_PARL1          -------------------------------------------------------LEEGA
D8JUP9_HYPDA          -------------------------------------------------------VSEFS
E3I0B2_RHOVT          -------------------------------------------------------LEDDA
SMC_RHOS1             -------------------------------------------------------VDP-E
Q2W040_MAGSA          -------------------------------------------------------LVEEE
D3P3X3_AZOS1          -------------------------------------------------------LDPAE
B6IR58_RHOCS          -------------------------------------------------------IDPAQ
Q2RPA2_RHORT          -------------------------------------------------------LGADE
SMC_CAUVN             -------------------------------------------------------GEAVA
B0T003_CAUSK          -------------------------------------------------------GEAIA
Q0AMJ6_MARMM          -------------------------------------------------------EDEMS
E0TC69_PARBH          -------------------------------------------------------HDPDT
C6XRC2_HIRBI          -------------------------------------------------------ENKEI
Q0C0X5_HYPNA          -------------------------------------------------------DAETL
Q1GQU3_SPHAL          --------------------------------------------------------FESE
D4YX43_SPHJU          --------------------------------------------------------FASA
Q2G9S3_NOVAD          --------------------------------------------------------FASA
D5BSU5_PUNMI          -------------------------------------------------------VESAD
A5FVJ2_ACICJ          -----------------------------------------------------------P
C5B6I7_METEA          -------------------------------------------------------IEPGA
Q937L3_DEIRD          ------------------------------------------------------------
Q1J060_DEIGD          ------------------------------------------------------------
L0A7J5_DEIPD          ------------------------------------------------------------
D7BH70_MEISD          -----------------------------------------------------------L
SMC_THASP             ----------------------------------------------------------KE
A1K715_AZOSB          ----------------------------------------------------------KE
C7RKG8_ACCPU          ----------------------------------------------------------RA
Q3SJI0_THIDA          ----------------------------------------------------------RP
SMC_DELAS             ----------------------------------------------------------VR
D6CTE6_THIA3          ----------------------------------------------------------AQ
SMC_BORPD             ----------------------------------------------------------DE
SMC_BURP1             ----------------------------------------------------------DM
A4SYV7_POLAQ          ----------------------------------------------------------KV
D5CRW3_SIDLE          ----------------------------------------------------------AG
D9SGR3_GALCS          ----------------------------------------------------------SG
Q2YBB9_NITMU          ----------------------------------------------------------PA
Q0AE88_NITEC          ----------------------------------------------------------PA
D7DI79_METV0          ----------------------------------------------------------GE
C1D4R7_LARHH          ----------------------------------------------------------KA
Q7NR76_CHRVO          ----------------------------------------------------------KP
A1KSF4_NEIMF          ----------------------------------------------------------K-
A1WY82_HALHL          ----------------------------------------------------------TV
Q0AAV4_ALKEH          ----------------------------------------------------------EV
SMC_XANOR             ----------------------------------------------------------NP
B8GTL2_THISH          ----------------------------------------------------------GV
Q3JAH9_NITOC          ----------------------------------------------------------DL
D3RSW0_ALLVD          ----------------------------------------------------------TE
B3PGR0_CELJU          ----------------------------------------------------------EI
A6V7X5_PSEA7          ----------------------------------------------------------SE
Q0VR03_ALCBS          ----------------------------------------------------------DE
C7RBE2_KANKD          ----------------------------------------------------------NE
Q2SD45_HAHCH          ----------------------------------------------------------DE
E4PL89_MARAH          ----------------------------------------------------------NE
E1V8E9_HALED          ----------------------------------------------------------TE
D3SAL9_THISK          ----------------------------------------------------------SV
SMC_METCA             ----------------------------------------------------------EE
SMC_COXBU             ----------------------------------------------------------TI
Q5WTI1_LEGPL          ----------------------------------------------------------TQ
Q12L80_SHEDO          ----------------------------------------------------------KT
Q080K7_SHEFN          ----------------------------------------------------------SV
A4Y804_SHEPC          ----------------------------------------------------------SP
D4ZIY3_SHEVD          ----------------------------------------------------------SS
B0TKB4_SHEHH          ----------------------------------------------------------TM
A3QFJ7_SHELP          ----------------------------------------------------------SL
A1S5R5_SHEAM          ----------------------------------------------------------SV
Q5QUJ9_IDILO          ----------------------------------------------------------DE
E1SMV2_FERBD          ----------------------------------------------------------AV
F2GBA5_ALTMD          ----------------------------------------------------------NE
Q15UZ3_PSEA6          ----------------------------------------------------------DE
Q3IKC0_PSET1          ----------------------------------------------------------II
A4SKA4_AERS4          ----------------------------------------------------------DR
D0KWM8_HALNC          ---------------------------------------------------------LAD
A0A2W1K6W8_ACIFR      ----------------------------------------------------------PG
A0A0J1A050_ACIBA      ------------------------------------------------------------
