CLUSTAL format seed alignment for MF_01895

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      ------------------------------------------------------------
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      ------------------------------------------------------------
Q1MQS9_LAWIP      -------------------------------------------------------MKRSQ
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      ------------------------------------------------------------
C1F8V5_ACIC5      ------------------------------------------------------------
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         ------------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        ------------------------------------------------------------
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         ------------------------------------------------------------
E6SKU1_THEM7      ----MPKRRKKDLDQGTPDAGTRDGRTGGEGARGGRRPASRAAVAAEAAGARHAAAVKPG
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      ------------------------------------------------------------
D7CS88_TRURR      ------------------------------------------------------------
D2QSQ5_SPILD      ------------------------------------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      ------------------------------------------------------------
D2R7Z3_PIRSD      ---------------------------------------------------MNLPEFEEQ
A7HAA8_ANADF      ------------------------------------------------------------
Q1D4N8_MYXXD      ------------------------------------------------------------
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ------------------------------------------------------------
RNR_VIBPA         ------------------------------------------------------------
RNR_ECOLI         ------------------------------------------------------------
RNR_SHIFL         ------------------------------------------------------------
RNR_HAEIN         ------------------------------------------------------------
E6WR29_PSEUU      ---MNKTGSRGSSRKGAGGAGAGKGAGSSVGGKGGKRQAGKLPPWMPEPAPATRQAGRSG
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ----------------------------------------------------MGGR-NPS
Q0BU01_GRABC      ----------------------------------------------------MARRLKPA
B0T0I6_CAUSK      ------------------------------------------------------------
C6XL74_HIRBI      ------------------------------------------------------------
Q2RPE7_RHORT      ------------------------------------------MPSLAPLWHDGADPGNGI
Q28VI9_JANSC      -----------------------------------------------------------M
A8I2E1_AZOC5      -----------------------------------------MSGRPAQLDFCPCHCGPRD
E0THA1_PARBH      ------------------------------------------------------------
D5BRG4_PUNMI      ------------------------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      MTNTDLFDTGSVLAALEDAGAAGLKIAALEDALGLSDDQDGEAQRARLRRLLTKMAKDGA
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      ----------------------------------------MNKTLKILNRSKKPLT----
E4TG32_CALNY      -------------------------------------------------MSRKKVK----
RNR_AQUAE         ----------------------------------MDKEKLEKEVIKLLSKKKKPLH----
B8DP48_DESVM      -----------------MTKKK---------REESYVLPDANDLATLFREAHRPLK----
C6C1J0_DESAD      -----------------MGKKR---------KSKNPGMIKPYEAMNVFKQSRKPLS----
C7LXJ9_DESBD      -----------------MPPKK---------QAKQLKFSKKN-LLAALHQSGAPLR----
B8IYR8_DESDA      -----------------MKKQKKLRGTTTASAPASGGFPSTEELLQTLAAQNRPMR----
Q1MQS9_LAWIP      HRSQKTKDNTLGQKTSKIQKHKP-KSYITRQSVQPGSKINGLHILSLLYNSDHPLS----
Q6ALZ0_DESPS      ---------------MTKKRKQSYKKKSTSFSPKKTQKLNSQEGEILYQIYASQAP----
E6W3Z0_DESIS      -------------------------------MPQRDEKSLAEEILALLDTYGEPVP----
C1F8V5_ACIC5      ---MTDRELLRHIERSPGQRAGYKHLVRILGLGGGRERRLLLEHLSRLTAAGRLVK----
RNR_MYCGE         --------------------------------MKVLTELQKQIFTIVKKENGKPIP----
RNR_MYCPN         --------------------------------MKVLTDLQKRIFAIVKKENGKPIP----
RNR_UREPA         -------------------------------MSDFTKQTITEVIS----KEERPIP----
Q7NB22_MYCGA      -----------------------------MNNNNNRRKIINDILQIVRLEDKKPIP----
RNR_MYCPU         --------------------------------------MKNLVLQNLKSNKAYSFL----
C5J794_MYCCR      ------------------------------------MFIPDQILCKFLT-QPKTFI----
A5IXZ7_MYCAP      ------------------------------------MINETVVINTIKENPHINTN----
Q4A6A7_MYCS5      -----------------------------------MNIDKIKLINYIKARKNVSFI----
D1AQ67_SEBTE      -------------------------------------MRELKDLKEILEHRSLTYN----
Q6F1Q7_MESFL      ------------------------------------------MNKEIILQIVKENN----
RNR2_LACLA        ---------------------------------------------------MVQLS----
RNR1_LACLA        ----------------------------------MSIREVIMDYLENSSKKALSVE----
E6U4I2_ETHHY      -----------------------------------MNMTKTQERVLRFIRADGYRP----
E6UGT4_RUMA7      ------------------------------------MKQDYRKMIYNKLKASGKRP----
RNR_BACSU         ----------------------------------MEKEAFMEKLLSFMKEEAYK------
E6SKU1_THEM7      EMEEPAEAARAAAPDAREAAGATAPQAAGAVKPGDAVQAWEDRILAFMREKAYR------
RNR_THEMA         -----------------------------------MSSIRKKDVERFILSDDYK------
D7BIB2_MEISD      ---------------------------------------MTERILEYLRKNPTK------
D7CS88_TRURR      -----------------------------------MSELDRERLYAFFQQHPEK------
D2QSQ5_SPILD      ---------------------------MRNGKSKQTKYTKDAASQPAGRQSHTARPREKG
B3ETS7_AMOA5      -------------------------------------MSQKQKNKQAKKHNNIRLPDQHR
C7PAC9_CHIPD      -------------------------------------MTKKKKPQKHSSQKK--------
D0J9E8_BLASP      -------------------------------------MKLEKKIKKFAGLSNNS------
D5H9E3_SALRM      -------------------------------------MLAEMTAQQLVERDGRK------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      -----------------------------------MADWQPQILSVVTHPAYTPLK----
D2R7Z3_PIRSD      SDRPLPESSSISDSSPLSELPESPADFPLEKDSPAARKLEPLVLAHVLAKNYQPVK----
A7HAA8_ANADF      ------------------------------MGHEGQERRRTALVEELRRAAGKPLS----
Q1D4N8_MYXXD      ------------------------------------MSLSQDLLKQILAEADHPLG----
RNR_BUCAI         ------------------MVVDPYQKREAKRYKNPIPS--REYISSCLRTSQDL------
RNR_BUCAP         ------------------MVVDSYQKKETKKYRNFIPR--REQILFLLKTDKDL------
RNR_VIBCH         --------------MSDTTHLDPFADREADNYDNPIPS--REYILEFLTQANVP------
RNR_VIBPA         --------------MSDNIPNDPFADRESQNYENPIPS--REFILEFLEQAGVP------
RNR_ECOLI         ------------------MSQDPFQEREAEKYANPIPS--REFILEHLTKREKP------
RNR_SHIFL         ------------------MSQDPFQEREAEKYANPIPS--REFILEHLTKREKP------
RNR_HAEIN         ----------MTKKRKNLINQDPHYKRELEKYGNPIPS--REFILTVIRDNNAP------
E6WR29_PSEUU      AGNAPSAARPPRRNTAGPAVTDPFAAREAQRYDNPIPS--REAILAVLEEAEGP------
Q15PA3_PSEA6      -------------------MNQTAQLSTIRTYANPIPG--REFILSLFSSLKKH------
A9GZQ2_GLUDA      DPQPTACPS-------PDVPPTDPRPPAPPQPGGGLPD--REALRRFVTEASGR------
Q0BU01_GRABC      KGSAAKGPSGGKAGRKSSRPSSQAVRPVPGHEPGTMPS--REAIRRFVAEASGR------
B0T0I6_CAUSK      --------MAKPRSPKSSKFPAASKGVKAPKPPAGLPD---RETLIAFLRDAGE------
C6XL74_HIRBI      --------------------------------MSNITE---KAVLEFLERNPDK------
Q2RPE7_RHORT      RARRVFPQDSLWLSRPNRRFPDPKDSPLTPKAPKHVPFPSREQVLEFIRAANGE------
Q28VI9_JANSC      TPPHLRATSP---------------------PMSNIPS--KEQILQWITDNPGK------
A8I2E1_AZOC5      TPLPKRPSTPKRPAPSRKTRAVRQPDAPAFKATGVLPG--KEEVLAFIASQGGK------
E0THA1_PARBH      --------------------------------MTQYPS--DSDILSYLRKREEQGEEA--
D5BRG4_PUNMI      ---------------------MADQDNSDDKTITGLPT--QQAITDYVNSCATP------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      --------------------------------------MNKEFIKWFYDQKSIQVT----
A9G9F9_SORC5      ----------------------MRSSSRGDPPTTGSGARRREAVVDLLSSFKRALH----
D0LU85_HALO1      LTRPARGVYAAPAKAATQGAKKATKKAAAKKAAAKKAATKKAATKKAATKKAATKKAATK
D5EIW1_CORAD      -------------------------------------MDLRDTLLKLLRAPDYVPLR---
                                                                              

D4H3I7_DENA2      ----------------------------------------FKQLLSQSGLDAKTLKRQLR
E4TG32_CALNY      ----------------------------------------HKKKI---------------
RNR_AQUAE         ----------------------------------------FLQIAKALGLGKKERKTLKK
B8DP48_DESVM      ----------------------------------------IDALMRMLGLHRRMKKELED
C6C1J0_DESAD      ----------------------------------------VGELEKRVGLTKRHRKFVKN
C7LXJ9_DESBD      ----------------------------------------SKNIFDLFDADASLKKVIKS
B8IYR8_DESDA      ----------------------------------------LDGLLRVLGLARRERKELEA
Q1MQS9_LAWIP      ----------------------------------------SNEIITRLKITKQKKQALEL
Q6ALZ0_DESPS      ----------------------------------------LRAKQIFAKCKKYSYEQLQN
E6W3Z0_DESIS      ----------------------------------------LRHLRGALGLSKSDTSTLQR
C1F8V5_ACIC5      ----------------------------------------VDKEHWALAQAAHSRDNLVA
RNR_MYCGE         --------------------------------------PGIVVRMMENSPNFPGKHLIYR
RNR_MYCPN         --------------------------------------PGIVVRMMENQAGFPGKQQVYR
RNR_UREPA         --------------------------------------AAILAKKVLEKIPTLNKTDVYK
Q7NB22_MYCGA      --------------------------------------PGIIVKKLDNR---YTKTAIYK
RNR_MYCPU         --------------------------------------EIARINKINPNFNSQLSKALFS
C5J794_MYCCR      --------------------------------------EITKNFNIPYNKNYTITNQISK
A5IXZ7_MYCAP      --------------------------------------TLLRKLNISPRHSKILTNMLIN
Q4A6A7_MYCS5      --------------------------------------ELANYLKINRKDNKEFSAYLVS
D1AQ67_SEBTE      --------------------------------------EIVSSLGWSKKNRKKNKQILEE
Q6F1Q7_MESFL      --------------------------------------EMISINSLATKLNYFDLPKLED
RNR2_LACLA        --------------------------------------ELASALNQTESK----------
RNR1_LACLA        --------------------------------------ELSVALHMNKAKDYKVFVKTLA
E6U4I2_ETHHY      --------------------------------------MQVNELAAALSLPESGRPAFFR
E6UGT4_RUMA7      --------------------------------------VTFKELVKSFRKGNFDFDKFAK
RNR_BACSU         ------------------------------------PLTVQELEEMLNITEAEEFKELVK
E6SKU1_THEM7      ------------------------------------PLTATQLAAAMDVEGPEAEAAFRA
RNR_THEMA         ------------------------------------PMVLKELYKKFRAKTREQRKKVRE
D7BIB2_MEISD      ------------------------------------TYSLREVQRMLRLE----REEVKS
D7CS88_TRURR      ------------------------------------PWHLQDLQKRLKLSD---RADLRR
D2QSQ5_SPILD      VERSGKSHVRPIQQADSFLDEMKNDIMAFFQINDEQSFTQEQVLDHFDTSDRRMKLIMHG
B3ETS7_AMOA5      L------------------------LLAFLEAAAGKGFTFSSLIKHFKGNLS--KENIKE
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ---------------------------------------------------------YKT
RNR_CHLMU         ---------------------------------------------MGKAKNK--KKVLKN
RNR_CHLTR         ---------------------------------------------MGKAKNK--KKFLKN
RNR_CHLPN         --------------------------------------------MLKKPKRKPGRRTYGK
D5SPD1_PLAL2      ----------------------------------------WQQLAKEVGAQKHDWTKFRR
D2R7Z3_PIRSD      ----------------------------------------PKVIAKQMKLRSDQLPALKL
A7HAA8_ANADF      ----------------------------------------IRELMQRARIHPGERTDVKR
Q1D4N8_MYXXD      ----------------------------------------IKELLRLAGLHPGQQTELKR
RNR_BUCAI         -------------------------------------ISQKNLEKKFGINNQESKKALRR
RNR_BUCAP         -------------------------------------ISQKKLEKKFSINSQEQKKALRR
RNR_VIBCH         -------------------------------------MNRNDLFEALKLEGEEQYEGLRR
RNR_VIBPA         -------------------------------------MNRNDLFEALKLAGEEQYEGLRR
RNR_ECOLI         -------------------------------------ASRDELAVELHIEGEEQLEGLRR
RNR_SHIFL         -------------------------------------ASRDELAVELHIEGEEQLEGLRR
RNR_HAEIN         -------------------------------------MNRDEILTALSIRNEDQIEAMRR
E6WR29_PSEUU      -------------------------------------QTAEQLAGLLGLHDPERFDALGK
Q15PA3_PSEA6      -------------------------------------LNREQIADALALNSPQEKEALRR
A9GZQ2_GLUDA      -------------------------------------VGKREIARAFNLGPEHKA-ALRA
Q0BU01_GRABC      -------------------------------------VGKREIAKAFGLGAADKL-HLRD
B0T0I6_CAUSK      -------------------------------------AAKADIARHFGLKGADRR-ALRE
C6XL74_HIRBI      -------------------------------------SNKREIARGLGVQGSDRV-ALRQ
Q2RPE7_RHORT      -------------------------------------VDRREIARAFHITGPERA-DLRT
Q28VI9_JANSC      -------------------------------------RSKRDIAKAFGIKGAARI-DLKR
A8I2E1_AZOC5      -------------------------------------VSKRDIARAFGLGSGQKI-ELKA
E0THA1_PARBH      -------------------------------------PTQRDLADVFSVKNAGRR-QFRA
D5BRG4_PUNMI      -------------------------------------PTQREIARAFNIGQDYRA-PLRR
RNR_HELPY         ---------------------------------------MQGFLRSLFFGVKKIPKPFAP
RNR_HELPJ         ---------------------------------------MQGFLRSLFFGVKKIPKRFAP
A9NF96_ACHLI      ----------------------------------------YELVKEVYKEKTDELLEAHK
A9G9F9_SORC5      ----------------------------------------ANEIAERLGVEPSRYAKLQR
D0LU85_HALO1      KAATKKAATKKAATKKAATKKAATKKAATKKAATKKAATKKAATKKAATKKAATKKAATK
D5EIW1_CORAD      ----------------------------------------QEEIVAVLRLSPDKAKKATK
                                                                              

D4H3I7_DENA2      DLVRQNK-AEKYRNGTFVSKNTPT------------------------------------
E4TG32_CALNY      -------------------KDNQQ------------------------------------
RNR_AQUAE         VMRKLKKEGKVKVVKGKYEYTGEE------------------------------------
B8DP48_DESVM      RLDDLVRQGRIIRLRGGAWGLVEQL-----------------------------------
C6C1J0_DESAD      ILKDLVREGKIIKI-GSAYGVVEKM-----------------------------------
C7LXJ9_DESBD      TLAQMVESGEIVQM-GKSYGLIDNL-----------------------------------
B8IYR8_DESDA      ALDDLERQGSALRLRGGLWTRPENL-----------------------------------
Q1MQS9_LAWIP      VLNVLQKQGQIVCTKGEKWAIASPM-----------------------------------
Q6ALZ0_DESPS      SLHTLVQKKIIHLVGGKTYVVSNKE-----------------------------------
E6W3Z0_DESIS      VLLSLCKEGRAGRDTSDRYFSASSA-----------------------------------
C1F8V5_ACIC5      GRLDLHRDGYGFVRPAQRDAAGDIF-----------------------------------
RNR_MYCGE         AIDDLLDWAILRKAGGVTNQLL--------------------------------------
RNR_MYCPN         AIDDLLEWHIFRKSGGATNQLL--------------------------------------
RNR_UREPA         LIDLLIQENTIKKLE--NNRLV--------------------------------------
Q7NB22_MYCGA      EIDKMLANGELKKLA--NNKVV--------------------------------------
RNR_MYCPU         LLDQGLI---VKNNDG--------------------------------------------
C5J794_MYCCR      LIENFVV---FKLPDG--------------------------------------------
A5IXZ7_MYCAP      LSSRDLIA--FDKRDS--------------------------------------------
Q4A6A7_MYCS5      LIKRNKI---FKTFDS--------------------------------------------
D1AQ67_SEBTE      WIDRGE---ILLIKSG--------------------------------------------
Q6F1Q7_MESFL      YLKELNEENILAFTTE--------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        SLEAEHLLNFTAKGKV--------------------------------------------
E6U4I2_ETHHY      LLQQMEREGSLTISKT--------------------------------------------
E6UGT4_RUMA7      TVDKMKKKGEIIEGKM--------------------------------------------
RNR_BACSU         ALVALEEKGLIVRTRSDRYGIP--------------------------------------
E6SKU1_THEM7      ALERLEAAGRVVRTRTRRYGVP--------------------------------------
RNR_THEMA         VVKKLEKEGRIFRDSRGRYRKL--------------------------------------
D7BIB2_MEISD      ALAELVKQGRLIEPRRGLYALP--------------------------------------
D7CS88_TRURR      ELGALVEEGRLVRTRRRSYGLP--------------------------------------
D2QSQ5_SPILD      LIGELTDEGTIVRQPDGTYRAD--------------------------------------
B3ETS7_AMOA5      ALADLVIQGAIERRDRGKFLVP--------------------------------------
C7PAC9_CHIPD      -----TFRGTVQITRSG-------------------------------------------
D0J9E8_BLASP      -----LAIGFINITSYG-------------------------------------------
D5H9E3_SALRM      KATTRQHTGVLQCHDKG-------------------------------------------
RNR_CHLMU         KQQVLVPGI---------------------------------------------------
RNR_CHLTR         RKQVLVPGT---------------------------------------------------
RNR_CHLPN         SLKIFIPGT---------------------------------------------------
D5SPD1_PLAL2      SLEELIEGKRLHRTSGGLIKVP--------------------------------------
D2R7Z3_PIRSD      AIRRLVKAGKLAYGSSHMVRKPDLLPPLPPESAKAREGTKKSKPARDLAVESTDDDLPDD
A7HAA8_ANADF      ALRDLTREGVLLRDGKRFSL----------------------------------------
Q1D4N8_MYXXD      ALRELVRQGDILKDGKRFVPRQPSRREADVRAREQGAPMAWRQRDAAGPREGGPDRGPRH
RNR_BUCAI         RLRAMERDGQVIYTSNRCYVAPE-------------------------------------
RNR_BUCAP         RLRAMERDGQIIYTRNRCYITPE-------------------------------------
RNR_VIBCH         RLRAMERDGQLVFTRRQCYALPE-------------------------------------
RNR_VIBPA         RLRAMERDGQLVFTRRQCYALPE-------------------------------------
RNR_ECOLI         RLRAMERDGQLVFTRRQCYALPE-------------------------------------
RNR_SHIFL         RLRAMERDGQLVFTRRQCYALPE-------------------------------------
RNR_HAEIN         RLRAMENDGQLVFTKRKRYALPE-------------------------------------
E6WR29_PSEUU      RLGAMVRDGQLVQNRRGGFAPVE-------------------------------------
Q15PA3_PSEA6      RLRAMERDGQLSFQRKG-YQLID-------------------------------------
A9GZQ2_GLUDA      MLRELALEGTLVPAGARRF-----------------------------------------
Q0BU01_GRABC      LLKDMASEGNLAPAGHKRFMPAGGSMLPHA------------------------------
B0T0I6_CAUSK      MLRELEAQGALGKRGRRGFAE---------------------------------------
C6XL74_HIRBI      ILKKLETEGTIARTGKRQFSS---------------------------------------
Q2RPE7_RHORT      LLKELESEGALQRGRGRRIAP---------------------------------------
Q28VI9_JANSC      ILRELQEEGHLEKVG-RTYRD---------------------------------------
A8I2E1_AZOC5      LLRDLKDEGAVEGGR-RRMHV---------------------------------------
E0THA1_PARBH      TLADLRDEGRIAVENRRILLK---------------------------------------
D5BRG4_PUNMI      LLRSLSEQGILARRDGRRIAT---------------------------------------
RNR_HELPY         LVEKGVLKEALELKKDRYFLKEG-------------------------------------
RNR_HELPJ         LVEKGVLKEALQSNKDRYLLKEG-------------------------------------
A9NF96_ACHLI      EYFDIIDNTHIQLKKR--------------------------------------------
A9G9F9_SORC5      LLEELSLEGSIVALPGQRFRTSQKQ-----------------------------------
D0LU85_HALO1      KAATKKKDAAAKQSATKTAASDEPSTKKAAAKKAPKKKAPAKSPKSKRGAAKAAAPAHEE
D5EIW1_CORAD      LIAQLLDSGEVVRIKRDRLVMPK-------------------------------------
                                                                              