B3E294_GEOLS          ---------------------------------------------------------DPV
A1AU91_PELPD          ---------------------------------------------------------DEL
B9M6F0_GEODF          ---------------------------------------------------------NEA
Q39WG2_GEOMG          ---------------------------------------------------------DEE
B5EFS9_GEOBB          ---------------------------------------------------------DEE
Q3A212_PELCD          ---------------------------------------------------------DPV
A9FIZ2_SORC5          ---------------------------------------------------------ADA
D0LY52_HALO1          ---------------------------------------------------------VTT
Q1D2R5_MYXXD          ---------------------------------------------------------LAP
B4UDF6_ANASK          ---------------------------------------------------------PGE
Q6MNS9_BDEBA          ---------------------------------------------------------DFL
A9A0M3_DESOH          ---------------------------------------------------------LDK
B8FHS3_DESAL          ---------------------------------------------------------DPK
E1QL74_DESB2          ---------------------------------------------------------DPQ
B3EFQ6_CHLL2          ------------------------------------------------------------
A1BDT4_CHLPD          ------------------------------------------------------------
A4SG64_CHLPM          ------------------------------------------------------------
SMC_CHLTE             ------------------------------------------------------------
Q3ATI3_CHLCH          ------------------------------------------------------------
B4S519_PROA2          ------------------------------------------------------------
B3EM83_CHLPB          ------------------------------------------------------------
B3QRZ4_CHLT3          ------------------------------------------------------------
D0MFL5_RHOM4          ------------------------------------------------------------
Q2S457_SALRD          ------------------------------------------------------------
C7PLU2_CHIPD          ------------------------------------------------------------
E4TVF1_MARTH          ------------------------------------------------------------
B2KBE7_ELUMP          ------------------------------------------------------------
B1H0P2_ENDTX          ------------------------------------------------------------
E4TEW8_CALNY          ------------------------------------------------------------
D3PDY1_DEFDS          ------------------------------------------------------------
D4H2V6_DENA2          ------------------------------------------------------------
D6YSC9_WADCW          ------------------------------------------------------------
Q04TU9_LEPBJ          ------------------------------------------------------------
E1R6H6_SEDSS          ------------------------------------------------------------
Q73ML2_TREDE          ------------------------------------------------------------
A0A0H3BKB7_TREPS      ------------------------------------------------------------
E0RSK7_SPITD          ------------------------------------------------------------
D5EMY0_CORAD          -------------------------------------PDKIAAQPKHERRDPTDEELAEM
B1ZZB8_OPITP          AKEAEQPLSITSAVAEVGDPGHNGDEPAQVVASAQPAPTKRRRKPKGPKGEPTEADLAAL
SMC_DESHY             -----------------------------------------------------QTYQ-SE
A4J682_DESRM          -----------------------------------------------------LAVE-PA
Q67PF3_SYMTH          -----------------------------------------------------LPRALPE
B0TGW8_HELMI          -----------------------------------------------------RERGRRP
Q2RJX0_MOOTA          -----------------------------------------------------LQKPRRH
SMC_BACSU             -----------------------------------------------------KEKYQLE
C5D8T7_GEOSW          -----------------------------------------------------KEAYPLT
D5DQR5_BACMQ          -----------------------------------------------------KEKYPLT
B7IUK7_BACC2          -----------------------------------------------------KLKYTMT
Q9KA07_BACHD          -----------------------------------------------------KVEYPLM
Q5WFM8_BACSK          -----------------------------------------------------ASRYPLS
Q7ZAM6_OCEIH          -----------------------------------------------------CEEFDKV
D6XTT7_BACIE          -----------------------------------------------------EKRYHLE
Q81ZN4_ENTFL          -----------------------------------------------------YEAYFPI
A0A0E0UX46_LISMM      -----------------------------------------------------EEKILPE
B1HQH6_LYSSC          -----------------------------------------------------QEEARAI
C6D303_PAESJ          -----------------------------------------------------KEQYPVP
C0ZFN9_BREBN          -----------------------------------------------------KQKYPAR
C8WWA4_ALIAD          -----------------------------------------------------KERYPLQ
D5WPA2_KYRT2          -----------------------------------------------------KERFGDV
C4L5Z7_EXISA          -----------------------------------------------------ELLPALE
B1YIN0_EXIS2          -----------------------------------------------------ELIQPLT
D3R1B0_MAGIU          -----------------------------------------------------KAEDLAD
D2RLB2_ACIFV          -----------------------------------------------------RQEA-LE
D1BLY1_VEIPT          -----------------------------------------------------QVLR-IE
A5UQ60_ROSS1          -----------------------------------------------------QSCADPS
B8G556_CHLAD          -----------------------------------------------------PASPAPP
A9B100_HERA2          -----------------------------------------------------QTPEVEQ
D1C6T1_SPHTD          -----------------------------------------------------ALDAVDL
D7CMX2_SYNLT          -------------------------------------------------------SGIIL
Q0AYV7_SYNWW          -------------------------------------------------------AEELL
SMC_LACPL             ------------------------------------------------------------
Q03RT7_LACBA          ------------------------------------------------------------
B2GD41_LACF3          ------------------------------------------------------------
A5VKP1_LACRD          ------------------------------------------------------------
Q03FW9_PEDPA          ------------------------------------------------------------
A0A249N2C3_LACRH      ------------------------------------------------------------
Q38XR7_LACSS          ------------------------------------------------------------
Q1WU99_LACS1          ------------------------------------------------------------
Q04GL1_OENOB          ------------------------------------------------------------
Q03VW6_LEUMM          ------------------------------------------------------------
A0A0U5K8Z4_LACDE      ------------------------------------------------------------
E4SKB3_LACAR          ------------------------------------------------------------
Q74IP9_LACJO          ------------------------------------------------------------
A0A0T8KIP4_STREE      ------------------------------------------------------------
A4VVL7_STRSY          ------------------------------------------------------------
C0MCR5_STRS7          ------------------------------------------------------------
A2RLZ7_LACLM          ------------------------------------------------------------
B9EBB4_MACCJ          ------------------------------------------------------------
SMC_MYCHR             ------------------------------------------------------------
E0TKT8_MYCHH          ------------------------------------------------------------
Q4A770_MYCH7          ------------------------------------------------------------
C5J708_MYCCR          ------------------------------------------------------------
A5IYM7_MYCAP          ------------------------------------------------------------
D5E4P4_MYCCM          ------------------------------------------------------------
Q6KHN4_MYCMO          ------------------------------------------------------------
Q98PK8_MYCPU          ------------------------------------------------------------
D1J8Q8_MYCHP          ------------------------------------------------------------
Q4A588_MYCS5          ------------------------------------------------------------
SMC_MYCGE             ------------------------------------------------------------
SMC_MYCPN             ------------------------------------------------------------
Q7NBU0_MYCGA          ------------------------------------------------------------
Q8EVS6_MYCPE          ------------------------------------------------------------
Q9PR04_UREPA          ------------------------------------------------------------
Q6F1N4_MESFL          ------------------------------------------------------------
Q6MTD2_MYCMS          ------------------------------------------------------------
E3GP81_9FIRM          ------------------------------------------------------------
SMC_HALOH             ----------------------------------------------------------RI
E4RL35_HALHG          ----------------------------------------------------------EI
D9QRN7_ACEAZ          ----------------------------------------------------------RE
A8MHB7_ALKOO          ----------------------------------------------------------KS
A6TRT3_ALKMQ          ----------------------------------------------------------KE
A3DDY2_HUNT2          ----------------------------------------------------------KK
D5X8N2_THEPJ          ----------------------------------------------------------KT
D9R048_CLOSW          -----------------------------------------------------------E
C4Z0E6_EUBE2          -----------------------------------------------------------E
C4Z924_AGARV          -----------------------------------------------------------D
E0RV40_BUTPB          -----------------------------------------------------------E
A9KLR0_LACP7          -----------------------------------------------------------E
D9S347_THEOJ          -----------------------------------------------------------Q
B2A2N3_NATTJ          -----------------------------------------------------------E
A8F8R1_PSELT          ------------------------------------------------------------
A5IN04_THEP1          ------------------------------------------------------------
C5CIS4_KOSOT          ------------------------------------------------------------
A7HMD4_FERNB          ------------------------------------------------------------
B7IHN5_THEAB          ------------------------------------------------------------
SMC_THEEB             ------------------------------------------------------------
Q2JHS4_SYNJB          ------------------------------------------------------------
SMC_SYNP6             ------------------------------------------------------------
B0C9C4_ACAM1          ------------------------------------------------------------
Q115J3_TRIEI          ------------------------------------------------------------
B2J925_NOSP7          ------------------------------------------------------------
E0UKI1_GLOV7          ----------------------------------------------------ETIMNQEN
B7K4Q6_RIPO1          ---------------------------------------------------AEIDLETTD
B0JSN6_MICAN          -----------------------------------------------------------E
SMC_SYNY3             ---------------------------------------------------QDRDEANLD
Q84EC7_SYNP2          ---------------------------------------------------EKLDQALQE
D3EQ04_ATETH          ---------------------------------------------------SELSESLDD
SMC_GLOVI             ------------------------------------------------------------
A5GQT1_SYNR3          ------------------------------------------------------------
A9B9B9_PROM4          ------------------------------------------------------------
A2BNJ6_PROMS          ------------------------------------------------------------
Q46EX0_METBF          ------------------------------------------------------------
D7EAF5_METEZ          ------------------------------------------------------------
D1YW78_METPS          ------------------------------------------------------------
A0B8B9_METTP          ------------------------------------------------------------
D4GT30_HALVD          ------------------------------------------------------------
A7IAD8_METB6          ------------------------------------------------------------