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      ------------------------------------------------------------
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      ------------------------------------------------------------
Q1MQS9_LAWIP      ------------------------------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      ------------------------------------------------------------
C1F8V5_ACIC5      ------------------------------------------------------------
RNR_MYCGE         ----------------------------------------------------VNYEPAEP
RNR_MYCPN         ----------------------------------------------------INYELADP
RNR_UREPA         ----------------------------------------------------IGYLDYEF
Q7NB22_MYCGA      ----------------------------------------------------LGYQNSAP
RNR_MYCPU         -------------------------------------------------------NFIKV
C5J794_MYCCR      -------------------------------------------------------RYHCP
A5IXZ7_MYCAP      -------------------------------------------------------SYVAL
Q4A6A7_MYCS5      -------------------------------------------------------NYYVP
D1AQ67_SEBTE      -------------------------------------------------------KYTLP
Q6F1Q7_MESFL      -------------------------------------------------------KNVYL
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        ------------------------------------------------------ELAEKE
E6U4I2_ETHHY      -------------------------------------------------------KKVHA
E6UGT4_RUMA7      -------------------------------------------------------GFTLG
RNR_BACSU         ----------------------------------------------------EKMNLIKG
E6SKU1_THEM7      ----------------------------------------------------ERMNLAVG
RNR_THEMA         ----------------------------------------------------GE-DLKVG
D7BIB2_MEISD      ----------------------------------------------------EAKPAPKR
D7CS88_TRURR      ----------------------------------------------------QEMNLRP-
D2QSQ5_SPILD      ----------------------------------------------------ADANVVEG
B3ETS7_AMOA5      ----------------------------------------------------FNIDKLPY
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      ------------------------------------------------------------
D2R7Z3_PIRSD      VVNDLA-----------DETLDEAEAFAAEEAAADSSAEVDPDDFLAMRAAKLKEKPSRR
A7HAA8_ANADF      -----------------PGARPAAAPAAALAPVGERRGMRRAGRGNE-------------
Q1D4N8_MYXXD      AGQRAAGPGGFAARRHEPGARGKSAGWQERGPGRERRGASKHGGGFRQERAEWPGRRGRF
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ------------------------------------------------------------
RNR_VIBPA         ------------------------------------------------------------
RNR_ECOLI         ------------------------------------------------------------
RNR_SHIFL         ------------------------------------------------------------
RNR_HAEIN         ------------------------------------------------------------
E6WR29_PSEUU      ------------------------------------------------------------
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ----------------------------------------------------------RA
Q0BU01_GRABC      ----------------------------------------------------------KG
B0T0I6_CAUSK      ------------------------------------------------------------
C6XL74_HIRBI      ------------------------------------------------------------
Q2RPE7_RHORT      ------------------------------------------------------------
Q28VI9_JANSC      ------------------------------------------------------------
A8I2E1_AZOC5      ------------------------------------------------------------
E0THA1_PARBH      ------------------------------------------------------------
D5BRG4_PUNMI      ------------------------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      PASEAPEAVEDAAS-------------GEGTDEFYEPPERERLHPSQIPGAEITRTRRGE
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      -------EITGKLDLHPNGYGFLSHDG---------------EGRDIFIPKNKMNG----
E4TG32_CALNY      -------FLVGKVDMAADGYGFFIPDDP--------------KEKDIFIPKNKLNG----
RNR_AQUAE         -------VVTGTVIAYPGGFGFLEVEG----------------GKDIYIPPFEMVK----
B8DP48_DESVM      ------RLVTGTLSIQRSGMGFVLP-----EEKGR---------DDIYVHPYQMGD----
C6C1J0_DESAD      ------NLVTGKLQVQRSGAAFLLP-----DDKKR---------KDIYIHTKNLRD----
C7LXJ9_DESBD      ------PRMTGTLDVRRSGVGYLIA-----DDRKQ---------KDLFIHPNNFGG----
B8IYR8_DESDA      ------KSITGRFSALREGAGFVTPMRLAADDEQESPRWQFSGGKDIYIPSAQNGG----
Q1MQS9_LAWIP      ------QKVIGTFVVQRSGAAFVIVDQ---QNTQKPY-------SDIFIRPELQNG----
Q6ALZ0_DESPS      ------LFCTAILDANPRGFGFLHNMESNIEAQLPL--------QDPYVSQYNMSQ----
E6W3Z0_DESIS      ------LKGRVQVTQTPGTAFVTDETTSH----------------EYRLLSADADT----
C1F8V5_ACIC5      ------IPPNEIGTAMQGDQVLVEVFPKRP--------------GEDRMAGRIVRV----
RNR_MYCGE         LLDKKLQGILTLGNK---NSGFIRSLD--------------DDKTVYYVHYSNLTG----
RNR_MYCPN         VLDQKFQGILNLGNK---NTGFVRPLD--------------DDKTVYYIHFSNLAG----
RNR_UREPA         D-HEIKQGIITINSK---GDGFIKEDN--------------TEI-EYYVNKKYLNG----
Q7NB22_MYCGA      DLSKIMVGRLAIGTN---GNGFIKLEN--------------EELSKYYVHNTNLNN----
RNR_MYCPU         NEIKKIQGIFKQSNR---NFAFIETAD----------------EQSYFVAKAHFNG----
C5J794_MYCCR      VFLESKVGIYRSKQA---TFGFVEDKDNP------------QSENNIFVPAKFSAN----
A5IXZ7_MYCAP      RKINTIQGPIHFASEGKCAFVDVEELSKN------------GTKSSYFVSSNNFNT----
Q4A6A7_MYCS5      ELLRKQSGIIKVASKKQFAFLEFENEAQE--------------KESVFVKFQDLNS----
D1AQ67_SEBTE      EKEGYVRGDISITTG---KFGFLDLEG----------------ENSIFIPGPYLKG----
Q6F1Q7_MESFL      LGGSFKKGNLRMNPK---GFGFVNDVLQP------------E-EEAYFVPPVSLNG----
RNR2_LACLA        -------GVFSKHPK---GFGFVHPEDAT------------DKTNDIYIGKNDTKF----
RNR1_LACLA        EAKVVISGIFRANAA---GFGFVSIDAEE------------P---DVFVARGQTAF----
E6U4I2_ETHHY      REAEGKPATIMNMSK---RGGFAQLAD---------------QSTDVYIDKSRLMG----
E6UGT4_RUMA7      KGGKLKKCKVTRLHK---SFGFVKNVD---------------TGEEVFIPGKHLLG----
RNR_BACSU         -------KISAHAKG----FAFLLPEDTS--------------LSDVFIPPNELNT----
E6SKU1_THEM7      -------VLHGHPKG----YAFLIQPDG----------------EDVFIPAENLNG----
RNR_THEMA         -------TIEFTRSG----YVAFVITDD---------------FEEIAVPVEDTKY----
D7BIB2_MEISD      GNKGFVGRLQVHPAG----FGFVIPDALAPDQARLPP----PEQRDLYIPKEFLGG----
D7CS88_TRURR      ------GRLQVTAGG----YGFVILDS---------------EEKDLFIPAESLNG----
D2QSQ5_SPILD      VVDHVNSRFAFVIPD----TAAGTARDRD---------------DDIWVSTDDLAG----
B3ETS7_AMOA5      VVGKVD----YVNPG----YAYVVVGDGQ---------------QDVLVRQKDLLY----
C7PAC9_CHIPD      -------------------MSFVIIEGQE---------------KDVMVRQKNLNT----
D0J9E8_BLASP      -------------------YAFVNIKGFP---------------KDIFIPKKKTNR----
D5H9E3_SALRM      -------------------FGFVQATDQD---------------EEFFIREANMGE----
RNR_CHLMU         --------LFVHPKK---GFGFVSPDQPDL------------YPFDIFVPASDLKG----
RNR_CHLTR         --------LFVHSRK---GFGFVSPDQPEL------------YPFDIFISASDLKG----
RNR_CHLPN         --------LFVHARK---GFGFVSPDNPEE------------YPFDIFVPARDLRG----
D5SPD1_PLAL2      VAREHIIGTIKRAAR---GHAWFTPESLANQ----------PHIEPYTVAAEDAGS----
D2R7Z3_PIRSD      GKDKTVTGKFKRAAA---GFGFVRPLDVTSR----------GDRTQDIFIPQNASQ----
A7HAA8_ANADF      --------VVGTLKKHRDGYGFVARIDRK--------------GDDVFVPPGEAAQ----
Q1D4N8_MYXXD      SEVEEDGLLEGILHVHRDGFGFVHPLSGE--------------GDNVFLPPHEAQR----
RNR_BUCAI         ----SLKIVKGKVIGHRDGYGFLRTET---------------LKEDLWLSSEQMKS----
RNR_BUCAP         ----NLKIVTGKVIGHRDGYGFLRTET---------------FKDDLWLSIEQMKL----
RNR_VIBCH         ----KLEMVKGYVIGHKDGHGWVRPEGS------------LNKEGDILLPHHQMRT----
RNR_VIBPA         ----KLEMVKGYVIGHKDGHGWVRPEGS------------VGKDDDILLPHHQMKN----
RNR_ECOLI         ----RLDLVKGTVIGHRDGYGFLRVEG---------------RKDDLYLSSEQMKT----
RNR_SHIFL         ----RLDLVKGTVIGHRDGYGFLRVEG---------------RKDDLYLSSEQMKT----
RNR_HAEIN         ----KLDLFKGTVIGHREGFGFLQVDG---------------KKDDLFIPNHQMQR----
E6WR29_PSEUU      ----QTNLIPGVVIANPEGFGFLRPDS--------------GGGDDLFLPPYEMRK----
Q15PA3_PSEA6      ----PDSLVSGPISIHPEGFGFVTYSD---------------VERDLFLPKSQLNH----
A9GZQ2_GLUDA      SAAMPEAALVQVTGTDPDGDPIARPVVW---------DGD-GPAPVVFMHPEQKGR----
Q0BU01_GRABC      SSHLPEVAVILITGTDRDGDAVGRPAEW---------PREAGPPPSVLMHPEPRGR----
B0T0I6_CAUSK      AGALPPVGVADVVERDADGDLYVRLTK----------GGEDLPMVRLVPGKGDAAA---G
C6XL74_HIRBI      VDAPPPTSIIKFEKLDEHGDLVGRCVGR---------DGLYGPEITCVATGG-RKK---G
Q2RPE7_RHORT      PGSLPEVAVLIVARADAEGDLFCKPEHWP--------EDEEPPRILLWPEPHHARRPGVG
Q28VI9_JANSC      PDKLPPVTILSVQAPDDNGDLFARPLEW------------HGEGVEPRVLYTPRTA---D
A8I2E1_AZOC5      PGSLPSVVLVDVTGRDGDGELLAVPTEWD--------SEEHGDAPVILLHVPDKLR---G
E0THA1_PARBH      GGPLPPVVVLDVIDTDSDGDLICEVISA---------EAPAGTSVVLPSTQAGKVK----
D5BRG4_PUNMI      PDQLPEVTVLELVSFDDNGDGMARVAGEN--------SDDEADAPEIRVILSRKAG----
RNR_HELPY         -------FDIGKVEKVKDKAFFISLAKNYP--------------KDPLIKNLPPSF----
RNR_HELPJ         -------FDIGKIERVKNKAFFISLAKNYP--------------KDPLIKNLPPSF----
A9NF96_ACHLI      -------YALGKITIKRTIAFLMMPEGA----------------KDIAIDLFDLNG----
A9G9F9_SORC5      -VEARGAEREGTLTVHPRGFGFVALGGAA---------------DDVYISPEAMGG----
D0LU85_HALO1      TRPEEDLSRTGRITVHPAGYGFVELEDGT---------------GTVFVPARHRGA----
D5EIW1_CORAD      ----DADLVSGKILFRQSGSAILIADSDAGK----------KGAVGFPVSAEDTAT----
                                                                              

D4H3I7_DENA2      --AMHGDKVTISPETFRGK-------------------QEGRVVEIVERSEQKIVGRIEN
E4TG32_CALNY      --ASHKDKVKVVIEYFRGK-------------------KEARVVEILERGYSKIVGRVEK
RNR_AQUAE         --VFHGDVVKAKVTEFKGK-------------------KEVRIIKVLKRAKKDIVAKVVF
B8DP48_DESVM      --AWHGDKVVVALLPGRHG-----------------KNPEGRIVRVLERGRKEIPARVVR
C6C1J0_DESAD      --AWHGDRVTVAITGSHWGG----------------KREEGRVVRVLERGKQVFPVRVIR
C7LXJ9_DESBD      --AWPGDKVVAVVDSSRKK-----------------DSPEGRVVEVLDRATRELLVRVSR
B8IYR8_DESDA      --AWHQDLVRVALSPGAQRG----------------PSPEGRIVEIVERGLKEVPAHVVH
Q1MQS9_LAWIP      --AWDGDKVQVIVYPTKHG-----------------KNFEGQVVQILERPRKEVIVRVSQ
Q6ALZ0_DESPS      --ALHGDKVLAYIFRTTQN-----------------GRSEAEIFHVIKRGLNRIAGVIAI
E6W3Z0_DESIS      --LMSGDIITFRILPNGRAT----------------IKEIVQRAVERMAGVVVVEGKQTL
C1F8V5_ACIC5      --LTRRNPTVVGKFHYGNVG----------------GNAGGGRRGGRERGPQYPGHYVVP
RNR_MYCGE         --ALDGDLVEFCKLDKPQ----------------FGDKFDAAVITILKRARILYAGNFLV
RNR_MYCPN         --ALDGDLVEFCPLDKPQ----------------VGDKFDAAVLKIVKRSRVLYAGNFLI
RNR_UREPA         --ALKKDSVKFVKLKKEP----------------KNNLQDAAVIEIVGHAKDHYVGQFIT
Q7NB22_MYCGA      --ALNNDLVEFAPLTVQNDW-------------YKHDLTDACILKVLERARTRYVGTYED
RNR_MYCPU         --AINSFEVEAIVYESPFEK-------------D---KKYAVVKKILKNTHPEIIGFIKI
C5J794_MYCCR      --SLEGDEVRVNIYKDSLKP-------------E---QKYGVITKILHRNLKFLIGKIVE
A5IXZ7_MYCAP      --ALNNDIVEADVFEPISPD-------------N--NRTFAKVKKIIERRCKTLIGVLDN
Q4A6A7_MYCS5      --ALNNDEVIASIYKDHNEK-------------NPTRQLLAVVDEIVQRNNQKIIGFIKK
D1AQ67_SEBTE      --AMNGDTVLVRILKEAKSG-------------K---SREGEVYKIIERSKNVVIGVYQQ
Q6F1Q7_MESFL      --CFDSDEVIFKVVKDQE-------------------KTRAEIVELCLRVKEFLIGEIVR
RNR2_LACLA        --AMDGDKVTVKVTYPKTE--------------KRG--ASGQITKINERAVVDTVGTYRS
RNR1_LACLA        --ALDGDEVFIEIDKNANA--------------LKGTSAEGHVVEIIRHDVHQVVGTFVA
E6U4I2_ETHHY      --AMPTDEVEVRILRETDR------------------LPEGEVTRIVKRNFVKFTGTYYR
E6UGT4_RUMA7      --AMPGDIVMVQLRESRGD------------------SPEGEVVSIEEENFNRFSGEIVD
RNR_BACSU         --AMNGDIVMVRLNSQSS----------------GSR-QEGTVIRILERAIQRVVGTYTE
E6SKU1_THEM7      --AMHRDRVVVRLVGRAR----------------GGRKAEGEVIRILERANRELVGRLEW
RNR_THEMA         --AMHKDRVVVEITGTWR----------------GLP--RGRVVRVLERGLKRVVGVFDH
D7BIB2_MEISD      --AWHGDQVLAYPQPPGR----------------DRR-PWGKVAQVLERSRSKLTGRLEF
D7CS88_TRURR      --AWDGDRVLARLNPERE----------------NGR-LSGEVVRILERKHNRVVGTLEY
D2QSQ5_SPILD      --AVDGDRVRVVRFQDSRNGGR----------NAARRRIEGKVASVVERGRTELVGRIEV
B3ETS7_AMOA5      --ALDGDVVKVAITKQE---------------NGTKGHPVGRVVEILEQNKNKWVGTVQQ
C7PAC9_CHIPD      --ALDGDEVLVDVIKQG----------------KNEGRMEGVITEIIKRKKIEFTGSLQV
D0J9E8_BLASP      --AIEGDLVQVRFKNRK-----------------SGKKIEGEVIKILKRKRKNFIGILKM
D5H9E3_SALRM      --ALHGDLVRVAVAARAP----------------EDKKRECEVLEVVERRCTEVVGTFHH
RNR_CHLMU         --ALDGDHVLVALPFSQRGG----------------EKRKGVIHKVLSRGKTVLVGTIIS
RNR_CHLTR         --ALDGDHVLVALPFSLRGG----------------EKRKGVIHKVLSRGKTVLVGTIVS
RNR_CHLPN         --ALDGDHVIVSVLPYPRDG----------------QKLKGTISEVLARGKTTLVGTITS
D5SPD1_PLAL2      --ALTGDKVSAIILKKRGPN----------------GKIAVRVIDILERATTQFVGEYHE
D2R7Z3_PIRSD      --DAANGDIVRVRLVSGGRS----------------LRKSGEIVEILERDTHQFVGVYQE
A7HAA8_ANADF      --ALDGDLVRVEIVPARGGR------------------TAGRLVEVIERRRRLLIGTYHA
Q1D4N8_MYXXD      --ALDNDRVVVAVS-GRPPR------------------LEGRIVRVVQRRRELAVGTYVV
RNR_BUCAI         --CIHGDIILAHIVETH-----------------GKRRSSARFLKLLQPNNILIVGRYYI
RNR_BUCAP         --CIHGDVILAHIVKSD-----------------RKGRNSAKVLKILRPNDVLIVGRYCV
RNR_VIBCH         --LIHGDFVLVQPSGTD-----------------KRGRKEGRLVRILEERNGQIVGRFFF
RNR_VIBPA         --IIHGDFVLVQPTDNS-----------------KRGRREGRLVRVLEERNSQIVGRFFL
RNR_ECOLI         --CIHGDQVLAQPLGAD-----------------RKGRREARIVRVLVPKTSQIVGRYFT
RNR_SHIFL         --CIHGDQVLAQPLGAD-----------------RKGRREARIVRVLVPKTSQIVGRYFT
RNR_HAEIN         --VMHGDFVLAQPAGLD-----------------RRGRREVRIVRVLESRKKQIVGRFFL
E6WR29_PSEUU      --VMHGDRALANVTGID-----------------RRGRREGSIARVLERGVHRLVGRFGS
Q15PA3_PSEA6      --VFDGDVVQVLVEPGK-----------------NAKRAYSNLIKVQKRNTTHVVGMLQR
A9GZQ2_GLUDA      PALAPGERVVARLKRLG------------------PGRYEGRTLRRLT-DAPGRIVGVFR
Q0BU01_GRABC      PALAPGEKVLARLRPIG------------------HGRYEGRTIKRLGGDTPRPILGVYR
B0T0I6_CAUSK      GAPGMGDRLLVRFEQLE------------------SGETEARLIKRL-GQSAHKVLGVIR
C6XL74_HIRBI      ESLGIGDKALCKVGKAN------------------DSLWYAKVIKKIENTTTSTVIGLFE
Q2RPE7_RHORT      AEIGVGDRILARLTRIG------------------DARYDARTIRRL-AAAPSRLLGVLA
Q28VI9_JANSC      PAVGQGDRILAKLFAVEGSD-------------AEDHQYTAKLIRKI-GTNPRKILGIFR
A8I2E1_AZOC5      PAPGLSDRIVVRVEPND--P-------------APGIGYTGRVIKVL-EKARKQQLGVFR
E0THA1_PARBH      PPIGTGDRFLGRLTALE------------------DFHYHAAPIKRI-GRGATRTLGVYR
D5BRG4_PUNMI      RAPSVGQTILARLARVG------------------PNLYEARIIKVLERQQKRLFGEVIA
RNR_HELPY         ---KTDALILCQIECSKK-------------------RPIAFFKAALLNADHTMIAYLAK
RNR_HELPJ         ---KTDALILCQIECSKK-------------------RPIAFFKAALLNADHAMIAYLAK
A9NF96_ACHLI      --AMESDIVLADIVGYNP-----------------------YIKEIIHSNLTKLIADVKI
A9G9F9_SORC5      --ALHGDTVVVRISTRSRRG------------------VEGEIVRVVKRRHARVAGVLRR
D0LU85_HALO1      --ALDGDRVVLNTWSGYKG-------------------TEGRVIEVLSRGRAKLTGTLQR
D5EIW1_CORAD      --AFHGDQVLARILRRPKRNFRRGRGRYGRQEKEPEEKPNVRVIRIQKRARETVVGNLCK
                                                                              