A3CWK7_METMJ          ------------------------------------------------------------
B8GG37_METPE          ------------------------------------------------------------
E1RII6_METP4          ------------------------------------------------------------
Q2FLH3_METHJ          ------------------------------------------------------------
A2SS75_METLZ          ------------------------------------------------------------
D3RYW2_FERPA          ------------------------------------------------------------
O28714_ARCFU          ------------------------------------------------------------
D2RFP2_ARCPA          ------------------------------------------------------------
SMC_THEAC             ------------------------------------------------------------
Q97AI9_THEVO          ------------------------------------------------------------
SMC_METVO             -----------------------------------------------------DEMIEET
A6UQ42_METVS          -----------------------------------------------------EEITEKI
A6UVP1_META3          -----------------------------------------------------DEIYNKL
SMC_METJA             -----------------------------------------------------VDVSKEL
C9RFQ3_METVM          -----------------------------------------------------VEIKDGL
D5VT24_METIM          -----------------------------------------------------TKVREEI
D3SQ87_THEAH          ------------------------------------------------------------
D3DG53_HYDTT          ------------------------------------------------------------
SMC_AQUAE             ------------------------------------------------------------
B4U7R1_HYDS0          ------------------------------------------------------------
C0QSN8_PERMH          ------------------------------------------------------------
B2V736_SULSY          ------------------------------------------------------------
SMC_PYRFU             -----------------------------------------------------IKEI---
C5A612_THEGJ          -----------------------------------------------------IKPNEIP
D1CC09_THET1          ------------------------------------------------------------
D3TAQ9_ACIB4          ------------------------------------------------------------
SMC_HALMS             -----------------------------------------------------SYEFHRR
Q6L0R1_PICTO          ------------------------------------------------------------
C1A7M6_GEMAT          ------------------------------------------------------------
C9RN51_FIBSS          ------------------------------------------------------------
D1B5Z0_THEAS          ------------------------------------------------------------
                                                                                  

SMC_FUSNN             EVEKLKSSKDRLRSLENKINNFGD-VNLLAINEFKELKERYDYLARERDDVVKSRKQVMD
E3H7H1_ILYPC          DGD-LKEATEKLLKLEVRIKSLGT-VNLLAIEEFQEIKNKYEFVLGQRNDLLSSEKSLRE
D1AK68_SEBTE          DDNILAATRRKMSVNEKSRMDIGP-VNLASIEEYEKEEERYRLLYEQKEDLLKSRESLFT
SMC_CLOK1             --ENLEEYKSKIVHLKSSISKLGV-VNLGAIEEYKNLQKKITFLSSQKEDLIKSKQELKK
D8GS00_CLOLD          --ENLDKYNSDVVNLKNSISKLGI-VNLGAIQEYSDLREKVTFLSTQREDLVKSKEELNN
Q97IA1_CLOAB          --EEMISYKKKIDELKREINKMGV-VNVASIEEYKEVKEKYTFMNSQKEDLDNAKDELIR
A0Q0Y7_CLONN          --QNIDECRADIQKYKNEISKLGV-VNLGAIEEYREVMEKYTFMKEQKEDLIKAKDELLS
Q895M7_CLOTE          --DNLNDYRNYIKNIKTEINKLGT-VNVGAIQEYENTKEKYDFMSSQKEDLINAKDEITQ
Q0SSA4_CLOPS          --EDMDSHKVRISTLKARITGLGN-VNVNAIEEFKEISEKYNFMTTERDDLEKAKEELLN
A6LSM4_CLOB8          --VDEEALKQEIFVTKGKITKLGV-VNLAAIEEYEEIKEKYEFMSTQAEDLENAKRELNA
D9SLC7_CLOC7          --LEVASVKDIIYSLKRQISSLGV-VNVGAIEEYKEIKEKYTFMNNQREDLINAKDELMK
D7APA8_THEM3          --GEISKLRQRADHLTKAIKGLGN-VNIDAIEEYKEVKERYDFLKSQMEDIIKAKESLIS
Q8R9W7_CALS4          --EEITNLRIEVERLNEEIKNLGN-VNLDSIEEFRQVKERYDFLKNQMEDIIRARESLLS
D9TN88_THETC          --ESISTLRQRSLKLAAMIRDLGV-VNLNSIEEYRNLKERFDFLKKQYDDLVDARNSLNS
C9YKI7_CLODR          ---DLDIDRKFLESLKREIRSLGN-INIGSIKEYEEIKERYDFYSEQKQDLEESMEEIEK
E3PS49_ACESD          ---TIDTSKTKIDNLKKSIQDLGN-INVDAIEQYNVIKERYDFYKEQKEDLEDSIKQINQ
B0S1M4_FINM2          --PDIKISQKEINKITNDLRNIGS-FSVDSIQEYESVKREFDFMTKNKNDLIESREDIMS
Q3AC59_CARHZ          --EPVYIEEREIEELYNQIQGLGP-VNLFVIDEVKRLEERINFLNQQRNDLNEAKEQLEK
E4SF58_CALK2          --WSKEKED-ELERCIQALSELGE-VKLYSIDQEKRLQERMQFLQKQIEDLQKTTDELKR
SMC_RHOBA             -----SSVDEEISRLRGQVQNVGS-VNMEALEELNELQVRYDELHGQYQDLTAAKDSLQR
D2QWB0_PIRSD          -----TAIEEEIESLRRKINQIGA-VNLDALEELDELESRYTHLSTQYKDLTEAKQALER
D5SU17_PLAL2          FEAIRPEVDAHVQRLRRKLKLLGS-VNTESLNDLEQLEQRYQQLAAQLQDLVEAKATLED
SMC_KORVE             -----AVADTEQKDMRTKLENMGP-VNMMALEEYKETAQRHEFLETQRKDLLDSIENTQN
C1F1T5_ACIC5          -----QAEDEACRGLKQKLESMGP-VNMMALEEYRETEQRHAFLETQRKDLVDSIENTRA
Q01Y77_SOLUE          -----AEAEQAANEVRARIEGLGA-VNAAAMEEYQEAQQRHDFLSAQRQDLIDSIRDTEK
SMC_MYCPA             IPFDRPTQERRAKRAERELAELGR-VNPLALEEFAALEERYNFLSTQLEDVKAARKDLLG
SMC_MYCTU             MPFDRVTQERRAKRAERALAELGR-VNPLALEEFAALEERYNFLSTQLEDVKAARKDLLG
SMC_MYCLE             MPYDRATQERRAKRAERELAELGR-VNPLALEEFAALEERYNFLSTQLEDVKGARKDLLD
A4FMG9_SACEN          VPFDRSTQERRAKRAEKDLSLLGK-VNPLALEEFAALEERYKFLSTQLEDLKATRRDLLD
C8XH72_NAKMY          MPYDRPTQERRLRRAERDLTALGK-VNPLALEEYAGLEERHKFLATQLEDLKSTRKDLLQ
D7GEI0_PROFC          VPFDRGEQVKRERRARRALDQLGR-INPLALEEFDALNARHQFLAEQFEDLKKTRKDLED
Q2J6Z3_FRACC          APFDRAEQSARAATAEKQLARLGR-VNPLALEEFAALQERAAFLSAQLEDIKSTRRDLLL
A8L599_FRASN          TPFDRAEQVARAGRAEKQLARLGK-INPLALEEFAALQERAAFLSTQLDDLKSTRRDLLL
C9Z3S1_STRSW          KTFHRAEQEKRLRAAERAYQQLGK-VNPLALEEFAALEERHKFLSEQLEDLKKTRADLLQ
D7CC86_STRBB          VRYVRAQQEKRLRAAERAYQQLGK-VNPLALEEFAALEERHQFLSEQLEDLKKTRADLLQ
B1VYX5_STRGG          KAYLRAEQEKRLRSAERAYQQLGK-VNPLALEEFSALEERHKFLSEQLEDLKKTRADLLQ
E4NHH3_KITSK          RPYVRAEVERRLKAAERAHQQLGK-VNPLALEEFAALEARHRFLGEQLDDLRKSRRDLMD
C7QGY1_CATAD          VPYDRAEQQRRLKKAEKDYTALGK-VNPLALEEFAALEERHQFLSEQLEDLKKTRKDLLD
A0LV82_ACIC1          VPYVRAEQEKRARSAERALAALGK-VNPLALEEFAALEERHRFLSEQLEDLKKSRRDLLE
A0JXV4_ARTS2          KPFVRDEQEKRLRKAERDLSSLGR-VNPLALEEFAALEERHQFLSSQLEDLKSSRKDLLD
A1R7H8_PAEAT          VPFVRAEQEKRLKKAERELAALGK-VNPLALEEFAALEERHQFLSSQLEDLKSSRKDLLD
A6W7T9_KINRD          RPYVRAEQEKRRRAAERALSQLGQ-VNPLALEEYAAMEERHQFLVTQSDDLRRSRKDLLD
D1BJA3_SANKS          RPYVRAEQEKRLQSAERAMARLGR-VNPLALEEFAALEERHTFLTEQLADLKRSRADLLE
C7NGM6_KYTSD          VPFVRDEQAKRLRRAERDLKALGA-VNPLALEEYAAMEERHQFLAGQLDDLVASKEALLE
B2GFM7_KOCRD          TPFRREEQETRLQRAQKQLKALGK-VNPLALEEFAALEERHRFLVTQLEDVKNSRTDLRN
E1VVN2_GLUAR          KPYDRGEQEKRLKKAEKDLSALGK-VNPLALEEFAALEERHKFLSGQLEDLKKSRSDLQQ
A5CQQ2_CLAM3          RPFDREEQRARLQSAERKLAQLGR-VNPLALEEFAALEQRHLFLTEQLADLTATRKDLLT
Q6AE90_LEIXX          -PFAREQQQKRLAAAERKLGQLGR-VNPLALEEFAALEQRHKFLSEQLVDLTSTRKDLLT
D1AB24_THECD          RPYARAEQEKRAKNAERQLAQLGK-VNPLALEEYAALEERHAFLTSQLEDLKKTRRDLLT
D6Y659_THEBD          VPYVREEQEKRAATAERRLAQLGK-VNPLALEEYAALEERHAFLTSQLEDLKKSRRDLML
D7BMZ9_ARCHD          RPYVRAEQEKRLARSERDLARLGK-INPLALEEHAALEERQRYLSEQLADLRQSRSDLLT
D6ZIF1_MOBCV          VPFVREEQVERKAHAQTELKRIGK-VNPLALQEHEALVARHKFLADQLADLKKSRDDLMN
C7R311_JONDD          QPFDRAGVEAARESARKKLSTMGK-INPLALEEYKALEERHVFLAQQLDDLKKSRADLLT
D6ZV06_BIFLJ          VPYNRQEQKKRLDKARRDLAALGK-INPLATEEFEALEERNKYLNDQRNDVVKSRDDLMQ
Q7ZAJ9_COREF          EHFDENAQRARLKQAEKDLASLGK-VNPLALEEFKALEERYEFLATQVRDVEQARADLRG
Q8NNW5_CORGL          ENFDEKFQRARLKQAEKDLAALGK-VNPLALEEFKALEERYEFLSTQLADVEQARADLSG
Q84F13_CORDP          EGFDIGAQRVRLKNAEKDLNALGK-VNPLALEEFKALEERYEFLSTQLADVEQARRDLHG
Q4JUZ1_CORJK          EDFDAAATKAELKKAEKALNSLGK-VNPLALEEFKALEERYNFLAQQLDDVERARNDLHE
C4LJD3_CORK4          TDFDPASEKKRLASAERALKQLGK-VNPLALEEYKALEERYSFLSTQLMDVEQAREDLRG
D6Z8M0_SEGRD          AGFDQDQLAHDVRLAEREIAAIGQ-VNPLALEEFAALEERHAFLTAQLDDLTKARKDLLD
C8WGU5_EGGLE          ---DRGATEDAAFKLRRRIANMGT-INPDAAEEYEQLKTRYDYLAAQLSDLDGARRSLAK
C7MMZ7_CRYCD          ---DRSTAEASAFKLQRKIDGMGT-VNPDAAEEYEQLKERFDYLNTQLEDMLTARRSLAR
C7N560_SLAHD          ---DRATAESRAFELRRKIERMGT-IDSSAAEEYEAMNERYEYLSSQIEDMEAARRSLMR
E1QVK5_OLSUV          ---DREAMERQAERLRKQIATIGP-VNEVAIDEYTALRRRADYIGEQVEDLERARKSLQK
C8W740_ATOPD          ---DREQAERLAASLKSQLEALGP-VNAVAMDEYERLKERADYINEQVADLEAARTSLKK
SMC_RHOPA             ELPPLAEIEESLDKLRRDRERLGA-VNLRAEEELNEVETQHGTLAAERDDLVEAIKKLRT
A7IGT2_XANP2          PPPNVAAIEATLERAKRDRERLGA-VNLRADVELEETESQHIKLVGERDDLLEAIKRLRG
B8EMM7_METSB          DLPPAADVERRLEALKQDRERLGA-VNLRAEEELNEAETEKARLAAEHADLTEAIRRLRQ
B8IQU0_METNO          PLPAAAAVEARLAGLKADRERLGA-VNLRAETELAEAEGRRDDLGRERDDLLEAIRRLRG
Q92RE8_RHIME          GLPDMRGVERELERLKIERERLGA-VNLRADEEQKELSERLAALLKERDDVIEAIRRLRS
A7HQY9_PARL1          EMPNLEQIDAKLERLKRERESLGG-VNLRAEEEARELTEQLETMTSEREDLVSAIAKLRQ
D8JUP9_HYPDA          TIPPLAEVEKQLTRLKADRERLGG-VNLQADDDLAEVSKQLEGLGAEKNDLEQGIQKLRG
E3I0B2_RHOVT          TLPSPQEIEQQIVKLKAERERLGG-VNLRAEEEAAALGGEFDGMEKERSDLQEAIGKLRT
SMC_RHOS1             RIPTVEALETDVGRLKRQREALGA-VNLRAEEDAQAVQTEHDTLKAEKTDLEEAVKKLRA
Q2W040_MAGSA          R-PDPEELQRKFDRLSRERDNMGP-VNLRAEQEVEELEARIGGMVAEKDDLVSAIAKLRH
D3P3X3_AZOS1          PMPDAAAVEARLDKLTREREGMGP-VNLRAEIEAQELEAQIAGLHGEREDLTAAIARLRQ
B6IR58_RHOCS          EQPEAAAVEARLERLIAERETMGP-VNLRAEQEVAELEGQIDVMKGEREDLIAAIARLRQ
Q2RPA2_RHORT          TLAPVAEAEAALLRLGREREAMGP-VNLRAEQEAGELDAQITSLRLERDDLVAAIARLRQ
SMC_CAUVN             VPKDAAGVEAHLFALERERDAIGP-VNLRAEEEAQEYAGRLETMRSERADLSGAVTKLRA
B0T003_CAUSK          VPKDAAGVEAHLFALERERDAIGP-VNLRAEEEANEYAARLETMRTERADLSGAVGKLRA
Q0AMJ6_MARMM          ELSPSE-LERRLDEARQSRERLGA-VNLRADDEAEELSAKIEEMTRERDDLVEAIARLRK
E0TC69_PARBH          PLPDQTTLEEKVDKLKRDRDSMGG-VNLCAEQEMTEIDDRLSDITRERADCEEAIAKLRG
C6XRC2_HIRBI          -PFSIPQAETQLALLMRDRESLGG-VNMEADLQVEETANRLETQLREREDLDQAIAKLQE
Q0C0X5_HYPNA          GAFTPREAETRLDSLRRERDQLGG-VNMNAEEEAEELETRLGVQIAERDDLTGAIAKLRQ
Q1GQU3_SPHAL          SIGDPQAESAAHDRLVADRERLGP-VNLVAADELAELDAEREKNAAEIEELTQAVHRLRG
D4YX43_SPHJU          DIRIAQSEQAEHDRLVTERERIGP-VNLVAAQELEELEATQANSRAESEELSQAINRLRG
Q2G9S3_NOVAD          EVAAAGDESAAMDRLVAERERIGP-VNLVAADELAEAEERHGTSIAEQAELTEAVHRLRG
D5BSU5_PUNMI          ALPPVATLDDKVQRLLRERDNIGP-VNLRAEVEMEEVASRIANMEAESEDLLAAIAKLRA
A5FVJ2_ACICJ          SPDAAEKARKRFERLTRERDEMGP-VNLRADIEVGEIETRLAAIDRDREEITSAIAKLRG
C5B6I7_METEA          ALPSIGAAESRLSKLVQERDGLGA-VNMLAAQQLQEAQAARSTVDKARAEVAQSVQKLEL
Q937L3_DEIRD          PPGTPKEWTAELARARAELDRLGP-VNARAEADYQAEAETLELQRREAADAEAAAAELRA
Q1J060_DEIGD          PPGTPREWTAELNRSRAELERLGP-VNARAEADHAAASAELEALTGELHDAEAAAAELRA
L0A7J5_DEIPD          LPGTSREWQSELTRVSRELAELGV-VNARAETEYQSERQRLDALSVERQDAEDAAGELRR
D7BH70_MEISD          PQGSHRTLTRQLAEAEAALQALGA-VNHLAEAEHHSLAEQAETLQAALREAEEVMSKLEA
SMC_THASP             S-----TLQREVARLAREIAELGA-VNMAALDELTTASERKGYLDAQTEDLLQAIDTLED
A1K715_AZOSB          T-----SLQREVGRLAREIAELGA-VNLAALDELRSASERKSYLDAQTEDLLQAIGTLED
C7RKG8_ACCPU          G-----PLQAAIAALQRSIDALGA-VNLAALDELAAASERKGYLDAQSEDLTQAMETLES
Q3SJI0_THIDA          N-----QLQAEINRLQNEIAALGA-VNLAALEELTQAQARAEYLAAQCADLTEAVTTLED
SMC_DELAS             M----HGLQGEIDRLHREIAALGA-VNLAALDELKLARERKTFLDAQTEDLTQAMNTLED
D6CTE6_THIA3          A----PALAREHERLQRDIAALGA-VNLAALDELGQARERKQFLDAQLEDLQTAITTLED
SMC_BORPD             WR-RANWLQSEVGRISRQIDSLGS-VNLAALDELNASRERKEFLDSQQQDLLTAIDTLED
SMC_BURP1             ---KPSYLQGEVTRINNAINALGP-VNMAALDELAAASERKVFLDAQSADLTNAIETLED
A4SYV7_POLAQ          G-----ALQSEVTRLNTEIQSLGP-VNMAALDELSSSRERKQFLDAQSADLNEAMQTLTD
D5CRW3_SIDLE          G------LQNELTRLGNEITALGA-VNLAALEELQSAQERKTYLDAQAKDLNEAIETLED
D9SGR3_GALCS          T------LQNELVRLSREIADLGA-VNLAALDELQAATERRGYLMAQSEDLQQAMATLED
Q2YBB9_NITMU          A------LQSEVNRLRGDITALGP-VNTAALEELESCQTRKTYLDSQARDLEEASETLRN
Q0AE88_NITEC          R------LQTRINRLGGEIAALGP-VNLAALQELDALKSRRMHLEEQSLDLREAIDTLEQ
D7DI79_METV0          SKLKVIDLESKRDKLVLDIEELGA-VNLAAIQELETEQTRKQYLDSQCKDLTDASETLED
C1D4R7_LARHH          G-----ALTADIGRLAQAIAALGA-VNLAALDELEAAREREGYLAHQHDDLVAAMNTLEE
Q7NR76_CHRVO          N-----ALAAEIARLARALEGLGA-VNLAALQELDEAKKRGEYLQSQSDDLNQAMATLEE
A1KSF4_NEIMF          ------VLNSSIGSLSQQIEALGA-VNLAALQELEEARERDGYYRSQSEDVQAAITILEE
A1WY82_HALHL          D-----AWEKALEQTTERIRRLGS-VNLAAIDECQQLEERRGYLDEQHADLNEALETLET
Q0AAV4_ALKEH          T-----DWEKRLEQLGRRIARLGT-VNLAAIDECAALEERQQYLDAQYDDLFEALETLEN
SMC_XANOR             A-----EWEATVGQIDGRMRRLEP-VNLAAIQEYGEAAQRSEYLDAQNLDLNTALETLEE
B8GTL2_THISH          S-----AWQEKVEQLAQRIQRLGP-INLAAIDEFKEQSQRKEYLDAQHADLMEALETLEN
Q3JAH9_NITOC          A-----ALEAESERIALRIQRLGL-INLAAIDECRIQAERKQYLDAQHADLTEALQTLEN