D4H3I7_DENA2      LAGIMRVVPMTRKVNTYIYLTSN----------------KVQYKDDTVV-----------
E4TG32_CALNY      SRFFAYVVPFVKRFGFDIYIPKK---------------YSEELKDDDVV-----------
RNR_AQUAE         EDEQCYVVPLDENAHHRILLSKK---------------DCQKLKEGEVV-----------
B8DP48_DESVM      RMGRHSLLCRPADPRMAVSFVV-----------------DMSAVEEKAE-----------
C6C1J0_DESAD      PMGGTALLCHPTDPRLDFGIVVE---------------PDEAVVNEPVLDDNGREIYPAE
C7LXJ9_DESBD      RIHQDSYFCHPTDSRMPFYTVV-----------------DTSDVPNPEK-----------
B8IYR8_DESDA      R-HGNSLFCRPADSRLPADFNV-----------------ELPAGSEAPA-----------
Q1MQS9_LAWIP      KHEKGGVVCYPVDSKLNVLFIV-----------------DTSKLPEKPI-----------
Q6ALZ0_DESPS      DGSKGIVVPEDKRLPFVVQVTIP---------------EDMSVRHGDGV-----------
E6W3Z0_DESIS      LNPYRKGIPWIRLNRTSAAAVS--------------------------------------
C1F8V5_ACIC5      FDERMTQPVIIPLDEPLPEAVVA---------------SPHRVLGEEVRQ----------
RNR_MYCGE         DQ------NEFALEYKIVA-------------------DNPRFYLTMIVNPDSI------
RNR_MYCPN         EY------SDFGQEFRIVA-------------------DNPRFYLTPIVNKASV------
RNR_UREPA         LP------NGG---YYIFV-------------------DDP-LFYLNINLKD--------
Q7NB22_MYCGA      TG------DE----YLVLP-------------------DDPKLIYKVVLDRH--------
RNR_MYCPU         --------SNGIKYFNAF---------------------EESFRSYKFFVDQNI------
C5J794_MYCCR      --------NGTFLDFEPI---------------------NLNTKVLFRWQNPSM------
A5IXZ7_MYCAP      --------VNGFVTFKPI---------------------EPIYKNTSFRI-KNI------
Q4A6A7_MYCS5      --------DKNTIFFAPA---------------------DGCFDKVKFEL-LNL------
D1AQ67_SEBTE      --------NDNFGFVLPR---------------------EAMGRDIYVSKKKIR------
Q6F1Q7_MESFL      SF------DGKFLDFIPS---------------------DQAFTGFRIRILNKK------
RNR2_LACLA        LS------NRQVKALGYKGRIEL---------------YNDRISDTLYIKQPLS------
RNR1_LACLA        LN------DDEKEQTGLIGFVKS---------------RNKKIPYRVYLENEGL------
E6U4I2_ETHHY      EGGRGFVLPDFGF-------------------------------KERIEVLPDD------
E6UGT4_RUMA7      EFGKLKIMPDVIS-------------------------------KYALDFVNPF------
RNR_BACSU         TRN-----------FGFVI-------------------PDDKKITSDIFIPKNG------
E6SKU1_THEM7      QQGQAG--------YGFVT-------------------PVDQRVSWDVFIPQGQ------
RNR_THEMA         KGT-----------FGFVV-------------------PDDPKIAYDFYVAPEN------
D7BIB2_MEISD      RRG-----------YAWVL-------------------PDDPRLPGKVKLEPEG------
D7CS88_TRURR      ARG-----------YAILR-------------------PDSPRLRERILLLPES------
D2QSQ5_SPILD      WPT-----------YGFVV-------------------PDSKKIYDDIFIPKEK------
B3ETS7_AMOA5      QGS-----------VTFVL-------------------PISRRMHYDIFVRPEN------
C7PAC9_CHIPD      NKG-----------FAFLI-------------------PEKGLFMPDIYIPANS------
D0J9E8_BLASP      KSQ-----------YGLVI-------------------VHNNTIHVDILIPINE------
D5H9E3_SALRM      RSD-----------FAFVE-------------------PDDQRILQDVYVAPDA------
RNR_CHLMU         LISPTLA-------MVCVN---------------------AISPEVPLKAELLP------
RNR_CHLTR         LINPTLA-------MVYVN---------------------TIGPEHPLKAELLP------
RNR_CHLPN         LVSPTSA-------LAYTS---------------------MSGSQSLIPVELLP------
D5SPD1_PLAL2      --SRGKG-------YVTVD---------------------NSRFERPIDVGDPG------
D2R7Z3_PIRSD      --QRGSG-------VVEVD---------------------GRVFAVPISVGDPG------
A7HAA8_ANADF      RGA-----------RSFVVPADE---------------ELGEAVPVPETAAAQD------
Q1D4N8_MYXXD      KGR-----------YAVVYPTDS---------------SLPGPIRVPLTQMARE------
RNR_BUCAI         DD-----------------------------KIKFVIPDDT-RFNFKIFIFSAIK-----
RNR_BUCAP         DN-----------------------------KKKFVIPNDT-RFNFKIFILDSLISN---
RNR_VIBCH         EY-----------------------------GYSYVVPDDS-RIHHDILIPNDLR-----
RNR_VIBPA         EY-----------------------------GYSYVVPDDS-RISQDILIPNEHK-----
RNR_ECOLI         EA-----------------------------GVGFVVPDDS-RLSFDILIPPDQI-----
RNR_SHIFL         EA-----------------------------GVGFVVPDDS-RLSFDILIPPDQI-----
RNR_HAEIN         EN-----------------------------GFGYVVPDDS-RIGRDILVPNEHR-----
E6WR29_PSEUU      EA-----------------------------GISFVIPDDR-RMQRNLHIPPDAT-----
Q15PA3_PSEA6      KG-----------------------------KHYFLLPDDV-KVSHTIHVEHSAL-----
A9GZQ2_GLUDA      ---PTTLYDGPGPLAPPRRHAEA----------GRLVPADR-RAKAEWIIPAGET-----
Q0BU01_GRABC      LSEPVTLVPRSTRTSHAARQMLARQNASTAQPEGRVVPTDR-RSKAEWLVPAGEE-----
B0T0I6_CAUSK      KV----RRET------------------------RVEPVDR-KSKESLLLNEQEA-----
C6XL74_HIRBI      AN----KHGG------------------------RVKPTSR-KDKNEYLVEKILS-----
Q2RPE7_RHORT      LA----RDGL------------------------RLRPTNR-RDRDEYLVAPEDA-----
Q28VI9_JANSC      KG----AEGG------------------------VITPISK-GSDKEWQVRAGDT-----
A8I2E1_AZOC5      KAPPGSSGGG------------------------RIIPIDKKNLGRELQVPPGAE-----
E0THA1_PARBH      PH----RRGG------------------------HVDPVSR--KAQSLDIDSRDA-----
D5BRG4_PUNMI      SN------KG-----------------------FKLMPAER-GKRDAINLQTSSS-----
RNR_HELPY         KN--------------------------------------NQIVAIPFKEPFKKP-----
RNR_HELPJ         EK--------------------------------------NQIVAIPFKEPFKKP-----
A9NF96_ACHLI      RSD------------------------------------KKMRFDANEAQNKLII-----
A9G9F9_SORC5      RGRS------------------------------AWLEPDDGRVRGPIVIVPREP-----
D0LU85_HALO1      TGRAVYLE------------------------------PDDPRIATDYGHVPLIDG----
D5EIW1_CORAD      GRHTWYVIP------------------------------DDPRIIQDFIVPDPANCGIK-
                                                                              

D4H3I7_DENA2      ----------------LVELTHFPSEGSAAR---GQVNKVLGMLSDPRIEDEIVLNRYDI
E4TG32_CALNY      ----------------ICEITKYPEKSKNPE---GKIIKILGNLNDKGIENEIVIEKYEI
RNR_AQUAE         ----------------VLKITQFPTKKSPAR---GKVIEVLGNPKEKFIAIDVIIRKYNL
B8DP48_DESVM      ------------KGDLVVAAPGEKVEDGLWA---ATGLAVLGADDNVLVQERLVKINHDV
C6C1J0_DESAD      SVDAEVDFTRVSRGDILLVAPGEQINPSLWE---GRILKMLGDEDDAIVQEAIVKANHGI
C7LXJ9_DESBD      -------------GDILSVAPVEEQEKGIWR---CTALRRLGEERDLATQELLVKTGYSI
B8IYR8_DESDA      ------------QGTLVLLAPLKPLASDLWS---ATLLGNYGREDDVAVQEELVKLNHEV
Q1MQS9_LAWIP      ------------ENELLVIIPTPNTNGELLM---GIAQYSLGVEEDVRVQEKVVKLNYNI
Q6ALZ0_DESPS      ----------------IVTLKQTATPDKVRQ---GMLLESFGSPDSVKSQIRFVVEKSVL
E6W3Z0_DESIS      -----------EGQGVVVRITSYPGRNTLPE---GEVVEVVGDASDAMVERTLVLEAYGL
C1F8V5_ACIC5      ------QFDDLEGLVVDVEITEWPTPTRPAR---GRVIEVLGEEDAFGVDVEMMIRKHHL
RNR_MYCGE         ------PNNLASNTKIAFQIDEYDPDNNLCK---VSVQQVLGNNDDPLINIKAIMLDNSI
RNR_MYCPN         ------PAELESNTKVAFQIDEYDPANNLCK---VSIQQILGNNDEPLINLKAIMLDHSI
RNR_UREPA         ------TTGLVNGHKILFKIISQ--TTKDAI---AELVHIIGHKNDVGSDVLSIVYDNGI
Q7NB22_MYCGA      ------YLELKEHDRILFEIIEI--KQGVIR---AALVKKIGSKEDLGIDIDAIAYNHLI
RNR_MYCPU         ------DVEED--DVILVVVEKI--VDQKIY---VNFVKKVSTLKSNFYQIDIVLEKSKT
C5J794_MYCCR      ------TSSLKSGDFVKVKIVDY--QKRILK---ISLIQKIGHESEHFLNVKIPIIDSGV
A5IXZ7_MYCAP      ------ASEARVLDVVVAEIINY--ENRNKE---INIIKRITDVNDPMAYVKSLEEARNV
Q4A6A7_MYCS5      ------SSKVKINDCVLCEIKKY--DKNLVS---LEIKKVITNTSDPNVFVKAYLESTNI
D1AQ67_SEBTE      ------GAKNGDLVAVKIYFWGD--EDRKPE---GEIISILGDPHNTEALINAILINNGV
Q6F1Q7_MESFL      ------EFPIQEYQIVKAKIISV--KERLLF---VRLKKVIGDARKASDRILSIAEEFEI
RNR2_LACLA        ------GVQEEDVVSLKITQYPTN--TKTFE---GKITGIIGHKGEVGLDILEVLCAMKI
RNR1_LACLA        ------IPENKAIVRVEITHYPDKEFPQTMQ---GLVTEIIGQADDQGIDVLEVLASMDI
E6U4I2_ETHHY      ------VKTLGEHEKVMAEMLRYPTAADNGQ---VHVVMSYGSADSGAACCQAVLDRKHA
E6UGT4_RUMA7      ------GLELHEGDKAIAVITRRGEKHSEHR---CEIVSCLGSSLKAAVCALGIVEAAGL
RNR_BACSU         ------KNGAAEGHKVVVKLTSYPEGRMN---AEGEVETILGHKNDPGIDILSVIHKHGL
E6SKU1_THEM7      ------LGGARAGDMVVVEITRWPEKRRG---PEGRVVRVLGPADAPGVDVAAIVAKAGL
RNR_THEMA         ------IDGAKPNQKVIAEILKYPSPGKN---PEAKVVKVLGDLDDPSIDLPSVIVKHDL
D7BIB2_MEISD      ------LAGLEQGARIAVELHFPQTGDKGG-EIYATFLEYLGMADDPQSETRAVIVNHDL
D7CS88_TRURR      ------VGQVEAGTRIVAKIVWPEVSGEK--DPFGEVEEVLGAGDDAEVETRAVIVKFDL
D2QSQ5_SPILD      ------LGGANDGEKVIVRLTKFPDPNSSKQRFEGEVITVLGVAGQNNTEMHAILAEFGL
B3ETS7_AMOA5      ------LKKAKHNDRVVVELVKRPTTSKNP---EGRIIEVFGPMGENDVEIHTIMAEFNL
C7PAC9_CHIPD      ------LKDAKNGDKAVVRVVAWGEKTRKP---VGEVVEVLDASNTNDLAMKEILIESGF
D0J9E8_BLASP      ------FKGYQHNEKVLVEIVKWPKNSKNP---LGKIIKGFGVSGEYKTEIFSLLSEYGI
D5H9E3_SALRM      ------FSGAKDGEKVMVSIDRFDDRKASP---EGRILRVIGPSDDPNVRVLSLAMSMDV
RNR_CHLMU         ------KRTYKIGDRLLLKTPGWKENYPSKEPPPLAMLEFMGNISNAKTDFPVIKAEFSI
RNR_CHLTR         ------KRTYKLGDRLLLKTPVWKENYPSREPPPLAMLEFIGNISNAKTDFPVIKAEFSI
RNR_CHLPN         ------GRTYKIGDRILLSTPPWVDKPQEGASPALQMLEFIGHITNAKADFQAIQAEYNL
D5SPD1_PLAL2      ------AKGVRPGDQVVIEMVHFPEFSTPGEA---VLLKVLGKRGEPGVDLQSIIYEFGL
D2R7Z3_PIRSD      ------AKGAAPGDKVVIEMVRFPSHTHEGEA---VITEVLGARGTPGIDTLSIMREYEL
A7HAA8_ANADF      ------------GDVVKVALEPGTARL------QGAVVEAIGRPGEPRVEVLKVAYAKGF
Q1D4N8_MYXXD      ------------GDLVKVQLGIGAQMLDPDRGLHGEVAGSLGKPGTPSAEVLGVAYSQGF
RNR_BUCAI         -------DDISIGSIVSVKLKQHPIRNSRVQ---GFIVEILGKEMGTNLAIEIALRTHLI
RNR_BUCAP         -------ENISIGTIVVVKLRENATKKSKIQ---GTIVEVLGKEMGTNLAIKIALRTHCI
RNR_VIBCH         -------AGARMGNVVVIEITDRGTRNRGMM---GKVVEVLGENMAPGMETQIAIRTHQI
RNR_VIBPA         -------AGARMGNVVVIEITDRGSRSRGMM---GKVVEVLGENMAPGMETQIAIRTHQI
RNR_ECOLI         -------MGARMGFVVVVELTQRPTRRTKAV---GKIVEVLGDNMGTGMAVDIALRTHEI
RNR_SHIFL         -------MGARMGFVVVVELTQRPTRRTKAV---GKIVEVLGDNMGTGMAVDIALRTHEI
RNR_HAEIN         -------NGARMGQVVVVELQERSASFNQPI---GVITEILGDNMAKGMEVEIALRNHDI
E6WR29_PSEUU      -------CGAREGQLVVCEIVAPPDTRRPPI---GKVVAVLGDSLTPSLVVETAIHSHNL
Q15PA3_PSEA6      -------NQARVGQYVSGKITHYPDFRQETH---VEITEVLGNATDAGIESTLALYRHGI
A9GZQ2_GLUDA      -------MGAEAEEVVVAEPLPLA-GSGLKP---ARIVARLGPMGDARSVSLLAIHTHSI
Q0BU01_GRABC      -------GGAEPGDIVRAMPLPHT-GYGLKP---ARIIEKLGKIGDARSVSLICIETHDI
B0T0I6_CAUSK      -------KDLKDGDLVLAQVGTSSGRYGPKF---GKVLEVVGNEDDPRAASLIAIHSHGI
C6XL74_HIRBI      -------KDAETGDIVRISLKKSK-PYGPQM---AEVVEIVGRMENPKSASLIALHTHDV
Q2RPE7_RHORT      -------GGAEPGELVEAELLPSR-RLGLRR---AKVIERLGGREGPRSISLVVVHSHDI
Q28VI9_JANSC      -------HGAKDGELVEGELAGPKARMGAPR---ARITTRVGDPGAARAVSLIAIHEHGI
A8I2E1_AZOC5      -------NGAEDGDLVSVEMMHQRV-FGQPT---ARVKERLGSLATEKAISLVAIHAHGI
E0THA1_PARBH      -------NNAEEGDLVWAEPLNAR-GYGPRK---GRIVSIEGHVDDRTNWSLIALAEQDI
D5BRG4_PUNMI      -------APCVAGDLVEAELLPSK-GYLAKT---ARIIRNLGSSSNTGAFSALAIAEFNI
RNR_HELPY         -------VSLKHSQKSLLELPRHCVVKIDTK--KREISEILGALEDPLIDENLSLSLFDR
RNR_HELPJ         -------ISLKHSQRSLLELPRHCVVKIDLK--KREISEILGALEDPLIDENLSLSLFDR
A9NF96_ACHLI      -------VKDVPDYLVDGHVVLLDVTEVTRTQIFTKFREVIGHKNDPDMEIVKIVYEYEW
A9G9F9_SORC5      -GAPLVPPDAEDGAAAVVSIARFPDLAEENP--EGVLEAVLGTPGDPNVEVAKILVREGI
D0LU85_HALO1      ------PPQSKVGQAAVVEICRYPTHERPEL--VGRLVRVLGKPDDPRTEIEKILAFADL
D5EIW1_CORAD      -------PRPKEGDKVVVKILEWQQRHLNPE---GEIIQLLGKTHEPDAEFKGILFKYEL
                                                                              

D4H3I7_DENA2      D--KVYPESIEKYVEKTSPELMKNP------------------GAR-TDLRSLPTVTIDG
E4TG32_CALNY      R--REFPKSVRKNLARDSFELFKNP------------------GKR-TDFRDLFTVTIDG
RNR_AQUAE         P--TSYPEKVIKEVEAIPEEIPEEE------------------IKRRRDLREQLCFTIDP
B8DP48_DESVM      P--GDFPPEVLEEARDLPAVPGRDD------------------MEGRIDLRHLEFVTIDG
C6C1J0_DESAD      P--TAFPGKVLAVADALPDEPVEED------------------FADREDMRDIPFVTIDG
C7LXJ9_DESBD      P--EVFPVPALRQAEALPDTPSPQD------------------WAERNDLRKLALVTIDG
B8IYR8_DESDA      P--RDFPAGALAEAEAL---PGEAD------------------FKGRRDVRDLALVTIDG
Q1MQS9_LAWIP      P--CEFPLHVLKEENVAKDLFIKSKAVFYNVPYQKYDDISQCSTAIRQDLRVIDFVTIDG
Q6ALZ0_DESPS      P--DKFSGETYAELEQMGGEDHDPK---------------------RVDLRDIKFVTIDG
E6W3Z0_DESIS      Q--LHFPPEVEREAQAVSRVV-KTSTS-------------------RADYRKLLTCTIDG
C1F8V5_ACIC5      P--HVFPENVLAEAREVAHLDGEVVAA-------------------RRDFRDLPIVTIDG
RNR_MYCGE         V--FETNDVVEQHANKLSFD----TE--------------EQHKAYRQDLTDLAFVTVDP
RNR_MYCPN         V--FEDNDVVEQQAAKLQFD----EK--------------EQSKPYRKDLTELAFVTIDP
RNR_UREPA         D--PTFDPQVVDLASKLEFY----VD--------------EHQNKIRRSIIDREIISIDP
Q7NB22_MYCGA      E--PTFSQEIINEAKSLKYE----LD--------------DHQKEIRKDLRDLSFLTIDP
RNR_MYCPU         I--IDFPEDVLDESALIEDH----VI--------------EKDYQNRKDLRDKLIITIDG
C5J794_MYCCR      S--TIFNEEVIQESKQIPQE----IK--------------SIDP-DRIDLRNEVVITIDG
A5IXZ7_MYCAP      P--REFPAEVNEYIQKFIPE---NIK--------------NEDLSMRTDLRNDLVVTIDG
Q4A6A7_MYCS5      D--LEFSAETLAESKLIPQEV--DLN--------------IKEKFQRKNLTSELIVTIDG
D1AQ67_SEBTE      S--EEFSEEIEEELARVT-----KVE--------------ASDLKGRKDLRDFDIITIDG
Q6F1Q7_MESFL      R--TEFEKATLKEAERVNVPVEHEVD--------------EINRRMKNSLLDKMVVTIDG
RNR2_LACLA        P--QEFSSETLAEAEAFSEK----LT--------------DSDLQDREDYRNEITYTIDG
RNR1_LACLA        V--SEFPKEVLDQAEAVPEE----VP--------------ENEIVGRVDYRNEITFTIDG
E6U4I2_ETHHY      R--QVFPDEVLAEANAIPQT---------------------FDPAGRFDLRDRIILTIDS
E6UGT4_RUMA7      T--PVFPAEVIDEARRVSSAG---IS--------------DEEKEGRLDLRDLPIFTIDG
RNR_BACSU         P--GEFPADAMEQASSTPDTID------------------EKDLKDRRDLRDQVIVTIDG
E6SKU1_THEM7      R--VEFPAAAMAQAEQVPERVT------------------ARDRRGRRDLRDWLIVTIDG
RNR_THEMA         PEPGEFPEEVIREANAIPARVR------------------KKDLVGRKDLRDKVIVTIDG
D7BIB2_MEISD      K--SEFDPEALAEAEAIPESIP------------------PEEIARRADFRSLNVFTIDG
D7CS88_TRURR      K--DAFDPDTLAEARAVPSTVS------------------EEMMRGRLDLREVNTFTIDG
D2QSQ5_SPILD      P--IHFPADVEKEAEAIPTKIL------------------KKDLAKRRDMRDVTTFTIDP
B3ETS7_AMOA5      P--TQFPENVLAETSAISIDIP------------------KEEIAARKDFREVFTITIDP
C7PAC9_CHIPD      P--LSFPDEVLKELNEIQENID------------------AEEVKKRKDFRKTLTFTIDP
D0J9E8_BLASP      S--YEFPKEVEKEAKEIVLKK-------------------NSDLNMRRDMRNINTFTIDP
D5H9E3_SALRM      K--ADFPDEVEAEAESIPVKIP------------------EDEIERRRDLRDKPVFTIDP
RNR_CHLMU         T--EEFPEAVVQEASQFLQKHV------------------TQALHSRKDLRDLLCFTIDS
RNR_CHLTR         T--EEFPDAVVQEASQFLQKHV------------------TQALHSRKDLRDLLCFTIDS
RNR_CHLPN         A--EEFPPEVIEEASLFSQKHI------------------TQVLHSRKDLRDLLCFTIDS
D5SPD1_PLAL2      P--DEFPESVLEESRLQAQLFS------------------EDDIGDRLDLRDELIITIDP
D2R7Z3_PIRSD      P--EAFPEAVLAASREEAEKFD------------------ES-IGDRRDFTKTTIITIDP
A7HAA8_ANADF      A--DVFPEPVRAEAEATPDRVR----------------PEDRQG--RRDLTALPLVTIDG
Q1D4N8_MYXXD      S--DEFPPEVMAEADRYAVTVT----------------EEEVRGEHRRDLRAIPLITIDG
RNR_BUCAI         P--SLWSKEVKKQVYEISRKIN------------------QYDFKNRTDLRHFPFFTIDD
RNR_BUCAP         P--YLWSKEVEYQLCGIKSKIN------------------EKDFKNRIDLRHLPFFTIDE
RNR_VIBCH         P--HEWPAEVEQQVAGLTEEVP------------------EEAKQGRVDLRALPLVTIDG
RNR_VIBPA         P--YEWPEAVEKQIVNLGEEVP------------------EEAKVGRVDLRELPLVTIDG
RNR_ECOLI         P--YIWPQAVEQQVAGLKEEVP------------------EEAKAGRVDLRDLPLVTIDG
RNR_SHIFL         P--YIWPQAVEQQVAGLKEEVP------------------EEAKAGRVDLRDLPLVTIDG
RNR_HAEIN         L--HKFPSAVEKYVKKFTEEVS------------------EEAKKGRVDLRNLPLVTIDG
E6WR29_PSEUU      P--HEFPPEVLDEATAVPLTVE------------------PSMIGDRVDLRELPLVTIDG
Q15PA3_PSEA6      S--DQWDKTLLDKANTHGTRVS------------------QADKAQRTDYRSLPFVTIDG
A9GZQ2_GLUDA      P--DQFPAEALSEAERAR----------------------GVSPEGREDLRDVPLITIDG
Q0BU01_GRABC      P--QIFPDEALSEARKAR----------------------AVPLEKREDLRDIPLITIDG
B0T0I6_CAUSK      P--TGFSEDAEAEAHAAK----------------------PPTLEGRDDLRDLPFVTIDP
C6XL74_HIRBI      P--DEFPVEIIAEAENAT----------------------AQKT-AREDLTDIPLITIDP
Q2RPE7_RHORT      P--VDFPPEALAEAEAAV----------------------GVDLRGREDLRAVPLVTIDG
Q28VI9_JANSC      P--DSFPNKVVAEADAAK----------------------PAGLTGREDLRDLPLITIDP
A8I2E1_AZOC5      P--NAFPAKVIAEAEAAR----------------------PATAKGREDWRKLPLVTIDP
E0THA1_PARBH      P--IHFPPEVVEAAEALTL---------------------PSDLSPYEDLRALPLITIDP
D5BRG4_PUNMI      R--HHFPDAVISEANALK----------------------TPPAKGRLDLRDTALVTIDG
RNR_HELPY         V--KDFSKDCLNLAQHYAQLKA-------------------SDFKDRINYSHIPFITIDP
RNR_HELPJ         I--KDFSKDCLDLAQYYAQLKA-------------------SDFKDRINYSHIPFITIDP
A9NF96_ACHLI      P--LKFSKEVLNELHHIKIDHE-------------------YERKTRRDITDKLVVTIDG
A9G9F9_SORC5      E--EEHAPEAIAEAEAFGGEVP------------------AEALEGRTDLTHLPMPTIDP
D0LU85_HALO1      P--TEFPRDVARRGDETSTTVR------------------TRDQVDRVDLRDRPFVTIDP
D5EIW1_CORAD      D--PQFPAEVEQQTKDIPDEVQ------------------PEDRAGRMDCRDLFTFTIDP
                                                                  .       ::* 

D4H3I7_DENA2      ETAKDFDDAISIEKT--ENE---FILYVHIADVCHFVQPGT-----PVDNEAYRRGTSFY
E4TG32_CALNY      ETARDFDDAISIQRL--ENG---YKLFVHIADVSHFVRPDS-----RLDKEAYRRGTSIY
RNR_AQUAE         EKAGDFDDAVAIELTP-EGY---YKLYVHIADVSYYVREGT-----ETDKEAYKRGFTYY
B8DP48_DESVM      AKARDFDDAVYVEEQ--GTG---YRLWVAIADVAHYVRPGS-----AMDREAQARSNSYY
C6C1J0_DESAD      ATAKDFDDAVFVEKI--AGG---YRLRVAIADVSHYVAMES-----PLDREALKRGNSYY
C7LXJ9_DESBD      ETAKDFDDAVYVERQ--ENG---YRLVVAIADVAHYVPEGS-----PLDVEALARGNSYY
B8IYR8_DESDA      ADARDFDDAVHVEEQPGGKG---WVLRVAIADVSHYVRPRGRGCPGALDAEALSRGNSWY
Q1MQS9_LAWIP      EDAKDFDDAICVYPT--DIG---WDLWVAIADVSHFVRAGS-----LLDSEALARGNSYY
Q6ALZ0_DESPS      DTAKDFDDAVCVEKR--GVN---FRLYVAIADVSHFVKVGS-----ALDRDAYERGTSVY
E6W3Z0_DESIS      ATARDFDDAISIETE--QGN---FRLYVHIADVSHYVTEGS-----ALDLEAQNRATSVY
C1F8V5_ACIC5      ETARDFDDAVLVREHG-DGT---WELQVHIADVAQYVTPES-----ALDLEARLRGTSVY
RNR_MYCGE         TTSKDLDDAIYVKTI-PTG----FVLYVAIADVAHYVNRNS-----EIDIEAKHKTSSIY
RNR_MYCPN         ATSKDLDDAIYVKRT-DKG----FVLYVAIADVAYYVQRNS-----ELDIEARHKTSSIY
RNR_UREPA         VGSKDIDDAVYVKKLNDQR----YFLGISIADVSFYVQPNT-----ILDADAFKRGTSTY
Q7NB22_MYCGA      ASALDLDDAIYVKKIDDDS----YNLKVAIADVCHYVKFDG-----PMDRGARTKATSVY
RNR_MYCPU         EDTKDFDDAIYVEKNKD-H----FLLSVHIADVAHYVKENS-----AIDKEALRRATSIY
C5J794_MYCCR      DDTKDFDDAISIETKEN-N----YILKVHIADVSYYVTEDS-----ALDLEAKARGTSIY
A5IXZ7_MYCAP      SSTKDFDDAISVVKIDENT----YELGVHIADVAYYVKENT-----PLDDEALKRGTSIY
Q4A6A7_MYCS5      ESTKDFDDAINVKKLENGN----FLLSVHIADVAHYVKEKT-----NLDSEALKRGTSIY
D1AQ67_SEBTE      SDAKDLDDAVYVKKSSEG-----FKLIVSIADVSHYVKEKT-----KLDEEALKRGNSIY
Q6F1Q7_MESFL      IDSKDLDDAICVEKLENGE----FKLYVAIADVSHYVEPKT-----PLDKEALIRGNSTY
RNR2_LACLA        DDSKDLDDAIHVKKLSNWH----FELGVHIADVSHYVTEGS-----SLDEEAYSRATSVY
RNR1_LACLA        ADAKDLDDAVHAKRLENGN----YELGVHIADVSHYVTENS-----PLDKEAYERGTSVY
E6U4I2_ETHHY      AHSKDLDDAISIEKT-DGG----YRLGVHIADVSHYVRPGT-----ALNEEAFERGTSIY
E6UGT4_RUMA7      ADTKDIDDAISVQRT-DNG----YILGVHIADVSHYVTPRS-----PLDNEAFQRGTSVY
RNR_BACSU         ADAKDLDDAVTVTKLDDGS----YKLGVHIADVSHYVTENS-----PIDKEALERGTSVY
E6SKU1_THEM7      ADAKDLDDAVSLQRLPEGGEA-VWRLGVHIADVSHYVPEGS-----PLDLEARRRATSVY
RNR_THEMA         EDAKDFDDAISVEKLPNGN----YLLGVHIADVSHYVKEGS-----ALDQEAFKRGTSVY
D7BIB2_MEISD      IDAKDFDDAIHVERLEGNR----YRIGVHIADVSHYVREGS-----ALDKEAYERGTSVY
D7CS88_TRURR      ADAKDFDDAISLERLGKGKNA-LLRVGVHIADVSYYVAEGT-----SLDQEAKARATSVY
D2QSQ5_SPILD      IDAKDFDDALSVQILDNGN----FEIGIHIADVTHYVLPGS-----KLEEEAFKRATSVY
B3ETS7_AMOA5      EDAKDFDDALSLKILPNGH----IEVGVHIADVSYYVQENS-----LVDQEAFERGTSVY
C7PAC9_CHIPD      VDAKDFDDAISIRKLRGNW----YEVGVHIADVSHYVQPDT-----ALDKEADKRATSVY
D0J9E8_BLASP      LDAKDIDDALSIRKLNSNT----WEIGIHIADVSHYVKEGS-----FLDKEAYTRANSIY
D5H9E3_SALRM      VDAKDFDDAIHVEELDNGN----YEVGVHIADVSHYVEPDT-----AIDAEALERGTSVY
RNR_CHLMU         ASAKDFDDAVSLTYDHEGN----YILGVHIADVSHYVTPNS-----ALDQEAAKRCNSIY
RNR_CHLTR         SSAKDFDDAVSLTYDHEGN----YILGVHIADVSHYVTPNS-----ALDREAAKRCNSIY
RNR_CHLPN         STARDFDDAISLTYDHNNN----YILGVHIADVSHYVTPHS-----HLDKEAAKRCNSTY
D5SPD1_PLAL2      LTARDFDDAISLKRHEDGS----WTLGVHIADVAHFVRPGT-----ELDKEAIRRGNSVY
D2R7Z3_PIRSD      VDARDFDDAISLTKLESGN----YQLGVHIADVSHFVKPKS-----VLDREARDRATSVY
A7HAA8_ANADF      EDARDFDDAVHVERLEGRKG--LYRLVVAIADVAHYVRPGA-----ALDAEAGRRGTSVY
Q1D4N8_MYXXD      EDARDFDDAVCVEDRADG-----WRLVVAIADVTHYVWEGS-----ALNAEALRRATSVY
RNR_BUCAI         EDARDFDDAVFCKRKANPE--EGWILWVAIADVSCYVQPNT-----PLDKAALERGTSVY
RNR_BUCAP         EDARDFDDAIFCKKKTNGE--KGWKLWVAISDVSYYIQPDT-----ALDKAASKRGTSIY
RNR_VIBCH         EDARDFDDAVYCEAKKGG----GWRLWVAIADVSYYVRPDT-----ALDKEAINRGNSVY
RNR_VIBPA         EDARDFDDAVFCEKKKDG----GWRLWVAIADVSYYVRPDS-----ALDKEAINRGNSVY
RNR_ECOLI         EDARDFDDAVYCEKKRGG----GWRLWVAIADVSYYVRPST-----PLDREARNRGTSVY
RNR_SHIFL         EDARDFDDAVYCEKKRGG----GWRLWVAIADVSYYVRPPT-----PLDREARNRGTSVY
RNR_HAEIN         EDARDFDDAVYCEK-HGK----GWKLWVAIADVSYYVRLRS-----TLDVEAHNRGNSVY
E6WR29_PSEUU      EDAKDFDDAVYCEPNRQG-----FRLVVAIADVSHYVRPGT-----PLDDEAQKRATSVY
Q15PA3_PSEA6      ADAKDFDDAVYCEKTQAG----NWRLLVAIADVSHYVLPND-----ALDIEAQARATSIY
A9GZQ2_GLUDA      EDARDFDDAVYAEPD-----GDGFRLIVAIADVAHYVRPGS-----ALDREARRRGNSVY
Q0BU01_GRABC      EDARDFDDAVFAERAE----NDGFRLIVAIADVAHYVRPGS-----ALDREAFKRGNSCY
B0T0I6_CAUSK      VDARDHDDAVYAHPDPDAGNVGGWIVWVAIADVAAYVRPGS-----ALDRDAREKGNSVY
C6XL74_HIRBI      ADARDHDDAVFARPDEDEGNNGGWIVYVAIADVAAYVQHGT-----ALDDEAYKRGNSTY
Q2RPE7_RHORT      EDARDFDDAVFAEPDDDPANPGGWRALVAIADVAHYVRIGA-----ALDKAARERGNSVY
Q28VI9_JANSC      ADARDHDDACYAHADEDPGNKGGHVIWVAIADVAHYVTPDS-----ALDREARKRGNSTY
A8I2E1_AZOC5      PDAKDHDDAVHAVPDDDPDNAGGFIVTVAIADVAAYVRPGS-----ALDREALLRGNSVY
E0THA1_PARBH      KEAKDHDDAVFAEPID-----EGFRIVVAIADVAQYVRPGS-----PLDQEAKRRGNSVY
D5BRG4_PUNMI      ADAKDFDDAVFAEPTD----TGGWRLLIAIADVSHYVRQGS-----ALDKEARTRGNSVY
RNR_HELPY         KDAKDFDDAIFYDQEK-------RVLFVAVADVSEFVPKHS-----SLDKEARVRGFSVY
RNR_HELPJ         KDAKDFDDAIFYDKEK-------NTLFVAVADVSEFVPKHS-----SLDKEARIRGFSVY
A9NF96_ACHLI      ADAKDLDDAISLEYLENGN----FKLGVHIADVSYFVKEGS-----YLNEAAYNRATSVY
A9G9F9_SORC5      EDARDHDDAVWVIREEDGS----YRAWIAIADVSHYVRPGS-----ALDQAALARGNSVY
D0LU85_HALO1      VTARDFDDAVCIEDGPHGGP----RVWVAVADVSHYVEIDD-----PIDREAAVRGVSVY
D5EIW1_CORAD      DDAKDFDDALSVEELEDDM----LRVGIHIADVSGYVKPNT-----PLDKEAQKRGNSTY
                    : * ***                  : ::**  ::           :  *  :  : *