D3RSW0_ALLVD          T-----VWQEELSKVAARIQRLGA-VNLAAVDEFKEQSERKTYLDAQHDDIARSLETLEQ
B3PGR0_CELJU          K-----PLEEELEAIAGRIARLGP-INLAAIDEYKTESERKGYLDAQNADLVEALETLEN
A6V7X5_PSEA7          R-----EWEERLESLAARIQRLGP-INLAAIEEYQQQSERKRYLDSQNDDLAEALETLEN
Q0VR03_ALCBS          Q-----QWAQEMDMIGQRISRLGQ-INLAAIDEYQQQSERKNYLDSQNDDLEDALGTLEN
C7RBE2_KANKD          Q-----QWISDIEDITGKIQRLGA-INLAAIEEFKAAEERKTYLDAQHEDLNEALETLES
Q2SD45_HAHCH          G-----QLQRDIEQIVGKVERLGA-INLAAIEEYEAQSERKVYLDGQHEDLQEALETLEN
E4PL89_MARAH          K-----DWADELERIGNRIQRLGA-INLAAIEEYQVQSERKTYLDSQHEDLMEALETLDN
E1V8E9_HALED          S-----AWQTRLEEVGERIRRLGA-INLAAIEEYDQQAERRDYLEAQHVELSEALETLDR
D3SAL9_THISK          P-----AWEQAIAELDRKIERLGP-INLAAIDEARSLEERSRYLEEQHADLIEALETLEA
SMC_METCA             S-----AWQASVIRLGEEIERLGP-VNLTAMQEYQEQEARQRYLEEQDRDLTESLATLEQ
SMC_COXBU             E-----SWQEKLDQLVERIQRMGP-INLAAIEEYESVNERKNYLDKQHADLTEALEILKN
Q5WTI1_LEGPL          S-----IKEDELIAILEKIKRLGA-INLAAIEEFAAEQQRKVFLDEQYNDLSQALSTLET
Q12L80_SHEDO          Q-----QLSNELDKLRAEILKLGA-INLAAIEEYEVQEQRKAYLDAQDEDLNKGLMILED
Q080K7_SHEFN          D-----VWSQQLEKVKQNIIRLGA-INLAAIEEFESQRERKAYLDSQDDDLNKGLAILED
A4Y804_SHEPC          D-----KWQSDLDHIRQKIVRLGA-INLAAIEEFEQQSERKSYLDHQDEDLNKGLATLEE
D4ZIY3_SHEVD          Q-----VRQRELERIRAQIIHLGA-INLAAIEEYEQQGERKNYLDSQDEDLTSALTSLEE
B0TKB4_SHEHH          L-----WRQKELERLREQIGLLGA-INLAAIEEYDQQNQRKLYLDSQDDDLNAALSSLEE
A3QFJ7_SHELP          S-----HRQKTLERTKAQIEHLGA-INLAAIEEFEQQSQRKAYLDSQDADLAKALGSLEE
A1S5R5_SHEAM          E-----EWQQRLEKLRSKISRLGA-INLAAIEEYDEAKARKDYLDEQDRDLEQALESLEE
Q5QUJ9_IDILO          K-----QWQQELESIQNKIKRLGA-INLAAIDEAEAQRERKQYLDQQVDDLSSALDTLEA
E1SMV2_FERBD          N-----QWQADLERVRERIKRLGA-INMAAIEEYEQQSERKAYLDAQDADLTEALEVLEA
F2GBA5_ALTMD          T-----GWQDELEKTQASLQRLGA-VNLAAVEEYETQSQRKQHLDTQHQDLTDALETLQS
Q15UZ3_PSEA6          K-----RWQEYLERTVAAVARLGA-VNLAAVEEYDIQAQRKQHLDEQNQDLESALDTLEQ
Q3IKC0_PSET1          S-----TAQNKLADIVNQLERLGA-VNLAAIDEFDQAKARSEYLDNQLDDLTKALSTLEG
A4SKA4_AERS4          G-----KLRQEIQTLEAQVEALGA-INLAALEEYEEAKTRSTYLESQCQDLEQALETLSQ
D0KWM8_HALNC          IPNIAEAQAAELSTLEQQIARLGA-VNLTAIEAFAEAEARKSELDGQIEDVQAALDQLQE
A0A2W1K6W8_ACIFR      PCPDATRCEESLTRIGAAIASLGN-VNLAAEDELRELEGRRGNLLAQVEDVESALYRLAE
A0A0J1A050_ACIBA      --------QQKLEKVQKQFEKIGA-VNLAASQEFEEVSQRFDELSHQIQDLENTVTQLKD
B3E294_GEOLS          VARV------RQTDLERLIDELGE-VNLMAIEEYAGMEQRYDFLASQKSDLEESLQDLQQ
A1AU91_PELPD          ASRE------RRAELQRLLDEVGE-VNLMAIDEYAEMEERFNFLSSQRDDLEESLRSLQQ
B9M6F0_GEODF          EKRS------RQNELMKVVDEMGD-VNLTAIEEFQELEKRFLFLDEQKEDLEDSLSSLQK
Q39WG2_GEOMG          TASQ------RQEELSRLIDEMGE-VNLTAIEEYRELDERFTFLSGQKADLEESLHSLQQ
B5EFS9_GEOBB          ERAV------RQAELQKAINEMGE-VNLMAIEEFKEMEERFSFLSSQKDDLEESMNALQK
Q3A212_PELCD          ASEH------RLEELRRCIENIGE-VNLMAIDEYRELEQRWEFLCQQDQDLQESLEGLQT
A9FIZ2_SORC5          SHRA------RIQELTELLDRMGP-VNLDAVREHAEAEERYTYYSGQKADLEKALDDLEK
D0LY52_HALO1          TEDK------RLSELKRLIERMGSDINLTAIDEYAEVSERHEYLRTQRDDLERAVDQLEA
Q1D2R5_MYXXD          ETEA------ELKDLRAQVEKMGE-INLTAIDEHAELSKRYDFLTAQKKDLQSSIEQLKE
B4UDF6_ANASK          AERE------RLDELKGQAERMGA-INLTAIEEYDELSNRHAFMSEQRADLERSLADLKA
Q6MNS9_BDEBA          EADA------QLKDLREKLAKIGE-VNLSAIEEYEETAQRYEFLTKQHADLTEAKDQLRK
A9A0M3_DESOH          SAEEM---EAELTTLREKIARLGD-VNMSAIEEFDQQKERLDFLTQQHDDLVTAIEDLHK
B8FHS3_DESAL          LADEA---AMEMDDLRQKIGRMGD-VHLGAINEYEALQERYEFLTQQRDDLMHAIESLEK
E1QL74_DESB2          ANRQ------RLDKLRVLLGRLGP-VNMEAIVEHEALQERHRFLTEQKADLDASLDDLRQ
B3EFQ6_CHLL2          --FDRASSADRLAVLQKQREQFGA-VNELALEEYESEKERLDFLITQKEDLFSAESQLRD
A1BDT4_CHLPD          --FDQNQATEKLALLENQREQFGA-VNELALEEYEVEKERLDFLLEQKADLESAALQLRN
A4SG64_CHLPM          --FNFNEATETLASLEAQCDQFGA-VNELALDEYQAEKERLDFLTEQKNDLYAAETQLRE
SMC_CHLTE             --FDVAASRERLAYLQKQKEQFGG-VNELALEEYESEKERLDFLTAQKEDLVSAEKQLRE
Q3ATI3_CHLCH          --LQPNEAQHELASLQEQRSQFGA-VNELALEEYEEEKKRLDFLLTQKNDLLSAEAQLRS
B4S519_PROA2          --FNKDDAEKTATDIGDQLQKFGA-VNELALEEYEQEKERLDFLTGQKEDLLGAERQLRT
B3EM83_CHLPB          --FDRENAQKQLDEIRNRIERFGA-VNELALEEYETEQERLDFLTEQKEDLIGAETQLRT
B3QRZ4_CHLT3          --FDQAAATERIGQIKTRLKNLGA-VNELALEEFKTEKERFDFLVSQQADLQSAEKQLLD
D0MFL5_RHOM4          --FDVQQTREQIETLRRRMANLGT-VNELALEQYQEEKERLDFLLTQQQDLESAEATLET
Q2S457_SALRD          --FDESEAQSEVKSLRGTINALGD-VNPLALEEYEDEKERLDFLREQKTDLEEAEDTLLD
C7PLU2_CHIPD          SALPVDELQGSAERLKKRLENMGE-INPTAIEAYQEMKKRYEFILEQKTDLVTAKESLMA
E4TVF1_MARTH          TDETADDLRNTVSKLKERMERIGP-INPMAMEAYEEIKERNDFILTQREDLRNAKESLLN
B2KBE7_ELUMP          -----IDH-ERVKMMRKRIENMGA-VNMTAPEEYDALNERATFLKKQIEDLENAKRDLKT
B1H0P2_ENDTX          -----EANSEEIAEIKRKMESLGA-VNLAAQEEYDALEKRYSFLLMQQQDLLEAKDDLYE
E4TEW8_CALNY          -------LKNELSAIENRIEEIGP-LNMAADQEYLEIEKRFRFLSGQKEDIENAIERING
D3PDY1_DEFDS          -------NRDMYNKYLEEIEGLGP-LNMAAEEEYNSLTERYHFLTEQRADLEKSIESIQK
D4H2V6_DENA2          -------AKNELSTIERDIESLGP-LNMAAENEYQEVVERNEFLSAQKEDLEGAVTSIYE
D6YSC9_WADCW          -------TERKIRSLRRKIEEAGD-INMTSIDEYEKFKERYEFLNQQIRDLTASKGELVE
Q04TU9_LEPBJ          -------EEVKLKRLKSDIQMLGS-INPLSIEEYRSVKEIFEHHRVQKEDIEKSKADVED
E1R6H6_SEDSS          -------LRDKLSKAKEELKALGQ-VNLMAPEEFSEVKERYDFLNGQLDDLYKAREDLTR
Q73ML2_TREDE          -------LRDSLSSIKQKLDSLGR-VNFMAPEEFESVKERYEFLTKHISDLDKARADLQR
A0A0H3BKB7_TREPS      -------LRQERGELQARVKEIGA-VNFMAVEEFQEVKERYEFLVAQVADLEKARADLQR
E0RSK7_SPITD          -------LARVLAEKREERRRLGN-VNFMAAEEFKDVKDRYEFLVSQLSDLNKAKENLTT
D5EMY0_CORAD          DATDWTEVEREVHELKGRISNMGP-VNLDAISEYADLKERHDFLKNQSEDLWNSKNALIK
B1ZZB8_OPITP          DSTDWDAIKTEADALRSRIGSMGA-VNLVAIEEYAELKQRFDFLQGQSNDLTTAKAELLK
SMC_DESHY             RNRAEL--GARVQEIKLRMELLGP-VNQAAIEEYPKLQERYDFLSVQKQDLEEANESLQQ
A4J682_DESRM          ANKKQA--RSDLQDLKSRMAEMGA-VNAGAEDEYQEVMKRYHFLEEQRADLEESRNSLEQ
Q67PF3_SYMTH          EETDFA--RARIAALREQIRELGP-VNLQAIEDYRAARERLDFLQAQEADLQEAKASLYR
B0TGW8_HELMI          EDRRAA--QKRLNQLRALQKDMGP-VNLLAIEEEERLQERAQFLSRQHEDLMAAKGTLEQ
Q2RJX0_MOOTA          LEKEAP--RLR-RVLQEKLAALGE-VNPGAPRVYEGLRRRFEELEQQRQDLEEGRAALEQ
SMC_BACSU             TDPEEA--RKRVKLIKLAIEELGT-VNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQ
C5D8T7_GEOSW          VDVQEA--RKRVKLIKRAIDELGT-VNLGAIDEYERVSERYQFLTEQKADLQQAKETLHQ