D4H3I7_DENA2      FPEF-AVPMLPESLSNGLCSLRPNEDRLALTAKITYTKDGQRKKAYFYRSIINSDRRLTY
E4TG32_CALNY      FPEF-AIPMLPEELSNDLCSLRPGEERLTITVEIDYDEKGNRIDSNFYQSVIKSDYRLTY
RNR_AQUAE         FPDR-ALHMLPEKLSAKLCSLRPNEDKLAFTVEMVFDESGNLKAYDIYESVIRSKARLTY
B8DP48_DESVM      FPQS-VEPMLPEALSNGLCSLNPRVPRLAMVAETFFYADGTPGRSKFYAAIIESKARLTY
C6C1J0_DESAD      FPKS-VEPMFPEALSNGLCSLNPDVNRLAMTATIEFDKSGAPVNSSFAPAVIRSQGRLTY
C7LXJ9_DESBD      FPLS-VEPMFPEALSNGLCSLRPKVARLAMVVDTPYSMDGEPGAPRLYNAVIMSQARLTY
B8IYR8_DESDA      FPRS-VEPMLPEVLSNGLCSLRPHVNRLAVLAEIPFTAAGKPGKPRFSEVVMRSAARLTY
Q1MQS9_LAWIP      FPCS-VESMLPEFLSNDFCSLKPKEERLVMATKISFDNDGKTKNVIFFPGVISSRARLTY
Q6ALZ0_DESPS      FPGT-VIPMLPEKLSNNLCSLVPDEDRLTLTAILDIDRAGKLQKKSFCRSLIRSQHRFTY
E6W3Z0_DESIS      FPAY-CIPMLPEALSNDICSLMPKVNRYAMTCVMDIDRQGNVTGYHITPSIIRSDRRFTY
C1F8V5_ACIC5      FPDR-AIPMLPQELSTDICSLRPGEDRLVLSCLMQMDAHGQVTGYEVTEGVIRSAQRMTY
RNR_MYCGE         LPGHYVVPMLPEQLSNQLCSLNPAQKRYVVVCEISFDNQGRIKTNKLYPATIISKNRFSY
RNR_MYCPN         LPGYYVVPMLPERLSNELCSLNPNEKRYVVVCELNFDHEARLNFSEVYPATIVSQRRFAY
RNR_UREPA         LVDR-VIPMLPHNISNNICSLNEGEFRMCITCDMVIDKDGKICWKDVYPAIMKNYRQMSY
Q7NB22_MYCGA      LANK-VIPMLPEELSNDLCSLNPGVDKFVIVGDLMIDGTGKIMSHEFYPAIINSHKRFSY
RNR_MYCPU         LPHM-VIPMLPEKLSNGICSLNPGVDRLVMSIDIFIDFQGNTIKTELYEGIINSKHRLTY
C5J794_MYCCR      LPHI-VIPMLPESLSNGICSLNPNVDRYTITMEALIDKNGQNLSVKIYPSVIRSYKRLTY
A5IXZ7_MYCAP      LLNE-VVPMLPFKLSNGICSLNPNEERLTISCITKINKLGQSIETKIVPSVIKSKYRLTY
Q4A6A7_MYCS5      IANG-VIPMLPSELSNGICSINPNVDRFALSCDIEIDQHGNNVNYKIYKSVINSKFRLTY
D1AQ67_SEBTE      LVDR-VIPMLPRKLSNDLCSLNPNEDKLAFSAEIDFDHSGKVVKNDFYKSVIKSKHRMTY
Q6F1Q7_MESFL      LANR-VLPMLPKILSDDLCSLNPNTKKFALACEMKFDKNGIMISKEVYETIMISKVRLNY
RNR2_LACLA        VTDR-VVPMLPVKLSNNLCSLNEAQERLTMSCLMEIDDKGKIVSYKISPSVIKTTYRMTY
RNR1_LACLA        VTDR-VVPMLPERLSNGICSLNPRINRLTQSCVMEISPEGRVINYQISQSIIKTTERMTY
E6U4I2_ETHHY      FGNR-VIPMLPEALSNGICSLNPREDRLAFTVFIDVNGSGEIIGHELHKSVIRSYVKGVY
E6UGT4_RUMA7      YANR-VIPMLPAELSNGICSLNPKEDRLAFTCLTELDNAGNIVSYKFAKSVIRSRVKGVY
RNR_BACSU         LVDR-VIPMIPHRLSNGICSLNPKVDRLTLSCEMTINSQGQVTEHEIFQSVIKTTERMTY
E6SKU1_THEM7      LVDR-VIPMLPPRLSNGICSLNPRVDRLAVSVIMDFDAQGRRVAYEIFPSVIRTRHRLTY
RNR_THEMA         LIDT-VIPMLPFRLSNGICSLVEGKDRLTMSVEMEIDRDGRVVRYDVYPSVIKSKKRMIY
D7BIB2_MEISD      LPGR-VLPMLPEKLSNGVCSLVPGQDRLVLSVLVEITDGGRVLRHSFREGVIRSKARLTY
D7CS88_TRURR      LPGR-VLPMLPEALSNGICSLVEGEPRLTLSVLVDLTKDGEVKAMQVAETVIVSNARLTY
D2QSQ5_SPILD      LVDR-VVPMLPEKLSNGLCSLRPNEDKLTFSAVFEMTSDAKIVNEWFGRTAIHSNRRFAY
B3ETS7_AMOA5      LVDR-TIPMIPERLSNELCSLKPHEDRPAFSAVFELDKQGSLHHEWFGETVIHSDQRLSY
C7PAC9_CHIPD      LPDR-VLPMLPEKISNELCSLRPHEDKLTFSAVFKMNDKGEIKENWIGRTVIHSDHRFTY
D0J9E8_BLASP      FVGK-VIPMLPKILSNDLCSLHPEKDKLSFSSIFNMNNQGKILKSWFGKTIIRSNRRFTY
D5H9E3_SALRM      LVDR-TIPMLPEKLSNKVCSLRPHEDKLAFSILMELTTEGDVVDYEICETVIHSKERLTY
RNR_CHLMU         FPGK-VIPMLPSALSDNLCSLKPNVDRLAVSVFMTFSKEGFLSDYRILRSVIRSKYRMTY
RNR_CHLTR         FPGK-VIPMLPSALSDNLCSLKPNVDRLAVSVFMTFSKEGFLSDYRILRSVIRSKYRMTY
RNR_CHLPN         FPGK-VIPMLPSALSDNLCSLKPNVDRLAVSVFMTFTKSGHLSDYQIFRSVIRSKYRMTY
D5SPD1_PLAL2      LPGK-VLPMLPEVLSNALASLQQDKVRFVKSAFIEYSPDGMVKHTSFANAAIKVRRRFAY
D2R7Z3_PIRSD      LPDR-VLPMLPEIISNNLASLQPDKVRYAQTAIIEFSPEGTPLHSEFYLSAIKSCRRFTY
A7HAA8_ANADF      FPMQ-VLPMLPERLSNGICSLNPDVDRLCMVADLVVDEHGETRSAEVYEGVMRSAARCTY
Q1D4N8_MYXXD      LPDR-VLPMLPERLSNGICSLRPDEDRLCMVADMTFDRRGHRRSYDLYPAVMRSVARCTY
RNR_BUCAI         FPSL-VIPMLPEKISTDLCSLKPNVERLCLICEMSLSKQGELISYKHYEGIICSHGRFTY
RNR_BUCAP         FPSL-VIPMLPEKISIDVCSLNPNAERLSLICEMNLSNKGELITYKHYEAVICSHGRFTY
RNR_VIBCH         FPSQ-VVPMLPEVLSNGLCSLNPQVDRLCMVCEMTVSETGKLSGYKHYEAVMNSHARLTY
RNR_VIBPA         FPSQ-VVPMLPEVLSNGLCSLNPQVDRLCMVCEMTISESGKLSSYKHYEAVMNSHARLTY
RNR_ECOLI         FPSQ-VIPMLPEVLSNGLCSLNPQVDRLCMVCEMTVSSKGRLTGYKFYEAVMSSHARLTY
RNR_SHIFL         FPSQ-VIPMLPEVLSNGLCSLNPQVDRLCMVCEMTVSSKGRLTGYKFYEAVMSSHARLTY
RNR_HAEIN         FPNR-VVPMLPEILSNGLCSLNPQVDRLCMVCEMQISAKGKLTDYRFYEAVMNSHARLTY
E6WR29_PSEUU      FPGF-VVPMLPETLSNGICSLNPKVDRMCFVADMQVDHDGEVVRSKFYEAVMNSHARLTY
Q15PA3_PSEA6      LPDQ-VVPMLPEALSNGLCSLNPHEDRLVMMCEMTINATGLVTQAAFSEGVIQSHARLTY
A9GZQ2_GLUDA      FPDR-VVPMLPEALSNGWCSLRPGEDRGCLFAEIFIDAAGNKTRHRFGRGIMRSAARLTY
Q0BU01_GRABC      FPDR-VVPMLPEALSNGWCSLRPDEDRGCLFVEMMINAGGGKIRHRFGRGLMRSTARRTY
B0T0I6_CAUSK      FPDR-VEPMLPETLSNGLCSLREGENRATLAVRMVFDNDGRKKSHKFVRGLMRSAAKLSY
C6XL74_HIRBI      FPDR-VAPMLPEALSAEQCSLKENELRETFAVEMRFSANGNKIGHRFIRGTMRSAAKLSY
Q2RPE7_RHORT      FPDR-VVPMLPEALSNGWCSLRPNEDRGCLAVWMIFDAEGNKLRHRFLRGLMRSAARLTY
Q28VI9_JANSC      FPDR-VVPMLPDRLSGDLCSLHEGVPRAVIAVRMVIDARGEKIGHTFHRGLMTSVASLSY
A8I2E1_AZOC5      FPDR-VVPMLPERISNDLCSLRPQEDRAALAVRMVIGKDGRKRSHSFHRILMRSAAKLAY
E0THA1_PARBH      LIDR-VVPMLPEALSNGLCSLKAGEDRTALCCELIIGPNGGRKRHRFFRALINCHRGLAY
D5BRG4_PUNMI      LPDL-VVPMLPEAISNDLCSLRPHEDRAAMVAEIFIDNEGQRISHSIQRALIKSHARLTY
RNR_HELPY         FPNS-VYPMLPLSLSQGACSLKAFEKRLALVYEIPLD---NLKNARLSQGVIEVRANCTY
RNR_HELPJ         FPNS-VYPMLPLSLSQGACSLKAFEKRLALVYEIPLD---NLKNARLSQGVIEVRANCAY
A9NF96_ACHLI      LADR-VIPMIPHGLSNDLCSLNPNEDKYTITCEMELNPDIEVVNYDIYASIIQSKHRLTY
A9G9F9_SORC5      LPDR-AIPMLPRALSSNLCSLLPGVIRLCLCVEVELDATAAVRRARVIEGYIRSIAKLTY
D0LU85_HALO1      LPDR-VVPMLPLPLSAGICSLNPEVDRCAMVVRLDLTDDGRVLERDFAAAVIRSHARLDY
D5EIW1_CORAD      LVGT-VIPMLPHALSNGLCSLVEAQDRLTKSVFITYSPNAGVQRVDYARTVIRSNKRLTY
                          *:*  :*   .*:     :                        :       *

D4H3I7_DENA2      NSVNDVLEKNTK------------------------EKDK--AILDLLKDSKELAGKIMV
E4TG32_CALNY      NYVNSIIEGYEK------------------------TDDL--RLISLIDTGLSLLDKLIQ
RNR_AQUAE         NEALALIVGDPA------------------------LEKKFPNLVEPLRMMETLYRILSR
B8DP48_DESVM      GQVNRAIIEKD-----------------------EKERRLLTPVLPLLERAEALARLLNA
C6C1J0_DESAD      EQVYQGVILGE-----------------------KEEQESLGDLLPMLKLCEELARKINK
C7LXJ9_DESBD      NQVQAALDGTP-----------------------DQD---TAELLPMLRDAEELAKIFMK
B8IYR8_DESDA      DQVKACILDKDEAALAE-----------------LRTEERGEEVLAMLDKAFALYTVLRD
Q1MQS9_LAWIP      EQVHLALEVKE-----------------------ISRLPGGIDTLSMLNNASELAKVLQA
Q6ALZ0_DESPS      TRVQEILDTPG------------------------SVSADEKAFLSMLQEAEKLARILKE
E6W3Z0_DESIS      EEVQEILDGNV------------------------HDR----AFTAALEQMAKLAKILRR
C1F8V5_ACIC5      TQVQAILDGDA------------------------ETRDAFRPLVPEFERMYRLAQILNA
RNR_MYCGE         DQVNKWLNNKSELNCD-------------------------ETVINSLKAAFTLSDLIQA
RNR_MYCPN         SEVNDWLEDSDALKDES------------------------ATVLESLKAGFTLSELIAE
RNR_UREPA         DEVNDFYEGKSRFESAT------------------------LTMKEMLLEAKELHHILRN
Q7NB22_MYCGA      EEVNEYFSATNDLKDVD------------------------PSIRQMLDEARVLAKILRR
RNR_MYCPU         NQVNDFYNNKIKL-DPN--------------------------LEKMLNDSLELSKILEN
C5J794_MYCCR      HQVNEFFDNKLSFGDPK--------------------------LENLLKNALKLGQILRK
A5IXZ7_MYCAP      ERVNEFINESKDFED--------------------------KELNKMLKNAYELSQIIRE
Q4A6A7_MYCS5      KQVQAFFDKDNNFLSLEQ----------------KKS-SYVKELETMLTNAYELSLILHK
D1AQ67_SEBTE      SKVNEIIAESEEANAEY------------------------QDIKEMISEMLELSNLLRE
Q6F1Q7_MESFL      NEVNEYIANKTWNHCE--------------------------ESRTMIDQAIELFKLIEQ
RNR2_LACLA        NNVNKMIHQGQEGHREAL----------------EN----FFKITDSIKVAVELHEILET
RNR1_LACLA        DAVNQMIA----GDEAAL----------------EN----YAKIADSVKIMVELHHILEA
E6U4I2_ETHHY      DEINQIYAETAGEDLLAK----------------------YKDALPSIARMRELAELLQQ
E6UGT4_RUMA7      SEINDIFDGFVSRELSEK----------------------YAEVMEQLPLMKELAEILCK
RNR_BACSU         SDVNKILVDDDEE----------------------LK-QKYEPLVPMFKDMERLAQILRD
E6SKU1_THEM7      EGVERMLEGDPDDPEVRA-----------------LR-EQHADVLPMLEEMARLAARLTA
RNR_THEMA         ERVNEFLEDPSS------------------------M-KEYEPFKDLIYNAVELAEILRE
D7BIB2_MEISD      TQVQAFAEGKGMP-------------------------DEFKWLEPDLALLLELTRKLKA
D7CS88_TRURR      DEVQAFADGEKLP-------------------------KGRGKLSRDLTQLLKLTQKLRA
D2QSQ5_SPILD      EEAQDILNSNSGD------------------------------YIEELRLLNELAYKLRD
B3ETS7_AMOA5      EEAQQAITQPTHS------------------------------LHEQITTLNNLAKKLRA
C7PAC9_CHIPD      EQVQEVIETGEGP------------------------------YKDEVLLLNKISQTLRK
D0J9E8_BLASP      EEVQKIIERKKGD------------------------------YHEDISTLLFFSKILTK
D5H9E3_SALRM      DRAQDYIEGGYPDD----------------------------KMAADVVQANRLAKTITR
RNR_CHLMU         DEVDEIIEKKL-----------------------------AHPISKTILEMAELSRIFSD
RNR_CHLTR         DEVDEIIEKKQ-----------------------------THPISKTILKMAELSRIFSD
RNR_CHLPN         DEVDNIIEKKH-----------------------------SHPLSKILNEMATLSKKFSD
D5SPD1_PLAL2      EQVMPLLLNRQSPGEHPA----------------PEGETVPEEICQLLERMYELAMILRK
D2R7Z3_PIRSD      EEVDDYLADRQAWKKKLK----------------PQ-------VHELLGVMHELAMILRR
A7HAA8_ANADF      TEVANVVAGQSVPGR--------------------------DRFRERFLLMAELQEKLTA
Q1D4N8_MYXXD      NEVQDVLDGKDVPHR--------------------------NAHKPHFERLMSLARALMK
RNR_BUCAI         NEIFKIWN--------GD----------------IFLRSKYKKFLKDIENLSCLQNIFNK
RNR_BUCAP         NEIFKIWN--------GD----------------IELCFKYKKLLKYIQNLSSLQKILKK
RNR_VIBCH         TKVHEILE--------GD----------------EELRERYKALVPHLEELHKMYQVLKS
RNR_VIBPA         SKVSAILE--------GD----------------EELRERYQPLVSHLEELHAMYKVLKE
RNR_ECOLI         TKVWHILQ--------GD----------------QDLREQYAPLVKHLEELHNLYKVLDK
RNR_SHIFL         TKVWHILQ--------GD----------------QDLREQYAPLVKHLEELHNLYKVLDK
RNR_HAEIN         TKVAKMLE--------GD----------------EELRTRYSTLVPHLEELYKLYQALLS
E6WR29_PSEUU      TQVWKAVGE-------DD----------------AEAKAQIGALMPQVERLHQLYQVLAA
Q15PA3_PSEA6      NQANALVTQPNSK---LG----------------KTTAASSPAIVPHVKDLHALFQVLIK
A9GZQ2_GLUDA      DQAQAIVGNVEE------------------------SQQETGLPDGLINTLFTAWRALST
Q0BU01_GRABC      ----------EE------------------------VQQAHEAGDETLDALYGAYHALIK
B0T0I6_CAUSK      EQAQAAIDGIAPP---DG----------------QDGDKAGPLLDPILRPLWAAFRLMGK
C6XL74_HIRBI      EQAQAAIDGKP-------------------------DDKAGPLLETVLKPLWAAYECVGK
Q2RPE7_RHORT      TQVQAARDGHA-------------------------DDLTAPLQERVIAPLYGVFQALLG
Q28VI9_JANSC      EEAQAAQEGTL-------------------------SERTAPLIEGSIRPLFAAYDALKI
A8I2E1_AZOC5      EQAQAAIDGVS-------------------------DDTTAPLLESVLRPLYAAYACVKQ
E0THA1_PARBH      EEAQAAADGRL-------------------------TDRTRDLKDSVIDPLWAAWQALET
D5BRG4_PUNMI      DTVQAVFDGTL-------------------------DEADADVPHGTLHALFGAWHALNI
RNR_HELPY         EEINHFLSANQSS--------------------------LDKDLQQSLLGFLEMALKLKK
RNR_HELPJ         EEINHFLNTQQSS--------------------------LGKDLQQSLLGFLEVALKLKK
A9NF96_ACHLI      HDVNQLFKEHQST--------------------------GFKEVDKMLFTMNEIAQKLKQ
A9G9F9_SORC5      PGVARALGFTPEP----------------------PRSPEAEALRNDLQVMWDLARLLRG
D0LU85_HALO1      PGVAAALSGDFRG-----------------------RRDHYRPWAPALSRLAALAQRMRT
D5EIW1_CORAD      AQAYAFMETDDLDEVRKTPLPPKHQTGSTGRDLSEVSDGEMETLQRYIRKLWTIAEQLRK
                                                                 .         .  

D4H3I7_DENA2      RRAKAGM-LDFDFPETTFEL-DENGEVTAIIPA-----ERHLSHRIIEHFMIEANEVVSE
E4TG32_CALNY      RRKNDGM-IDFDLPEVEFYF-DENGDMVDIKPL-----ERKISHRLIEFFMIEANEAVAE
RNR_AQUAE         KRWEMGS-IDFDLPEAEVIV-DEYGEPTAIYPY-----ERHVAHRIIEHFMISANETVAL
B8DP48_DESVM      KRSERGS-LDFDLPEPEVIF-NIYGETVDIGRK-----VRHFGHQIIEEFMIAANEAVAR
C6C1J0_DESAD      RRNARGS-LEFDLPEPEILF-NLQGRTVDIRPR-----CRNFAHQIVEEFMIAANEAVAE
C7LXJ9_DESBD      RRMDRGC-LDFDIPEAQV---RVIEDIISVHAG-----TRLFSHRLIEEFMIAANERVAE
B8IYR8_DESDA      VRRQRGT-LDFDLPEAQSRL-DDLGRVVWLGHR-----ERNDAHRLIEEFMIAANEAVAR
Q1MQS9_LAWIP      NRIKRGS-LEFDLPETRFLINKATRRVIGVIRQ-----ERFFSHQLIEELMLAVNEAVAT
Q6ALZ0_DESPS      KRAIRGA-LGFTMPESIILL-DSEGEVENVARS-----EAHFSQKIIEEFMLSANEAVAE
E6W3Z0_DESIS      KRFTKGS-IDFDRPEREVIV-DEKGMVLDVRRA-----ERLFAHRLIEEFMLIANVTVAR
C1F8V5_ACIC5      KRERRGS-IDFDLPEPVIEF-DEFGAMKAVTRA-----ERLWANRLIEEFMLSANECVAS
RNR_MYCGE         QRQKRGT-IDLSHKETEIVV-DEHYFPIKINFL-----VHDKAETMIENLMVVANETVAW
RNR_MYCPN         QRKKKGT-IDLSHSETEVVV-DQNYYPIEIRFL-----THGKAETMIENLMVVANEAVAW
RNR_UREPA         KKIKDGY-VDFDIKEPKIIL-DETGVPIDIKIY-----ERKTAQMMVEDFMIAANEAVTM
Q7NB22_MYCGA      MKIKRGY-LQFDVDETSIEL-DDRFEPINILKK-----PHGEAQEMIEDFMVAANEAVCL
RNR_MYCPU         YKKDEGY-INLEIEESKVIL-DKEGKTVGIKVI-----QRGLSEVLIENFMVRANEAVAW
C5J794_MYCCR      YKENQGY-VDLEIDESKIIL-DEQGYTERIEIK-----ERGLSENIIEDFMVRANENVSK
A5IXZ7_MYCAP      FKNKQGY-IDFEIQEPHIEL-DSDGRVLDISVE-----KTGESEKMIEDFMVRANEEVAK
Q4A6A7_MYCS5      YKEAQGY-VDFEIPEPKIFL-NEDGTVKEIKIH-----KRVYSEILIEDFMVRTNEVVAK
D1AQ67_SEBTE      TKKRRGS-IDFELPEIKVVL-NDDKSVKDIELR-----KRGESERIIEDFMVAANEAVAE
Q6F1Q7_MESFL      VKIKRGT-ITFDVREPKVIM-DENSNVIEIKAR-----QTGESEKLIEQFMVSANEAVAE
RNR2_LACLA        MRKDRGM-IEFDESEAKIIL-DEKGHPIEIVKR-----DRDTAERMIESFMLMANETVAL
RNR1_LACLA        MRKRRGA-IDFDTVEAKIIV-NEKGLPIEIRKR-----TRGIAERMIESFMLEANETVAT
E6U4I2_ETHHY      ARKRRGA-IDFESDDCEVVF-NEQGVAVDIVRR-----TRGISERMIEEFMLLANEAVAT
E6UGT4_RUMA7      KRIARGA-PQIETSESALMI-NEDNVCVGVGEY-----TRGFAQEMIEDFMLTANECAAR
RNR_BACSU         KRMDRGA-VDFDFKEAKVLV-DDEGAVKDVVIR-----ERSVAEKLIEEFMLVANETVAE
E6SKU1_THEM7      RRERRGS-IDFDIAEVKVVL-DQQGMPRELLRR-----ERTVATRIIEEFMIAANETVAE
RNR_THEMA         ARRKRGAILDIESDEVKVIL-DENGQVVDIVPR-----KRGIAEKLIEEFMIRANETVAE
D7BIB2_MEISD      KRVAAGA-LDFHFTEVKVDI-GEAG-EIHLIPQ-----TEPDARSLIEELMLLANRIVAK
D7CS88_TRURR      ARMAAGA-LDFDFTETKVDV-DPEG-ELKVMPV-----RPNAARQLIEELMLLANRLVAE
D2QSQ5_SPILD      ERFKNGA-INFETVEVRFRL-DENGVPLAVYPK-----IRQDTNKLIEEFMLLANKRVAE
B3ETS7_AMOA5      DRFKSGA-INFDTPSVKFQL-DKQGRPLSILPK-----VSEDSHRLIEEFMLLANKRVAL
C7PAC9_CHIPD      VRFENGA-INFSSQEVRFQL-DENAKPIGIVIK-----ESKEAHQLIEELMLLANRTVAE
D0J9E8_BLASP      NRLKNGA-ISIEKVEIKFHL-DKKNNPTRLYLE-----KSNEAHRLIEEFMLLANRKISE
D5H9E3_SALRM      RRMQEGA-IDFGSDEVNVIL-DDDGTPTNIVRK-----ERLQANRLIEEFMLLANRTVAK
RNR_CHLMU         IREQRGC-TRLVLPSFTMSL-DNLQEPVALVEN-----KQTAAHKLIEEFMLKANEVIAY
RNR_CHLTR         IREQRGC-TRLVLPSFTMSL-DNLQEPVALIEN-----KQTAAHKLIEEFMLKANEVIAY
RNR_CHLPN         IREERGC-IRFVLPSVTMSL-DNLQEPVALIEN-----HQTFSHKLIEEFMLKANEVVAY
D5SPD1_PLAL2      RRFSRGA-LELSLGEVELDC-NDDGNVTGAHRA-----LHDASHQIIEEFMLAANVAVAE
D2R7Z3_PIRSD      RRLERGA-IELSLPETKIDL-DKKGEVSGAHLS-----KNTESHQIIEEFMLAANEAVAR
A7HAA8_ANADF      MRGRRGA-LDFDLPEAKIVL-GEGGEVVAIEKR-----PRNRAHRIVEEFMLAANEAVAR
Q1D4N8_MYXXD      MRKERGA-IDFDLPEHKVVL-DEDGLPARMDKR-----ERKDSHRLIEECMLAANEAVAT
RNR_BUCAI         DNISKKG-IYFENI-EPKFVLDSNLRIKSIYQN-----IRNDAHKFIESCMILANVASAR
RNR_BUCAP         YNVSKRG-IYFENI-EAKFILDSNYRIKNISQN-----IRNDAHKFIESCMILANIASAE
RNR_VIBCH         ARDERGA-IEFETV-ETKFIFNAQRKIESIEPV-----VRNDAHKLIEECMILANIASAS
RNR_VIBPA         ARDQRGA-IEFETV-ETKFIFNAERKIESIEPV-----IRNDAHKIIEECMILANIASAS
RNR_ECOLI         AREERGG-ISFESE-EAKFIFNAERRIERIEQT-----QRNDAHKLIEECMILANISAAR
RNR_SHIFL         AREERGG-ISFESE-EAKFIFNAERRIERIEQT-----QRNDAHKLIEECMILANISAAR
RNR_HAEIN         ARHQRGA-IDFETI-ETKFIFNAMGRIERIEPV-----VRNDAXKIIEECMXLANIAAAN
E6WR29_PSEUU      ARARRGA-IEFESS-EVRFVLDNRGEVTQAGML-----PRNDAHKLIEECMIAANVEAAR
Q15PA3_PSEA6      QRKQRGA-IDFETR-ELALKLNKHKNIASISPV-----KRNDAHRMIEEFMLCANVATAQ
A9GZQ2_GLUDA      ARARRGT-LDLDVP-ERVVRLDTSGRITAIEPR-----PRHDSHRLIEEFMVLANVAAAE
Q0BU01_GRABC      ARTARGT-LDLDLP-ERKVILNEAGSVDAIIPR-----PRLDSHRLIEEFMVLANVAAAE
B0T0I6_CAUSK      GRAQRSP-LGIESD-ERRIII-KDGEIQSITRR-----ASLEAHKLIEEMMIQANVCAAE
C6XL74_HIRBI      ARTRRQP-LELDLP-ERRVTLDKDGTVLGVFTK-----DRFDAHKLIEEFMIQANVCAAE
Q2RPE7_RHORT      ARSRRGT-LELDLP-ERKVVLDDGGEVARIEPR-----LRFDSHKLIEELMIAANVSAAE
Q28VI9_JANSC      ARAKRQP-LELDLP-ERRIELDDAGNVTSVAFK-----DRLDAHRLIEEFMVLANVAAAE
A8I2E1_AZOC5      ARDARQP-LELDLP-ERKILLKEDGTVDRVIVP-----PRLDAHRLIEEFMILANVAAAE
E0THA1_PARBH      ARRKSPS-LDLDMP-ERQILLAEDGAVDRIVRK-----QRLDAHRLIEAYMVTANVCAAE
D5BRG4_PUNMI      DRTAREP-LALDLQ-ERRVEFDDSNNAVGIALR-----KQSESQRLIEDFMIAANVAAAD
RNR_HELPY         ERLKKGF--NFNSFENKLYL-NKEGRIEKIETE-----KESDAHTLIEEAMLLANQSSAR
RNR_HELPJ         ERLKKGF--NFNSFENKLYL-NEEGRIEKIETE-----KESGAHTLIEEAMLLANQSSAR
A9NF96_ACHLI      IRTKRGA-IDFNSTELKFVL-DVNGDVLGVEER-----TTDEAEALIESFMILANETVSR
A9G9F9_SORC5      RRMRRGA-LDLDLPEAKVVLDPKTGAPVDVQKRSH-DPGVAKAYQLIEELMLLANETCAQ
D0LU85_HALO1      RRRARGA-LELTLAEPYVILDADEAELVRDIVRSKGAEDVRQAYELVEEFMIAANEAVGK
D5EIW1_CORAD      KRFRNGS-LDLEMTEIKIYV-DEQGYADRIEKQ-----SHDESHQLIEEFMLAANEAVAR
                   .        :                                  ::*  *  .*     

D4H3I7_DENA2      FLEKH-------------TKKSVYRIHDKPDPMKLEDFAGLAATFGVDVTVKDVT-PKDV
E4TG32_CALNY      FLEKA-------------YDRGMFRVHGSPDPEKLQEFVTICHIYGIEVGELVVDDPKSI
RNR_AQUAE         HLEHA-------------GYPCLYRVHEPPDEEKVENLLEILEGLGYKVKRPHEYTPKFF
B8DP48_DESVM      FLTEK-------------NARFLYRVHPEPDTEKLEGLFKVLGRTSLAQHLPGKASAKAL
C6C1J0_DESAD      FLTEK-------------EIGCLYRVHPGPDEEKLTNLFKVLRKIGISKQIPDPVTPQTL
C7LXJ9_DESBD      YMGAR-------------QRVFPYRIHPQPDEKKLETLLRMLSHTSLVDRLPKEMNQMGL
B8IYR8_DESDA      HLRDA-------------DIPFLYRVHPDPDPERLESLFDTLAATGI-ENLPPKPSPAAM
Q1MQS9_LAWIP      FLHDK-------------QIPFLYRIHPEPDIERLEKLFRILATTDLACQLSGSPDAKKL
Q6ALZ0_DESPS      FFTEQ-------------GCSALYRIHEKPDVDRVKEFATYAHNLGMQLPPPDN-SPAWF
E6W3Z0_DESIS      HLDSH-------------GYPGIFRIHEEPDQQRMEEFARIAWNFGYPLKGRSYHSSQLN
C1F8V5_ACIC5      WLENL-------------AVPAIYRIHEKPEPRRVVEFEEIAASFGYSLGIGNLPVKRFH
RNR_MYCGE         VLTNN-------------KIALPYRVHPRPSKKKLQSLIETVGELNITKPQF---NLDTV
RNR_MYCPN         TLTNH-------------KVHLPYRVHPRPSKKKLQMLLENIVELKITQPNF---VLDTV
RNR_UREPA         FAEEHMDKTLKEF---NLEMPFIYRVHDKPSIINLQKFEIEAKKLSFNISH----DFENI
Q7NB22_MYCGA      FASKY-------------NLDFIYRVHPKPAVHKLNSFANWARTLEFEIFG----DLNSI
RNR_MYCPU         KMNKL-------------KLPSIYRVHDNPSIESLVLFEKTLKTLGIDF-----DTPKIT
C5J794_MYCCR      YLADH-------------NFPNLYRVHNKPDSQRILQLNQIIKNLGLEI-----QIPYNV
A5IXZ7_MYCAP      FITNS-------------KLPMMYRIHEVPSEEKIEYFLEVLKSLKINV----SLNRKHI
Q4A6A7_MYCS5      YLSDL-------------KMPVLYRIHENPSEEKLQSLKTNLTALGINIK---NINSITS
D1AQ67_SEBTE      KLFWE-------------EIPAIYRVHEDPDKEKIKTLNDTLIKFGVH-----LKNLEDI
Q6F1Q7_MESFL      IVYEM-------------ELPFIYRNHDKPDEEDLITWYQSLKSFGIDPKLTPLEMLDPI
RNR2_LACLA        DFQKK-------------KLPSLYRVHDNPKEKSFAKLMEAAANAGFSLN-----SDS--
RNR1_LACLA        HFEAH-------------GLPFIYRIHEQPKADRLQRFIDFAATFGMQIE-----GTSNG
E6U4I2_ETHHY      FASEK-------------KLPFVYRVHEEPDALKLENFAASLAAVGINNR-----KIKPG
E6UGT4_RUMA7      FGKDN-------------ELPFVYRVHEPPSAEKIDGLKELLAGLDIMY------VMGDD
RNR_BACSU         HFH-------------WMNVPFIYRIHEEPNAEKLQKFLEFVTTFGYVVKG-----TAGN
E6SKU1_THEM7      HCH-------------WRQVPFVYRVHEEPDPDEVEELAAFLTILGYPLP------PRRK
RNR_THEMA         IFD-------------HAGLPFMYRVHEEPDPETIFQLKNYLEAMGIRAK------FSHK
D7BIB2_MEISD      YLS-------------DKGLPALYRVHEDPTDMAYAKLAAQLSKLGYELP-------GME
D7CS88_TRURR      YLS-------------KRDLPALYRVHEDPSEAKMQALQASLARLGYTLD-------LEH
D2QSQ5_SPILD      FVHSLSKRNK-----GGEENTMVYRVHESPAEDKLRSFSDFARKLGYKLNV-----DD-E
B3ETS7_AMOA5      HVRRMKQ--------GKQFPTFVYRTHDQPNLERLGDFALFVKQFGYSIKA-----EP-Q
C7PAC9_CHIPD      YVYNIRIG-------TNQHVPFPYRVHDTPDEEKLKMFSAFARKFGHKLEV-----DNLE
D0J9E8_BLASP      FFSLNLDG-------KPSNRTYIYRVHDEPDFQKIFVLKKIIEPLGYFLDL-----KN--
D5H9E3_SALRM      HIAAPEHVDRHRSNGTDEPLPFVYRVHDSPDSEEIQQLAEYVRVFDHELPL-----TDGN
RNR_CHLMU         HISHQ-------------GITMPFRIHEPPNEENLLLFRETAKAMGFTITQ------TPT
RNR_CHLTR         HISHQ-------------GITMPFRTHEPPNEESLLVFQETAKAMGFTITQ------TPA
RNR_CHLPN         HISHQ-------------GVSLPFRSHEPPNDENLLAFQELAKNMGFDITF------TPT
D5SPD1_PLAL2      EFDRR-------------GWFFLRRVHDSPDELRMQNFAKFVATLGYDLPR------AQD
D2R7Z3_PIRSD      HLNEK-------------ELPFLRRIHENPDLRKLQVLTKFVRELGIECDS------LES
A7HAA8_ANADF      WFGSR-------------ELPTIYRIHDVPDEEKLQAFLDLAESHGFEVPE------VPG
Q1D4N8_MYXXD      FFQNE-------------GLPTVYRFHGEPDPEKLATFAALAEAYGFKMRV------EDG
RNR_BUCAI         FVEKY-------------KYPVLFRNHDRPKKDNVVSLRLFLNELGFTLLGGDSPESVHY
RNR_BUCAP         FVKKH-------------KSPVLFRNHDRPDKDSIINFRSVLKKLGLSLLGGEIPESTDY
RNR_VIBCH         LVEKA-------------KEAALYRVHEPPGEERLTGFRDFLGELGLDLSGGLEPSPTDY
RNR_VIBPA         LVEKA-------------KEPALYRIHESPGELRLQGFRDFLSELGLELKGGLEPSPTDY
RNR_ECOLI         FVEKA-------------KEPALFRIHDKPSTEAITSFRSVLAELGLELPGGNKPEPRDY
RNR_SHIFL         FVEKA-------------KEPALFRIHDKPSTEAITSFRSVLAELGLELPGGNKPEPRDY
RNR_HAEIN         FMEKH-------------KEPALYRIHATPSEEKLTSFRTFLSEFGLTLEGGLKPTTKDY
E6WR29_PSEUU      YLIRS-------------HIPAPFRIHEKPPESKYADLLEFLKEFGLALPPWSKVVPGDF
Q15PA3_PSEA6      FLQRH-------------KIPSLFRVHLGPQQKKLTALRAFLTEKGLTLGGGDSPSPQHY
A9GZQ2_GLUDA      ELERR-------------RRPCLYRIHAPPSPERAEAMRDSLSAMGFDLPPPGALRARDL
Q0BU01_GRABC      ELERL-------------HRPCMYRVHAPPSDEKTEALRGFLDSFGISLPPAGQIHPRDL
B0T0I6_CAUSK      SLEAK-------------RTPLIYRVHDTPSQEKVMSLVEFLQTIEVKWSKGEAPTTARF
C6XL74_HIRBI      SLEKA-------------NSPLIYRVHDEPSDEKILALGFFLPTIGMKWARGAKKTAERF
Q2RPE7_RHORT      TLEEK-------------RRPCMYRVHDQPAPDKLVALGEFLESLDIPFHKGSINRSGQF
Q28VI9_JANSC      TLIAK-------------RTPLLFRVHEEPSPEKLEALREVAASAGLTLAKGQVLQTRHL
A8I2E1_AZOC5      TLEQK-------------KVPLIFRVHDGPTLAKLSALREFLATLDISLPKTDQVRPSHF
E0THA1_PARBH      TLESA-------------NRALIYRVHDVPDEERIDGLRVYLSSMGYSLPKGQVLKPAKF
D5BRG4_PUNMI      TLIAA-------------KRPCVFRVHDAPDPKKADSLHKLADAIGGKFTRGQVLQPHHF
RNR_HELPY         LLDEH------------FHNKGIYRTHKEPSLEQQKRLYDKLFDYEIVRPKNMGFFPFLE
RNR_HELPJ         LLDGH------------FHNRGIYRTHKEPSLEQQKRLYDKLFDYEIVRPKNMGFFPFLE
A9NF96_ACHLI      HFFFN-------------DLPGIYRVHEKPTSEKLDIAFESSAKLGFRVDQSAKSSAQKL
A9G9F9_SORC5      FVVDQ-------------GIPTVFRYHAPPDQAKLERFATMCGELGLAFDPEDAADPKRL
D0LU85_HALO1      YFAER-------------NLPTVWRIHAPPEPDRLHELLPVLANFGIKLTVEDIEAATKP
D5EIW1_CORAD      VMKRN-------------RFPCIYRVHDEPEDEKLQELRETMSTYGVKCGNLNKAQEMSR
                                          * *  *                              