D5DQR5_BACMQ          LDIQEA--RKKIKLIKLAIDELGT-VNLGSIEQYERVSERYEFLNTQRADLDEAKNTLYQ
B7IUK7_BACC2          MPAEDA--RKKVKLIKLSIEELGT-VNLGAIDEYERVAERHTFLLEQRDDLEEAKTTLHQ
Q9KA07_BACHD          MEIGEA--RTKVKLIKRAIEELGT-VNLGAIEEYERVSERYEFLKDQQADLVEAKETLHN
Q5WFM8_BACSK          QPLEQA--KMRLSLVKRSIDELGT-VNLGAIEEYARVRERYEFLREQKSDLLEARVSLDQ
Q7ZAM6_OCEIH          ENIQES--QVEVDRLKADIERLGT-VNLGAIEEFERISERYNFLSEQKNDLVEGKQTLYS
D6XTT7_BACIE          IPLQKA--KEKVKLMRMGIEELGH-VNTGAIEEFERVKERYGFLSEQKQDLEDAKGTLHE
Q81ZN4_ENTFL          DDLAQA--QQTVKRLKQEIERLGP-VNLSAIEQFEQVDERHQFLVSQRDDLLNAKEQLFE
A0A0E0UX46_LISMM      VNTEQA--RSKVRLLKRSIDELGI-VNIGAIEEFERIQERFDFLNGQQADLLAAKETLFK
B1HQH6_LYSSC          EDEEFI--RRRVKLLKKSIEELGP-VNLGAIEEYERVLERHTFLTEQREDLLAAQETLHE
C6D303_PAESJ          EDIVGT--QNAVRDIKRQITALGD-VNLGAIEEYERVRERFEFLTEQKDDLVEAKTTLYQ
C0ZFN9_BREBN          GEIQEE--TQVVNRLKKQIGALGT-VNLGAIEEYERLSERQQFLSSQEADLNEAKDMLYQ
C8WWA4_ALIAD          GTVAET--ERRLESLRRERASLGD-VNLGAIEEHERLSERVRFLTEQRDDLVAARQQLEQ
D5WPA2_KYRT2          EDPGPL--SRRLEELRRSMQSLEP-VRSGAVEEYGRLRERLDFLSAQRDDLLAASARLND
C4L5Z7_EXISA          IPLEEA--KEEFKLLVRQIEEIGP-VNLNAIEEFDSVHERFTFLSEQRDDLVSAKEDLYE
B1YIN0_EXIS2          ISFEEA--KEELHLLKRQLEEIGI-VNLGAIEEFAEVDQRFTFLSTQRDDLVSAKTDLYA
D3R1B0_MAGIU          DSVATSNLQKSLSQAKEKVRGLGP-VNPCAIEELAAVQERYDFLTAQHDDIVRASRSLTG
D2RLB2_ACIFV          GDLPEGELKKREAQAARELEELGP-VNQAAQEEYQAARERYDFLKKQYQDMVQAREQLET
D1BLY1_VEIPT          GSVS--DWKDEQARLIAEIAELGP-VNPNAVEEYEETKERYDFLTTQLADLDTAKAQLQA
A5UQ60_ROSS1          SDANVEDMQRRIDDLKRRIARLGI-INPLALEEYDEAAARYEFLSAQMNDLRAASATLNE
B8G556_CHLAD          T----DELPAAIEALRARIVRLGV-VNPLALEEYEEAAKRHTFLTAQADDLRAASATLHQ
A9B100_HERA2          AELSAQALNEQIDQLRNKLRRMGT-INPLAPQEYAELGERNQFLTGQVSDIRQAADGLRE
D1C6T1_SPHTD          DDTDPDTLQREVDRLRERLRRIGL-VGEDAIEQYEREAERYTFLRGQLDDVHAAGEALRA
D7CMX2_SYNLT          DGEKEREARQRKEVLTKQLAELEP-VDHGAEAEYEEIRARYDFLNNQYQDITEAKNAIYA
Q0AYV7_SYNWW          TPGEIREARKRIAILQQQLEAIGS-VDIASIQEYEEVSGRYDFVKQQYDDLSSARDSLDE
SMC_LACPL             ---ALPAITEQLKLLKRGLDEIGT-VNLGAIDEFERVKERFDFLNNQASDLTEAKEHLLQ
Q03RT7_LACBA          ---PADDLAVQLKLLKRGLDEIGT-VNLNAIDEYREVKERYDFLTQQRDDLLTAKAQLMT
B2GD41_LACF3          ---ADEELARQIKLLNRGIADLGE-VNTSSIAEYKQVKERYDFLSGQQADLVAAKEQLEQ
A5VKP1_LACRD          ---DEETLATRLKLLKRGLDDLGQ-VNVGAIEEYERVRERYDFLKGQQDDLLASRAQLNQ
Q03FW9_PEDPA          ---EDESLERELKLLRRGLNELGT-VNLGAIEEYDRVSTRYNFLRDQKNDLADSKAQLEQ
A0A249N2C3_LACRH      ---PIPELKSKLKLLKRGIDELGP-VNLNAIDQFKEVNERYEFLTKQQDDLLAAKQQLVA
Q38XR7_LACSS          ---TNDQLKSKLKLLKLGLADLGT-VNLAAIEDYQRVKERYDFLMQQDADLLDAKSQLLA
Q1WU99_LACS1          ---DLNTIEKKLKLLKLGLDELGV-VNIGAISEYERVNERYEFLNSQQNDLLSAKEQLEV
Q04GL1_OENOB          ---DFQSIFSRLNALKSELAKHNA-VNLAAIDELKRVKERYDFLTGQRDDLITASENLKV
Q03VW6_LEUMM          ---DFQNITEQLRLVKRSLDEIGN-VNIGAIEEYESVKTRFEFLTKQRDDLNSAKETLLQ
A0A0U5K8Z4_LACDE      ---NQQNLRRSVKLHRMSLEDIGP-VNLGAIDEYKEVKDRYDFLNGQQNDLLEARSNLQQ
E4SKB3_LACAR          ---TRNELAKSVKLHRMSIEDIGP-VNLDSIQEYEDVKKRYDFLSGQQNDLLKARDDLEK
Q74IP9_LACJO          ---LRKKLEREVHLHKMSLADIGE-VNLNSIEEYEDVKTRYDFLNGQQNDLLKARKDIEE
A0A0T8KIP4_STREE      ----LNLAEQEVQDLEKAIRSLGP-VNLEAIDQYEEVHNRLDFLNSQRDDILSAKNLLLE
A4VVL7_STRSY          ----LAVAEQSLKDLERAIRALGP-VNLDAIEQYDEVNNRLTFLNEQRTDILSARDLLLD
C0MCR5_STRS7          ---DMAAARQKLQQVQQSIRALGP-INSDAIAQFDEVSERLTFLNGQRADLIKAKNLLVD
A2RLZ7_LACLM          ----LAEAEQKLKNLERQIKALGP-INLDAIAQFDEVNERFTFLSSQKDDLLEAKNLLLS
B9EBB4_MACCJ          -AKQLNELRSRVKLTKIAVDELGP-VNMNAIEQYAAVKERYEFLISQEADLLEAKDNLEM
SMC_MYCHR             -----EQARHFVDSLKKELKELGN-VNLEAITEFEEVNQRYQEKKQYIEELTTAKSKIEE
E0TKT8_MYCHH          -----EQARHFVDSLKKELKELGS-VNLEAITEFEEVNQRYQEKKQYIEELTTAKSKIEE
Q4A770_MYCH7          -----KDAREFVNSLNLEIKALGN-VNLDAINDFETTSQRLEKLKKSQNELETARSKILE
C5J708_MYCCR          -----SDARKFVKQLNDEIKALGN-VNLDAIDDFQETQQRFEKLQAHHEELETAKSKILE
A5IYM7_MYCAP          -----DQATEIVREIREEINKLGN-VNLEALEQLVEEEERYNKFVKSEEELTQAKQVLES
D5E4P4_MYCCM          -----DEAREFVETTRDEISALGH-INLESIEELKEKEERFNMLSSNQEELYQAKETITS
Q6KHN4_MYCMO          -----EEAREIVKTLQTEIKALGN-INLDAIESYEEVNTRYNTLKSSEEELLNAHATIIN
Q98PK8_MYCPU          -----TEAEEFVGRIKEEIKDLGN-INIDSIKSYEEISERYDGLKATESEIVDAKDKIES
D1J8Q8_MYCHP          -----EVARKTVADLKLDIRELGH-VNLDSINQLEELETRYKEVKSQEQEIISAKTTIED
Q4A588_MYCS5          -----NLAKEIVSTLKKEIQEIGS-VDEKAIEKYKAIKKDYDFLVTQRNEIQNAIGETKE
SMC_MYCGE             ----SMQAHNKIAKLQNQLNEMGV-INMESIAEISEKQKRFDDINAEYESAQQAVENLQK
SMC_MYCPN             ----TMQAQNKIARMQSQLDEMGP-INLESIAEIADKQKRFDDINGEYESLQTAIKDLQT
Q7NBU0_MYCGA          ----LSQARSEVVKLQSTLNNLGA-INMEAIQELDIKKERYEKLYSQQQELINARERINQ
Q8EVS6_MYCPE          ----DQAARNRIERLSKEIGYIGP-INMDAVNELKEKSERYEKMRNEEIEITQAKENILD
Q9PR04_UREPA          ----ESAARLRIESLKIDLEKYND-INLNALEEYEEKQAEYDSNFLEYENCKQAVDQISS
Q6F1N4_MESFL          ----PEETRTRIQELTIELKSIGE-VSMDAIQEYEETKKEYDYYVTNLNEVQESADKLNE
Q6MTD2_MYCMS          ----EQVARERIIELTTYIQNIGN-VNMDAIEEYKNEKERFDYYDQQIKDIYDAKEKLES
E3GP81_9FIRM          ----LDLSPENQRSLKGRMAAMGN-VNVGAIEEYLELNERYGFMSAQYKDLTKAKGELER
SMC_HALOH             KITNYSRAGQKVKELKNAIKKLGT-VNQGAIEEYNDLVDRLDYLQNQHDDLLKAKESITK
E4RL35_HALHG          KAEEEAEVEAKIKGLKAKIKQLHP-VNEAAVEEFKELKDRLDYLHEQQNDLKHARRSIEL
D9QRN7_ACEAZ          PIEDYEVVEERIEELKSAIDELGH-VNLGAIEEYETLKERFSFMKEQHADLIEARNSLTE
A8MHB7_ALKOO          EIADASNTNKEIKELKDRLKALGV-VNLDSIEEYEKVKERYDFLKAQQDDLNEAQKSLVK
A6TRT3_ALKMQ          ETGDLTGSVKEIKDLKEKIKALGT-INADATEEYIKVKERHDFLNQQQMDLDQAQQSLMK
A3DDY2_HUNT2          DIGSMAQAQKRIAEIRNEIKELGP-VNVAAIDEYIKTKERFEFMSAQKSDMEQAEKKLQK
D5X8N2_THEPJ          EISSKREAQARIKELKSLIADLGA-VNLAAIEEFEKVSERYNFLKAQYADLEEARVSLYK
D9R048_CLOSW          EWTSLPEIKRMIQSLKEEIRKLGN-VNVNAIEDYKEVSERYGFMKTQHDDLVSAEATLLK
C4Z0E6_EUBE2          ELTDISDIKKQINILKANIKKLGV-VNVNAIEEYKEVSERYNFLKTQHDDMIKAEEALVL
C4Z924_AGARV          AYDDLPSLKKLIAGIKDEIRRLGD-VNVNAIEEYREISTRYEFLKGQHDDLIEAEKTLVG
E0RV40_BUTPB          DMTDVPAMRKETSSLKDSIRKLGD-VNVNAIEDYKNLMERYTFMKTQHDDLVEAEEQLKG
A9KLR0_LACP7          ELSNPVTNKKGITELKNSIKTLGD-VNVNAIEDYKNLSERYEFLTTQKADLISAEETLMG
D9S347_THEOJ          DLGGYERMKQELYSVKDMIMTLGP-VNLNAIDDYENLKSRYDFLKSQRDDLLQAKIKLDD