D4H3I7_DENA2      KKINEA-----------------------------------VNNSDYADILGGALVRTMA
E4TG32_CALNY      QSLSEK-----------------------------------IANSKFSYLLSSMLVRTMQ
RNR_AQUAE         QKIIED-----------------------------------FEGRPEENLVRFLTLRAMA
B8DP48_DESVM      QGVLQA-----------------------------------AKGSDQEFLVNRMALRTMM
C6C1J0_DESAD      QEVIKD-----------------------------------SEGTDQEYIVSRLLLRSMK
C7LXJ9_DESBD      QHISHA-----------------------------------AKGTDIEYLVNRLILRTMM
B8IYR8_DESDA      QGILAA-----------------------------------AQGTPQEFLVNRLCLRAMP
Q1MQS9_LAWIP      GGILEE-----------------------------------AENTPQTFLISRMVLRSMM
Q6ALZ0_DESPS      GRVIEE-----------------------------------SKGSEKEFVVNNLLLRSMK
E6W3Z0_DESIS      TILEQS------------------------------------RGKPEEDLISTLMLRSMK
C1F8V5_ACIC5      TRGERRDQRRDGRGGRRETRAHEVAEDIAVTPQMYQKLTAKLAGKPEERIVAYLMLRSLK
RNR_MYCGE         TSSQIASWLN-----------------------------ENK-DNPSYEIFVILLLRTLG
RNR_MYCPN         TSTQIAAWLK-----------------------------ENK-DNPSYDIFVILLLRTLG
RNR_UREPA         QPNTISNWLK-----------------------------MND-NHVNLPLISKLLLRSMA
Q7NB22_MYCGA      KSTDIQKWLT-----------------------------NNA-DHKQIKLINKLLLRSMN
RNR_MYCPU         SPKAFSDSFE-----------------------------KIKQNYQIDNFVKLMVLRTME
C5J794_MYCCR      DSKSFADFVN-----------------------------QIK-NKQNDNFIKIAILRTMQ
A5IXZ7_MYCAP      TPLTFQKIIN-----------------------------QIN-SQRNDEFLKMLFLRTMQ
Q4A6A7_MYCS5      SANDFSKFVY-----------------------------QTR-NQRNDYFINLLFLRTMQ
D1AQ67_SEBTE      HPGK-FQTII-----------------------------EKTKDLDEGYLIHKLILRAMQ
Q6F1Q7_MESFL      NINKTLKRIS-----------------------------EQTKDPIEEELLNLSLLRYMA
RNR2_LACLA        --HQAINFFA-----------------------------DEIKGTSSEKALTYQLRHTMS
RNR1_LACLA        IDQKVLQAFM-----------------------------KKIKGQPGEMVLSTMLLRSMQ
E6U4I2_ETHHY      LKPGDLAEVL-----------------------------REIEGTPKERALNQMALRTMA
E6UGT4_RUMA7      PKPKQLAEIL-----------------------------EMSKNTDAEKIVNNAVLRSMS
RNR_BACSU         IHPRALQSIL-----------------------------DAVRDRPEETVISTVMLRSMK
E6SKU1_THEM7      LHPRLFQQVL-----------------------------KQVEGRPEEYLVNAVVLRTMK
RNR_THEMA         IHPGMLQKLL-----------------------------EKVKDHPLRSSVERLLVRSMK
D7BIB2_MEISD      PSPKAMQAIL-----------------------------KQVEGKPEAPMVSTLLLRSLK
D7CS88_TRURR      ATPQDLQAIV-----------------------------RAASSKPESQLVNTLLLRSLK
D2QSQ5_SPILD      HLSNSMNRFM-----------------------------ASIEGKPEANMLQQLAVRTMS
B3ETS7_AMOA5      EIAQSINVLS-----------------------------EGLAGKPEAHIIQTLAIRLMA
C7PAC9_CHIPD      KLARSFNEML-----------------------------QLAHGKPEQHVLETLGIRTMA
D0J9E8_BLASP      -IKTSINHLL-----------------------------KSIQGKSEQNMIENLILRTMS
D5H9E3_SALRM      ARSSDLGALI-----------------------------DEVQGQPEEQVIVRAALRAMS
RNR_CHLMU         QEPDYQYLLQ-----------------------------ETSAGHPLEPILHSQFVRSMK
RNR_CHLTR         QEPDYQYLLQ-----------------------------ETTAGHPLEPILHSQFVRSMK
RNR_CHLPN         QEPDYQYLLQ-----------------------------TTSAGHPLEQVLHSQFVRSMK
D5SPD1_PLAL2      RQ--AIQALL-----------------------------NEVAGQPEAFPLNYALLRSLK
D2R7Z3_PIRSD      RF--EIKRVI-----------------------------KEVAGAPEEHAVNYAVLRAMQ
A7HAA8_ANADF      P--RALNALL-----------------------------GRFQGHAQQRALNQLLLRAMM
Q1D4N8_MYXXD      VSSKELDAFV-----------------------------SQLQGHPEQRALNQLLLRSMM
RNR_BUCAI         SNLLKNVSDRPEY-----------------------------------EMIQTVLLRSMT
RNR_BUCAP         SELLKKISTRPDY-----------------------------------EMIQTILLRSMK
RNR_VIBCH         ANLMKQIGERPDK-----------------------------------ELIQTMLLRSMK
RNR_VIBPA         ADLARQIAGRQDQ-----------------------------------ELIQTMLLRSMK
RNR_ECOLI         AELLESVADRPDA-----------------------------------EMLQTMLLRSMK
RNR_SHIFL         AELLESVADRPDA-----------------------------------EMLQTMLLRSMK
RNR_HAEIN         AALLEKVKERPDH-----------------------------------ELIQTMLLRSLS
E6WR29_PSEUU      TRLLKKVRDRADA-----------------------------------TLLESVLLRSQS
Q15PA3_PSEA6      NDLLKKVNHRADA-----------------------------------KLIQMLLLRSQS
A9GZQ2_GLUDA      GAVLARAAQGEASG-------------------------PASGTPVSGTLVSETILRAQS
Q0BU01_GRABC      DHILKQVAGTEHA-----------------------------------ALINETMLRSQS
B0T0I6_CAUSK      NKLLDDTRESPHA-----------------------------------AIINEVVLRTQM
C6XL74_HIRBI      NDLLAQARRTEHE-----------------------------------HLVSEMVLRSQS
Q2RPE7_RHORT      NGVLKAARGTPHE-----------------------------------HMVNEVVLRSQA
Q28VI9_JANSC      NALLKAA-GEDTS-----------------------------------ELISISTLRSMQ
A8I2E1_AZOC5      NRILGMVDGGDSA-----------------------------------PLVNQVILRSQS
E0THA1_PARBH      NHILRAARDKDET-----------------------------------DLVALAVLRTQM
D5BRG4_PUNMI      NKLLAHVKDTTDE-----------------------------------LMVNEAVLRSQS
RNR_HELPY         HALKIAKEKS------------------------------------IEREVSRLIIKSQN
RNR_HELPJ         HALKISQEKS------------------------------------IEREVSRLIIKSQN
A9NF96_ACHLI      QRLTKKVAQT-----------------------------------PYEYIINMILLRSMQ
A9G9F9_SORC5      SVFLKKLDAHP-----------------------------------QKQVLHMLLLRAMK
D0LU85_HALO1      TGMRRIIEAIE--------------------------------GQPAAASLSFQVLRSLK
D5EIW1_CORAD      LLKQLKDHPQ-------------------------------------GYTLKTHVLRSLK
                                                                    .     :   

D4H3I7_DENA2      KAEYNTNNIGHFGLASDSYTHFTSPIRRYPDLMVHRLICNTLFGTEYHSEA--GLDDACK
E4TG32_CALNY      KAIYSPDNTGHFGLSSTCYTHFTSPIRRYPDLVVHRLLKKKLFGYFFDFDE--DYLDAAA
RNR_AQUAE         RAKYSPHNVGHFGLALEHYAHFTSPIRRYPDIIVHRLLKKALRGEEIDYEKTLAYLEEAG
B8DP48_DESVM      QARYAPDHEGHFGLASECYCHFTSPIRRYADLVVHRALRRTLGLPVNGPLPGERALLTIA
C6C1J0_DESAD      QAKYEPDNEGHFGLASECYCHFTSPIRRYADLVVHRLLKVALG-DEHQAIPGQKQLGRIG
C7LXJ9_DESBD      QAQYSPENDGHYGLASVAYCHFTSPIRRYADLLVHRSLKRLIAGEPEKMSMGD--VQGIC
B8IYR8_DESDA      QARYMPFNEGHFGLASTAYCHFTSPIRRYADLLTHRALKMSLGLDSGPLPAGEK-LLRIG
Q1MQS9_LAWIP      QAKYSPEPGEHFGLASPLYCHFTSPIRRYADLLVHRAVKFALGDTQKHIPFGQQ-LFSIA
Q6ALZ0_DESPS      QAKYSADNVGHFGLAATDYTHFTSPIRRYPDLMVHRELCRLVGYLPAETKNRS--AQQAG
E6W3Z0_DESIS      RAVYSPESGLHYGLGFTHYCHFTSPIRRYPDLIVHRSLRASLDTTKRARRHKRLEASAPH
C1F8V5_ACIC5      QARYSEKNEGHFALAAPAYTHFTSPIRRYPDLMVHRIAKALLEAGVDGHGVVAMGDARVH
RNR_MYCGE         KAFYSVNPLMHFSIGSNHYTHFTSPIRRYIDLTIHRLLWMHLFT----------------
RNR_MYCPN         KAFYIVNPLIHFSIGSHHYTHFTSPIRRYADLTVHRLLWMNLFT----------------
RNR_UREPA         KASYEIINTGHFGLASDNYTHFTSPIRRYPDLIVHRLLWMFIFD----------------
Q7NB22_MYCGA      KAYYSVENTRHFSLASKHYTHFTSPIRRYADNIVHRILWMFVFD----------------
RNR_MYCPU         KAIYSDKNIGHFGLASSYYSHFTSPIRRYPDLQLHRLIKQMVFD----------------
C5J794_MYCCR      KAIYSDVNEGHFGLASKFYSHFTSPIRRYPDLILHRIIRHFIFN----------------
A5IXZ7_MYCAP      KAVYSPDNIGHFGLASECYCHFTSPIRRYPDVIVHRVLWDFVF-----------------
Q4A6A7_MYCS5      KAIYSLNNIGHFGLASEFYCHFTSPIRRYPDLLVHRILTMHLEG----------------
D1AQ67_SEBTE      RARYNNKNLGHFGLSSKFYLHFTSPIRRYSDLIVHRVLGKSLEK----------------
Q6F1Q7_MESFL      KAKYELENIGHFGLSSKCYTHFTSPIRRYSDLIVHRYLKQYIIN----------------
RNR2_LACLA        TAVYSEKNTKHFGLAATNYTHFTSPIRRYPDLIIHRLLHLY-PS----------------
RNR1_LACLA        QARYSENNEGHFGLAAENYTHFTSPIRRYPDLLVHRLIREIGEG----------------
E6U4I2_ETHHY      KAKYWPECLGHFGLALKYYSQFTSPIRRYPDLVIHRILSELLEH----------------
E6UGT4_RUMA7      KAKYDTEPIGHYGLVLEDYAHFTSPIRRYPDLSIHRIMSAFLG-----------------
RNR_BACSU         QAKYDPQSLGHFGLSTEFYTHFTSPIRRYPDLIVHRLIRTYL-I----------------
E6SKU1_THEM7      RARYATEALGHFGLAARFYCHFTSPIRRYPDLVVHRIVKELV-A----------------
RNR_THEMA         RAMYSAVNIGHFGLASYAYTHFTSPIRRYPDLVVHRLLKLYLEQ----------------
D7BIB2_MEISD      LARYAHENLGHFGLAAEHYLHFTSPIRRYPDLIVHRVLKTLM------------------
D7CS88_TRURR      QARYSADNLGHFGLAFEHYLHFTSPIRRYPDLVVHRVLRAAL------------------
D2QSQ5_SPILD      KARYSTEDLGHFGLAFKRYSHFTSPIRRYPDMMAHRLLQHYLDK----------------
B3ETS7_AMOA5      KALYTTEAKPHFGLAFEHYTHFTSPIRRYPDLLVHRLLKKYLKG----------------
C7PAC9_CHIPD      KAAYTTDDIGHYGLGFEHYCHFTSPIRRYPDVLVHRVLQQCLSH----------------
D0J9E8_BLASP      KAKYSTKNIGHYGLSFIYYTHFTSPIRRYSDIIAHRLLNYYLTK----------------
D5H9E3_SALRM      KAEYAVGNIGHYGLGFDYYSHFTSPIRRYPDLMVHRLLKRYAKG----------------
RNR_CHLMU         TASYSTENKGHYGLCLDYYTHFTSPIRRYVDLIVHRLLFHPLSV----------------
RNR_CHLTR         TASYSTENKGHYGLCLDYYTHFTSPIRRYVDLIVHRLLFHPLSV----------------
RNR_CHLPN         TASYSTENKGHYGLKLDYYTHFTSPIRRYIDLIVHRLLFNPLSI----------------
D5SPD1_PLAL2      QAEYSPEKIGHYALAVDNYAHFTSPIRRYPDLTIHRLLEHVIADASFTHSVPAAESLNTA
D2R7Z3_PIRSD      KAIYSPAVEGHYALHSEHYCHFTSPIRRYPDLTIHRMLRSLIHG----------------
A7HAA8_ANADF      QAVYATENIGHYGLAAQHYLHFTSPIRRYPDLVVHRLLKEEWARR---------------
Q1D4N8_MYXXD      QAVYTSSRVGHYGLAAEHYLHFTSPIRRYPDLLVHRLLKAHWARK---------------
RNR_BUCAI         QAVYSPDNRGHFGLSLSSYVHFTSPIRRYPDLILHRVIKYLLFKDKNTSKSNYNFY----
RNR_BUCAP         QAVYSPDNRGHFGLSLSSYVHFTSPIRRYPDLLVHRVIKNLLLKEKNLSKY---------
RNR_VIBCH         QAVYNADNAGHFGLALKRYAHFTSPIRRYPDLLLHRAIKYLIAKQEGRNQDRWTPT----
RNR_VIBPA         QAVYNADNAGHFGLALKRYAHFTSPIRRYPDLLLHRAIKYLIAKEEGRNQDRWTPT----
RNR_ECOLI         QAIYDPENRGHFGLALQSYAHFTSPIRRYPDLTLHRAIKYLLAKEQG-HQGNTTET----
RNR_SHIFL         QAIYDPENRGHFGLALQSYAHFTSPIRRYPDLTLHRAIKYLLAKEQG-HQGNTTET----
RNR_HAEIN         QAVYHADNIGHFGLALEEYAHFTSPIRRYPDLTLHRGIKYLLAKEQG-AKRKTTDT----
E6WR29_PSEUU      LAIYSPDNAGHFGLALEAYAHFTSPIRRYPDLLVHRAIKHALKRGKP-------------
Q15PA3_PSEA6      QAEYSPENQGHFGLAYEAYAHFTSPIRRYPDLLTHRAIRATLRSNKSANNASKSESGFKR
A9GZQ2_GLUDA      QAEYSPDNIGHFGLALPAYAHFTSPIRRYADLLVHRALIGMGTQPADGMPAADA------
Q0BU01_GRABC      QAEYNPDNIGHFGLALSRYAHFTSPIRRYADLLVHRALIAGLKLGVGSLEDDEA------
B0T0I6_CAUSK      QAHYSSDNLGHFGLNLARYAHFTSPIRRYADLIVHRALIRALKLGDDGLTDQDI------
C6XL74_HIRBI      QARYAPENFGHFGLNLAKYAHFTSPIRRYSDLIVHRALIRALSLGPDGLSDVES------
Q2RPE7_RHORT      QAEYSPDNIGHFGLALRRYAHFTSPIRRYADLLVHRALIAGLGLGDDGLRPGAE------
Q28VI9_JANSC      QAYYNPENFGHFGLALKSYAHFTSPIRRYADLIVHRALIAAHGWGPDAKIDGLSPD----
A8I2E1_AZOC5      QAEYSSENYGHFGLNLRRYAHFTSPIRRYADLVVHRGLLRTLGADADALPETAT------
E0THA1_PARBH      QAIYSTENLGHFGLSLRRYAHFTSPIRRYADLTIHRALVSARRLGPGGMRAEDE------
D5BRG4_PUNMI      KAVYDINNIGHFGLSLRNYAHFTSPIRRYADLLVHRALVDHAAKGKKAPVDGLLDM----
RNR_HELPY         LALYSPLQESHFGLGFASYTHFTSPIRRYSDLALHRLLKELLFYQAK-------------
RNR_HELPJ         LALYSPMQESHFGLGFASYTHFTSPIRRYSDLALHRLLKELLFHQAK-------------
A9NF96_ACHLI      KAIYSEKPIGHFGLASAYYSHFTSPIRRYPDLLLHRMIRDLMLNNPD-------------
A9G9F9_SORC5      QAVYDVANVGHFGLASSAYLHFTSPIRRYPDITAHRAIRAVLRGERVD------------
D0LU85_HALO1      QAQYSTDPIGHFGLASPFYLHFTSPIRRYADLLVHRQLKHYLHADGKPSGGG--------
D5EIW1_CORAD      QAQYRASPDGHYGLAKQDYTHFTSPIRRYSDLIVHRVFDAYLHKIGAESAPDKP------
                   * *      *:.:    * :******** *   **                        

D4H3I7_DENA2      -------------------------------LSTE-NEQRAENAERDISKFKKLKYLAKH
E4TG32_CALNY      -------------------------------INSSRMEQMAEEAEREIHLYKKLKFLQSH
RNR_AQUAE         -------------------------------NHLSKQERIADEAEMEAIDYLKARYMKGR
B8DP48_DESVM      -------------------------------DTLNTNERVAMEAEREILKRITVLFLSER
C6C1J0_DESAD      -------------------------------SAISGTERTAMEAEREILKRLTIIFLKDK
C7LXJ9_DESBD      -------------------------------EGLNALERKAMEAEREIQKRSAILALEDR
B8IYR8_DESDA      -------------------------------DQINRRERAAMACEREMDRRLGCLALLPR
Q1MQS9_LAWIP      -------------------------------EQCNSHERVAQEAEREITKRLSCLVLQGD
Q6ALZ0_DESPS      -------------------------------DFLSGRERVATKAERELGDRLKCIFMERY
E6W3Z0_DESIS      -----------------------------LAQHSSSQERKAADASTQMELLKSVQFMRTF
C1F8V5_ACIC5      KVAPS------DAGQAQEAAPFDEVELAAIAQETSDTERRAAEAERELVEWKKIKFMRDR
RNR_MYCGE         -----------PDQFTDNERDQLKQELEKIADTVNDTEIKIINCERNANDYLTTLLLSKQ
RNR_MYCPN         -----------PERFTDTEREQLNAELEQICETINDTEIKINGCERTANDYLTTLYLSKQ
RNR_UREPA         -----------SQSYTDKQRVELVNKLKLITEESNKNEIIAVKTERDVNAAKFAEYMNLH
Q7NB22_MYCGA      -----------PQAYTDLQRNELKSHLVEWCDLINKQELVAVDCERDVNAFLYVKYMSNF
RNR_MYCPU         -----------KSNLK-EKKNHFSLILSDVSVQSSKKEVEAVSIERQINDIKKAEYYESK
C5J794_MYCCR      -----------KN----TDITHFNNILAIEASSTTELEQKAFVLERKIVGIKKAEYINKH
A5IXZ7_MYCAP      -----------KKQL--NKVDEFAANLQKIAAMNSASEENAVQLERDVNDLKFAEYFKSK
Q4A6A7_MYCS5      -----------KSSQ--EILNHFDSKLDSYAQLNSNSEQKAIEIERKVNDLKFAEFLKFQ
D1AQ67_SEBTE      -----------FIKEK-EKEEMLSKY-EVISKHISKTERDADRMEEESVKIKLIEYMQDK
Q6F1Q7_MESFL      -----------KDYDQ-KALEMNEAFIKKASVIINETETTSVDCEREVVKACTVEYMSDK
RNR2_LACLA        -----------DHSNH--TKDEWKERLPEIASHSSDMEHRAVVTERIIDAMKKAEYMSER
RNR1_LACLA        -----------KTPAN--ILQKWEDKIPEIAEHSSHRERRAVDAEREVEKMKKAEFMEEH
E6U4I2_ETHHY      -----------KVETE-EILHRYESFVAEAAEQSSEREVNAMQIEWDCDDIYKAEYMLQH
E6UGT4_RUMA7      -----------GMTAE-ECRSRFNKFVYASADRSTETELTAMQTERACDDCYKAEYMMGH
RNR_BACSU         -----------NGKVDEATQEKWAERLPDIAEHTSSMERRAVDAERETDDLKKAEYMLDK
E6SKU1_THEM7      -----------RGTLPAQRAEQLEAILPEIADHCSQQERVAEEAERESVELKKVQFMMDK
RNR_THEMA         -----------NGYFTPEQIEKFSKVLPKIAKHCSRRERVADEAEWDLVAMKKVEYIARH
D7BIB2_MEISD      -----------RRRLTPEKVEHWREVFPRMAEHTSSRERSAEAAERDLTKYYQCCWAELH
D7CS88_TRURR      -----------QNRLSPTLKERLKSDFPALAQHTSERERLAEEAERDLTRYYQAKWAKEH
D2QSQ5_SPILD      -------------GKPADRDEYEEKC-----RHSSEREKMASDAERASIKYKQVEFMSRM
B3ETS7_AMOA5      -------------EFYFEEAIYEKKC-----QHASERERVAADAERASIKYKQVELMQTL
C7PAC9_CHIPD      -------------DIHPDKQ-MEKKC-----KHSSEMERKAMEAERAANKYKQVEYMQQY
D0J9E8_BLASP      -----------KNNKLKSIEFYEEQS-----KHCSEKERLAIDAEREFLKYLQVKYIKKY
D5H9E3_SALRM      -------------GSPADIEDLAARC-----EHCSEQERNAEEAERESVKLKQVEYVKNH
RNR_CHLMU         ----------------------EEGHLEQIVRACSSQERVAAKAEGAFINIKKARFLKKF
RNR_CHLTR         ----------------------EEEHLEQIVRACSSQERIAAKAEGAFVNIKKARFLKKF
RNR_CHLPN         ----------------------DQTHLEIIVRACSTKERVSAKAENSFENLKKTRFINKF
D5SPD1_PLAL2      SDR--------KKSKSSRADLLSEADLRQLGKQCSLTERRAEKAERELIKIRLIRYLADK
D2R7Z3_PIRSD      --------------KKPAADFASQV---LLAEHCSEREQRAQAAERDLIKVKLLGYLSKR
A7HAA8_ANADF      -----------QGQPVR---EPSPAALAEMAAVSSERERAAMEAERDIAAFYAALFMKDK
Q1D4N8_MYXXD      -----------GRKPSQSMLEREEDQLEDMAAQCSERERAAMQVEREVVSFYACLLMKDR
RNR_BUCAI         -----------------SAHLYSTGEIKKIGAHCSITERRADEANRDVIDWLKCDFMYKK
RNR_BUCAP         -------------------HLYNLNEVTKIGLHCSMTERRADEATRDVLDWLKCDFMQKK
RNR_VIBCH         -----------------GGYHYSFDDMDFYGEQCSMTERRADDATREVSDWLKCEYMQDH
RNR_VIBPA         -----------------GGYHYSFDDMDFYGEQCSMTERRADDATREVADWLKCEYMQDH
RNR_ECOLI         -----------------GGYHYSMEEMLQLGQHCSMAERRADEATRDVADWLKCDFMLDQ
RNR_SHIFL         -----------------GGYHYSMEEMLQLGQHCSMAERRADEATRDVADWLKCDFMLDQ
RNR_HAEIN         -----------------GGYHYSFDEMDLLGNHCSMTERRADDATREVADWLKCEYMQDH
E6WR29_PSEUU      -----------------EAYQYSARDMAGLALQCSERERRADEAEREVDERYRAAWMEKH
Q15PA3_PSEA6      LLRQLKLGVSIGKAVPNNASPYTAEEVALLSHHCSGQSRLADTVSREVESALMCKYMQPF
A9GZQ2_GLUDA      ------------------------ACLDEIGEQVSTAERRAALAERETTERYVAAWLADR
Q0BU01_GRABC      ------------------------SRFVDIAEHITATERRAAMAERDAIDRYLAAFMADR
B0T0I6_CAUSK      ------------------------SQIKDTAEVITHAERRAMAAERDATDRYIAAFLSDR
C6XL74_HIRBI      ------------------------KRLEEIAEHLTTTERRSMAAERDATDRYLVAFMSEK
Q2RPE7_RHORT      ------------------------EDFVETAAHITATERRAAQAERDAVNRYTVSFLAAK
Q28VI9_JANSC      ----------------------EIERLEDTAKLISGTERRSMVAERDTSDRYLAAYLSDR
A8I2E1_AZOC5      -----------------------VETLAEISADISATERRAMAAERETVDRLIAHHLAEQ
E0THA1_PARBH      ------------------------AHLADVAEHISVTERRAVAAERATQDRYLASFLEDR
D5BRG4_PUNMI      ----------------------PLEIMGEICTHISETEANAAGAERRSIDRFAAAFFESR
RNR_HELPY         ------------------GCSYLLEETPELCAELNALQKKAALIERDFIKRKFARLALEL
RNR_HELPJ         ------------------GCSYLLEETPELCAELNALQKKAALIERDFIKRKFARLALEF
A9NF96_ACHLI      ------------AETLKKLKKHYRDLMPSYSEHTSNQERQAVNMEREVNKLKSRQYMAQF
A9G9F9_SORC5      ------------------RSEAATERLREAAITASERERKAMEVEREVVDLHRALLMRSR
D0LU85_HALO1      ----------------ARIPAADIDTLAERCAQISTHERRAVEVEREAVSMYRAYFMRGQ
D5EIW1_CORAD      ------------------DAKYSLEKLESISDHLCITERNSIDAERDSVKTKLLEFYERQ
                                                       .                      