B2A2N3_NATTJ          AIDDFKKYEYQIKNIQSEINQLGE-VNLGAIEEYNRLQERMDFLKDQQKDLRSAQKSLNK
A8F8R1_PSELT          ----LESLKNELEDLQNKIKYLGP-VDVTAIDEFNQVEQKFNDLTMQKKDLQDAQEKIIN
A5IN04_THEP1          ----LEEIYRQIKDLENKIKYLGP-VDLTAIDEYEKLREEYEEILKQKEDLEEAKRKLEE
C5CIS4_KOSOT          ----LEKTRMELEELENKLKFLGS-VDLDAIEEYKLVDAEYQELMVQKEDLEEARQKLIK
A7HMD4_FERNB          ----LDELANEIKDLENKLKMLGA-VDLTAIDEYKAIEQEYNELLKQKQDLEDAKKKLEE
B7IHN5_THEAB          ----VNTIKKEMDDLENKIKYIGP-VDFEAEEEYKEVVKKYEELELQKKDLENAKQKLIE
SMC_THEEB             ----LRDIQQQCQALEQRLRAMEP-VNMLAIQEFEETQARLKELQEKLAVLAAERTEILL
Q2JHS4_SYNJB          ----LDELQRQKRKIEEQLRSLEP-VNMLAIAEYEQTQARLRDLSAKLETLHQERTELLL
SMC_SYNP6             --QGIEALQHELRSLAKRIQAMEP-VNMLALEEYERTQARLEELSEKLTTIEAERTELLL
B0C9C4_ACAM1          ----LEQLREELQKLQKRLQAMEP-VNMLAIEEYERTQERLVELTEKLTTLESERTELLL
Q115J3_TRIEI          ----MTELEKEVRSLQKQLQALEP-VNMLALEEYEQTQKRLEELSQKLGTLEEERTALLL
B2J925_NOSP7          ----LEELQKELRSLTKRLQAMEP-VNMLALEEYERTQNRLQELTQKLETLEGERTELLL
E0UKI1_GLOV7          LAQYLEQLQSEIKNGKKRLEAMEP-VNMLALEEYERTKERLDELSGKLATLEGERTELLL
B7K4Q6_RIPO1          LTPHIEQLQKEIRNGQKRLEAMEP-VNMLALEEHEKTQERLNELTEKLTTLESERTELLL
B0JSN6_MICAN          SDRDFEKIQSDIRQLQKKLAALEP-VNMLALEEHQKTKERLDELSEKLQTLEGERTELLL
SMC_SYNY3             FANILEELERSIRNGQKRLEAMEP-VNMLALQEYEKTEARLGELSEKLQTIAGERTELLL
Q84EC7_SYNP2          ITEQIEKSQRANRRTQKKIEDLEP-VNMLALKEYEQTQIRLGELSEKLSTLEQERLEVLA
D3EQ04_ATETH          LLTHTEKLQKEIYKKQRQLELMEP-VNMLALEEYEKVQERLSELTSKLVTIQEERTELLL
SMC_GLOVI             ---SLEQLQATRLRKQRRLEALEP-VNMLAIEEYDRTAERQGELSEKLATLQRERSELLL
A5GQT1_SYNR3          --AGLEALQEQLRVIQQRMEALEP-VNMLALEELEQLEARLAELRERLEVLGNERHELLL
A9B9B9_PROM4          --NGLDFIQDQLKNLENRLEALEP-VNMLALEELEKLESRLFALAEKLEVLTEERSELLL
A2BNJ6_PROMS          --KGLESLQSEISIINAKLESLEP-VNMLALDELEELIERLNGLREKLEILSNERSELLL
Q46EX0_METBF          ----YETVYMRIQAIDEALRRLEP-VNMRAIDEYNEVELRLSDLQGKRDTLFTEREQLLE
D7EAF5_METEZ          ----YETVRTRIASIEKAMEDLEP-VNMRAIDEYDEVLNRHEEMKNRRDTLSNEREQILE
D1YW78_METPS          ----VDKVRASISQLEKKMQALEP-VNMLSITEYDGVQARLAELTGKRDTLQKERENILE
A0B8B9_METTP          ----SETIAAKIRALEEEMASLEP-VNMLAIDEYERVDKRFRNLSDRREVLHREREGIIE
D4GT30_HALVD          ----HDTVESEIERLTEEMEELEP-VNMLAIDEYDDVKADLEALQERRDVLVEERDAIAD
A7IAD8_METB6          ----LTEIEGKIADAELALHKIGA-VNMLAIEEYEKIERQVQERTERKDTLSKERETLIE
A3CWK7_METMJ          ----IAAIDAGIAEAERALKKIGA-VNMLAIEECDRVAARVEERTEKKEVLSRERMMLLE
B8GG37_METPE          ----LDEIEEGIATTDRAIRKLGA-VNMLAVEEYARVEERVGERREKKEILSVERSSLME
E1RII6_METP4          ----LKEIEEGLDESESALRKIGA-VNMLAIEEYDRVAGRVEERSSKKAVLSNERTKIIE
Q2FLH3_METHJ          ----EEEIEDRSQKTIVAIERLGD-VNMRAIEEYEQVHAVVAERMSRVETLKREMNDIQE
A2SS75_METLZ          ----MDEILDRVATTERAVRKLGN-VNMRAIEQYDEVQKRSIERTEKKETLSRERQALLD
D3RYW2_FERPA          -----EDAIEQLERVEKELANFGE-VNMKAIQEYEEVKKRRDDLFERKLTLEREREEILE
O28714_ARCFU          ----LEKVEKVLDEVLVELSTFGD-VNLKAIQEYEEVKARRDELVEKKMVLEKERADILD
D2RFP2_ARCPA          ----LEYVERKLLQVEEELKSFGE-INMKAIQEYEDVKKRLDELIEKKKTLERERKEIIE
SMC_THEAC             ----IGDLQAMRQEIERAIMDLGE-INNAAPQQYEDALKDLDDYEKKHEKLMEEKKALEE
Q97AI9_THEVO          ----EGDIVLEKRKCEADISALGD-INNGAIQEYEESVKAYNELKDKKNRLELERRSLQD
SMC_METVO             YSLEIDDLERNQALLESSIKKLEP-VNMRAIEDYDFINERYEELFGKRKEYEQEEGKYLQ
A6UQ42_METVS          NGFDVDTLERHQMNLENSLKKLEP-VNMRAIEDYQYIVDRYEELFQKRADYENEEKKYLQ
A6UVP1_META3          NEMNDTELEQLTIKLDNSIKRLEP-INMRAIEDYEYIEQRYNELFDKRKEYEQDEKKYIQ
SMC_METJA             EKKDIEELEIYIGELENEIKSLEP-VNMRAIEDYNYVAERYKELIEKRKEYERDEKKYLQ
C9RFQ3_METVM          EEKTIEELEIYIGELESEIKKLEP-INMRAIEDYKYVEERYKELIEKRKEYERDENKCLQ
D5VT24_METIM          KEKDIKELEFLISEIDKEIKALEP-VNMRAIEDYNIIYERYKELLNKRESYEKEEKKYLD
D3SQ87_THEAH          -QESFQKLRDQLQKLQSKLEALGS-INMKAEEDYREYKERHQEYQERYSKLKEEKESIIR
D3DG53_HYDTT          -KEGYTKIKEVMEKVRKQMEELGT-INFKAEEDYKEYEARHRDYTERYQRLNQEKKAIRD
SMC_AQUAE             -EESIPKLKEKLKRVTEEIQKLGS-VNFRAEEDYAEELKRFNDYKEKQQKLKEESKAIKK
B4U7R1_HYDS0          -NQSASKLKEELERTKKLLESMSD-INLKAEEEYEETLNRLKDYKEKLDQLIKDKQAIKA
C0QSN8_PERMH          -EGDLKVLEKELKELQEKRQSIGA-VNQKALEDYDQIKERFDDLSQKLKVLIEEKKSIEE
B2V736_SULSY          -EEDVKEIEKKLKELQERRRNLGF-VNEKAIEDYEEEEKRYNEIKEKLDTLINEKKAIEE
SMC_PYRFU             -PLDLEKVKKEIEKMEEEIRSLEP-VNMKAIEDFEIVERRYLELKSKREKLEAEKESIIE
C5A612_THEGJ          EPEKLEELKERIEAMEEEIRSLEP-VNMKAIEDFEVVERRYLELSSKREQVLAEKESIEE
D1CC09_THET1          ---DLGDLIKKIEQSRQKIARIGP-VNPLAIEEYNQVRDRVDFLESQLRDISKAKHNLED
D3TAQ9_ACIB4          ---SISSLKNRLNDVQAQMMSMGP-VNMRSIEEYDEEKERYDKLKEEYKNLEKEKKNLLE
SMC_HALMS             YGQDLKECSNKLKNYKNEYNRLGE-INWQAIEDYDRQKLRFDFLRVQEVELKQSLEDLET
Q6L0R1_PICTO          -----SEIKALVDKYKSEINALGP-INQMAVSEYNETLERYGENMEKYKKLESERSELME
C1A7M6_GEMAT          -DLSTDDLRVEATQLRTALDELGP-VNPLAIEEHEEEQRRLEFLTSQRNDLVAAKQSLHQ
C9RN51_FIBSS          --YTQPEADREIRELRGKIKELGP-ININVMEDYEDEKKRLEEVEKQFDDLDRARASLDR
D1B5Z0_THEAS          -----EGLRQRIRELERALREMGP-VDMGVLSESRSLDERMEFLKDQMEDLRRAMGELER
                                               .                                  

SMC_FUSNN             LIQEIDERIHEDFHTTYQNINENFNKMCDETIRN-TEGRLNIINPE------------DF
E3H7H1_ILYPC          LIKEIEDIIEMRFFEAYKSINENFGYMCREILSN-SEGKLELTNVE------------NI
D1AK68_SEBTE          LIKDIEGEITEKFSYALKEINSNFVYMCKEILNN-AKGEIKILDEE------------NL
SMC_CLOK1             VIDAMTEKMKGVFKENFVKLKKNFNDTFRELFKG-GSADLVLTK-------------GDE
D8GS00_CLOLD          VIDAMTEKMRTVFKKNFDRLKESFNETFKELFKG-GSADLIITG-------------GDE
Q97IA1_CLOAB          VIEEMTSKMRTVFNENFKKLNENFKITFRDLFKG-GNADLILSG-------------DDE
A0Q0Y7_CLONN          VVSEMTHKMKTVFHENFNKLRVNFNETFKELFKG-GKADLILES-------------DDE
Q895M7_CLOTE          LIDGMTNKMKIIFKENFQKLRENFDETFKELFKG-GTADLLLSS-------------EDE
Q0SSA4_CLOPS          VIEEMTSKMRAVFRQNFNILNKLFDETFKELFKG-GSAKLVLGE-------------GDE
A6LSM4_CLOB8          VIEEMTNEMKSLFKENFKILNYNFDKTFKDLFKG-GSAELILGE-------------GDE
D9SLC7_CLOC7          VIEEMTEKMKEVFNENFEKLKVLFNETFQQLFKG-GSGDLLING-------------DDV
D7APA8_THEM3          VIEEANKIIKTKFKDGFEILQIQFKETFRRLFGG-GNAELILTDE------------DNL
Q8R9W7_CALS4          VIEEASKIIKIRFQDGFEVLRAQFKETFKKLFGG-GNAELVLTDE------------KNL
D9TN88_THETC          IIEETNKIIKTKFKDNFELIETQFKETFKKLFGG-GRAELILTNP------------DDL
C9YKI7_CLODR