D4H3I7_DENA2      VDEPF----GAVVMSVGAFGLNIYIESVMLKGTVSLESIP---GDVYQFMKKEQIVRGRV
E4TG32_CALNY      IDATF----DAFINRLTPNGIFIYLEKFLLTGFIPIENML---DDEYYYLDNQNMFIGKR
RNR_AQUAE         IGEEF----IGIITGVVAFGFFVELEENLVEGLVKINTLT---DDEYVFDEPAHRLVGVR
B8DP48_DESVM      VGEEF----TGVISGIIDFGFFVEFNEVMAEGMVRLSSLD---DDYYGYLPERQELVGER
C6C1J0_DESAD      VGEEF----TGVISSIAEFGFWVEFQEVMAEGMVRLSSLG---DDYYTFWSDRQMIVGER
C7LXJ9_DESBD      IGEEM----RGVVSGVADFGFWVELLDMPVDGLVRLATL----DDFYVFDPERQDLLGQR
B8IYR8_DESDA      VGEHF----SGIVAGVTDFGVFVELEAMPVEGMIRVEDLG---DDWYDFDARLMSLVGQR
Q1MQS9_LAWIP      EGKIF----EAIVTGITDFAFFVELISMPIEGMVRLASLK---DDWFEYNQDRQELLGVR
Q6ALZ0_DESPS      IGETF----KAIISGVTDTGFFVELKDFPISASAPIEELV---EDMYLFDYRGHNLIGQN
E6W3Z0_DESIS      VGEEF----SAIISGVTSWGIFVQLQTCYVEGLVHVSTL---DKDYYLYQEETHELVGRR
C1F8V5_ACIC5      VGEDF----DGLILSATKYGLFVELEDLFIEGLVPIQSLGALDGDRYSYRENTREIIGDG
RNR_MYCGE         IGKTF---SGF-ISAITSFGIFMRMDENNFDGLIKITTIP---DDFFIFEKEKMVLKGRK
RNR_MYCPN         VGQTF---HGF-ISAITSFGIFMRMDENNFDGLIKITSIP---EDFFVFEKDRMVLRGKR
RNR_UREPA         IGKEF---IGV-VTTVSSFGVFVELE-NTIEGLIRIKNLK---DDFYDFIPENMTLVGQK
Q7NB22_MYCGA      LGNWY---HNVTINAITNFGMFVELD-NGIEGLVRLNNIN---GDYYRYDPNTDSLIGRN
RNR_MYCPU         IGKSL---KAQ-IVSILSFGMFVEFEDKVSGLIHISNLLG---ED---FQVSEDGLLISS
C5J794_MYCCR      IGKSF---NAQ-INSILKFGFFVEIEGIFDALVGVKSLPD---NDEDVYNVSEDGFSISN
A5IXZ7_MYCAP      INSEF---EGQ-VFGITKFGMFIQFDNKTDAMVHISNIGD---GDFEANEQMTKLYSKND
Q4A6A7_MYCS5      TGQKF---KAQ-IVSVLNFGIFVEFEFGGSGLIHKSNFFD---GSYEANEMLTVFASET-
D1AQ67_SEBTE      VGEVF---VAR-ISGMNKSKIFMELENHVEVVYNIHSE-----QDDYLYDEENYKMINTH
Q6F1Q7_MESFL      IGNIY---EGT-ISVALKFGIFVQLENMVEGLVHISNL-----EPNIVYDE-TNKILIKH
RNR2_LACLA        IGEVY---TGT-ITGLQKFGIFVALDNTVEGLIRVPNLHTGT-TEELEFDEEASIFKGKK
RNR1_LACLA        VGEEY---EGI-IASVTRFGMFIELENTIEGLVHISTLKG----DYFNYQERMLALIGER
E6U4I2_ETHHY      VGGTF---SGT-ITGVKSYGFYVELENTVEGLVRVETLKG-----WFDYDEKNMQLFCTT
E6UGT4_RUMA7      IGEEY---EGV-IVSVTDFGMFIELDNTCEGLLHLDNMPE-----GYYECDGMMKLKNFS
RNR_BACSU         IGEE----FDGMISSVTNFGMFVELP-NTIEGLVHVSFMT---DDYYRFDEQHFAMIGER
E6SKU1_THEM7      VGET----YRGIISGVTPFGLFVTLP-NLVEGLVHVSTLT---DDYYHYEEKLYSLVGER
RNR_THEMA         IGEV----FNVVVTNITKFGLFVEIPEKSISGLVHISTL----DDYYYYDETRNMLIGKR
D7BIB2_MEISD      KGER----FGGVVSGVTGFGVFVALE-NGVEGMVRLSSLL---DDHYEYVEETLSLVGTR
D7CS88_TRURR      RGEV----FNGLITGVTNFGVFVALP-NGVEGLLHVSQLD---DDYYMYIEEQMMLLGKT
D2QSQ5_SPILD      APDQV---FEGVISGVTEFGIFVEITENSCEGLVRMQDL-S--DDFYEFDKDNYRIIGSR
B3ETS7_AMOA5      QGKR----LKGVISSLMEWGIYVELLDILCEGMIRLSDL-T--DDYYVLDKKGFKLVGER
C7PAC9_CHIPD      IGEE----FDGVVSGVAHFGFWVETVDTKCEGLVSIHSMST--KDEFVYDEQEYSLVGSF
D0J9E8_BLASP      LGKE----FEGIITGFTEWSVYIDLLVFQTEGMIRLRDI-Q--EDFYTLHSNNYSIIGRK
D5H9E3_SALRM      VGEE----FDGVVSGVTKFGVFVEITDLLVEGLVHVREM----NDYYVYDESTYTLRGEN
RNR_CHLMU         LDEQPATLYKAFIITVSPEGLSFVLPELCHEGFIPAAKLP---KKYVIKTKLGLEELPEH
RNR_CHLTR         IEEQPATLYKAFIITASPEGISFVLPEFCHEGFIPAAKLP---QAYVLQTKIGLEELPEH
RNR_CHLPN         LQEQPKTTYHAYIITANHEGLSFVVTEFCHEGFIAAAELP---KEYSLKKNALPESIPDK
D5SPD1_PLAL2      VGLE----LNATITGVERFGLFCQGIELPAEGLVHLSDLP---GDYYDVDQIAHAVIGRR
D2R7Z3_PIRSD      VGSE----MDAVITGVEEFGIFVMGIDLPAEGLIHIQSLE---DDYYKFDSDTHSLTGRR
A7HAA8_ANADF      VGERY----EGVISAVVEFGLFVELKRWFVEGLVRLEDLG----GAPELDTELHALVDRT
Q1D4N8_MYXXD      VGEEF----AATVAAITDFGFFVELDEVHVEGLVKAETLG----PGAKLDKLTHSLVYAN
RNR_BUCAI         IGCIL----NGVISNVTTFGFFVRLNQFFIDGLVHINSLN---DDYYYFDSLGLKLIGKS
RNR_BUCAP         IGDVL----TGVISNVTSFGFFVRLNQFFIDGLVHIATLI---DDYYYFDSIGLKLIGKS
RNR_VIBCH         VGEEL----EGVVANVTSFGFFVRLTELHIDGLVHISTLA---NDYYHYDPIGQRLVGES
RNR_VIBPA         VGDEL----EGVIANVTSFGFFVRLTDLHIDGLVHISTLA---NDYYQFDPIGQRLIGES
RNR_ECOLI         VGNVF----KGVISSVTGFGFFVRLDDLFIDGLVHVSSLD---NDYYRFDQVGQRLMGES
RNR_SHIFL         VGNVF----KGVISSVTGFGFFVRLDDLFIDGLVHVSSLD---NDYYRFDQVGQRLMGES
RNR_HAEIN         VGGEF----SGVISSVTGFGLFVRLDDLFIDGLVHISTLE---NDYYQFDAAKQRLIGEN
E6WR29_PSEUU      VGGQF----DGVVSGVTSFGLFVELDQSKVNGLVHVTQLP---HDYYQFDPIRKMLSGER
Q15PA3_PSEA6      IGDTF----GASISGMNNAGLFVTLENTGAEGLVSMMSLP---GETYTFDAQKQQVTNGQ
A9GZQ2_GLUDA      VGAEF----SGHVSGVTRFGAFVTLTQTGATGLVPVSTLP---DDVWTHDEKTQTLRGRH
Q0BU01_GRABC      VGARF----AARISGVTRFGLFITVEENGASGIVPISSLP---DDFWIHDEREQALIGRN
B0T0I6_CAUSK      VGATF----SGRITGVTRFGLFVKLDETGADGLVPVSTLG---EEYFVHDDRMHALVGER
C6XL74_HIRBI      VGAEF----QGRIAGVTKAGMFVKLDDSGADGFIPAARLS---DEYWLYDEHNAALVAEG
Q2RPE7_RHORT      VGATF----AGRINGVTRAGLFVTLEDTGADGLIPIGSLP---NDYYVHDDAHHCLRGQR
Q28VI9_JANSC      VGAEF----GGRISGIARFGVFVKLDETGADGLLPMRALG---QEYFHFDAEAQTLMGAD
A8I2E1_AZOC5      IGAVF----QGRITGATRAGLFVALDETGADGFVPAASLG---QDYYRFDETRQALVGDR
E0THA1_PARBH      EGNDF----HGRISGVTRAGLFVTLDETGADGFIPMRSLH---TDYYQHDEERNALIGQR
D5BRG4_PUNMI      INETM----DAVIVAITGFGAFLRLDDGKADGFLPLKNLP---DDYYDLDASGQWLEGRH
RNR_HELPY         LEKEF-------------LGVVLEVKDWVVVGLKEFIGLK----------------VLVK
RNR_HELPJ         LEKEF-------------LGVVLEAKDWVVVGLKEFIGLK----------------VLIK
A9NF96_ACHLI      INQSF----DGQIVSMMPSGFFVKLENGIEGLVNVRNVNQ------YLIYDDEALLFYTE
A9G9F9_SORC5      LGDTF----EGTVTGIVGGGVYVNIEDPFVDVLVRMESLG---PDQYEIDDEGLRVIGRR
D0LU85_HALO1      VGEQF----TGRVSAVTNFGAFVELDAPFVEGLIKLDDLG---ADAFGFDASSMRLRGRR
D5EIW1_CORAD      LKKDIKQPFEAVITDIKNHGLYIEITDSMAFGMVHISTLD---DDFYHPSTDGKKLTGRK
                                                                              

D4H3I7_DENA2      TGKMFRAADLIEVMVERIDMDMQEAYFFPAK-----------------------------
E4TG32_CALNY      RKKRLKLGDRISVKLSRVNYDHLEADFFLVELGGK-------------------------
RNR_AQUAE         TGKVFRLGDHVKVRCIAVDEERARVEFELIEKLEKHETL---------------------
B8DP48_DESVM      TGRSFRLGQTVTVRLAEVNVARLEVNLALAGPDAVASTGVRKERRERRDYGGRSGRDARG
C6C1J0_DESAD      TGHAFRLGQKITVRLESVSLELLEANLSLVSGAEDYKKFV--------------------
C7LXJ9_DESBD      TGKTFAMGQTLNVVLEAVSLERVEINFTLP------------------------------
B8IYR8_DESDA      SGVQWRMGQKLEVALSEVHLGRLEIRLMPLELPKGIGGRGARSPRGSRGRGSPAGRAAGG
Q1MQS9_LAWIP      TGKRFYLGQRLTVKVSSVNILRLEIEFELHMMQPTSGENIKKGRTKARNYYRQKEKVRSS
Q6ALZ0_DESPS      KGAFFSLGDSVEVTVQRIDRARNRVIVAPVQ-----------------------------
E6W3Z0_DESIS      TRQRFFLGMPVTVQLVRADVEKRELDFILVS--------------SGSQPEHADTKKTSR
C1F8V5_ACIC5      HGRTFRIGQRVRVLLDRVDAMEKRLQFSILLDEEEATAARKPRGKSAGKSKSAGHSKTGA
RNR_MYCGE         TNKVYKIGDRLEAKLSEIDFIQKRAILTLI------------------------------
RNR_MYCPN         TNKVFRIGDRLTAKLTEIDTVQKRAILTLV------------------------------
RNR_UREPA         RKKIITVGNKVRVRVIEANKLTRKIDFELVAQ----------------------------
Q7NB22_MYCGA      NHKKYQIGDTVDVKLLSADKRLKRIDFAIHEDNKCK------------------------
RNR_MYCPU         NKTKYKLGQEIDVVVVKVDKNLGKVDVVLEKDYQEYLKKEQAFQAFKKNKFTQDKEKQNG
C5J794_MYCCR      SKFEFKLGQIVNVTITEVDTWNGKVSAKINI-----------------------------
A5IXZ7_MYCAP      PKKAYKLGQTVRVVITNADETTGKIDCVLAQDYKTYLRNKVSKNFNQQKGFNKR------
Q4A6A7_MYCS5      --KSYKIGEYVDVVIIATDLLEGKIDCVLESQYDAYKLNLTRKHEKPR---NSK------
D1AQ67_SEBTE      NGLEYTMGNTLKVLVTNASFEKMEIEVIPYKE----------------------------
Q6F1Q7_MESFL      DNTFYRMGQKVKIKVISADIRKRKIDFILVK-----------------------------
RNR2_LACLA        SETVYQIGQEIKIRVIAANKRKGTVDFEQIAPE---------------------------
RNR1_LACLA        SGLTFKIGQPIKIKVVKADRMTGEIDFEYLPSELDLIDKAAKAKKKPDHKGRKKSNQSLK
E6U4I2_ETHHY      NGRRYSIGDAVTVVATRVEVALGQVDFELA------------------------------
E6UGT4_RUMA7      TGEEYRVGERFRVKVLGANVNSGKVDFVPADR----------------------------
RNR_BACSU         TGNVFRIGDEITVKVVDVNKDERNIDFEIVGMKGTPRRPRELDSSRSRKRGK-----PAR
E6SKU1_THEM7      TRRTFRLGDEVEVVVAKVNPEARTIDLVLAELAGELEDYAGR-PSRGGRRGEGAGRGGAR
RNR_THEMA         KGKVFRLGDVLKAKVVRADKIRGEIDFVLVEEDEE-------------------------
D7BIB2_MEISD      TKRRIRIGDPLEVVIQGVNLPTRQIEL--VPAEFAAVRPSNTAKPEISREVSRKPVLATT
D7CS88_TRURR      SKRKFRLGGRLDVRILSANPTVRQIDLGLSSAELPDEEEADEVRPERPPKRLRNPLTDRS
D2QSQ5_SPILD      TKKMYTFGDAVVVRVKETNLARRSMDFALVSDKAGRATDAGSGR-KSGRSDSSRLGGSSS
B3ETS7_AMOA5      TKKVYQLGDLVEVEIKACDISKRTVDLWLVG-----------------------------
C7PAC9_CHIPD      TGRKIRIGDKVRIQVVAANLVKRQLDYDLVEPEGSAPDIFAGGRGRSARKPATDKKTSRA
D0J9E8_BLASP      KRRVYYLGDRIKVKLIDANIEKKQITLGWIKKE---------------------------
D5H9E3_SALRM      NGTSYRPGDSVRVEVASASVEDREIDLLFVE-----------------------------
RNR_CHLMU         ----LLPGIPISVQLASVTLLTQAIEWTLIESKERSSSKK--KKAKAKSNATQVKKKSSS
RNR_CHLTR         ----LRPGAVISVQLASVTLLTQSIEWTLVEATTKAKAKRTSKKKKTESVTTKEKKKSPA
RNR_CHLPN         ----MKPGASIKVTIDSVNLLTQKIVWSIATTTEDKPKK---------------IKKTPS
D5SPD1_PLAL2      SGRVFRLGDPVRVQVSSVDPAKRELNFRIVGRSGQD-DTLSEGEFSRETPGDDRSRSASD
D2R7Z3_PIRSD      AGNRFRLGDVLRVSVAKVDVDRRELDFRFVGRLKSDRTHLSRLPRSGVRMRQDVPDEMQN
A7HAA8_ANADF      TGRAFRVGDEVTVDVVSASPIRRRIELKLV--EEAKAIGKPAAKGRRRREAEPVLAEAGP
Q1D4N8_MYXXD      -GRRVRVGQKLRVRLTSVNVTAKKIDFEALQFDGEAPLSRVATRGEQPQRRQAWTAEAPS
RNR_BUCAI         TKNTYCLGDALKVKVISVNLNEKKIELSLYKSS---------------------------
RNR_BUCAP         SKNTYCLGDTLKVKVISVNLNERKIELSLYMSR---------------------------
RNR_VIBCH         FGAIYRLGDAVKVKVLAVNLDDRQIDFELVETSRKLRGQGKTAKKRADEARAKAQGKKEA
RNR_VIBPA         FGNIYRLGDAVKVKVLAVNLDDKQIDFELVETSRKLRGEGKTAKKRAAEAKRKAKEKKRA
RNR_ECOLI         SGQTYRLGDRVEVRVEAVNMDERKIDFSLISSERAPRNVGKTAREKAKKGDAGKKGGKRR
RNR_SHIFL         SGQTYRLGDRVEVRVEAVNMDERKIDFSLISSERAPRNVGKTAREKAKKGDAGKKGGKRC
RNR_HAEIN         SGMQYRLGDKVRIKVEAVHLENKMVDFSLIGSERKPRRAGKTAKEKAKK-----------
E6WR29_PSEUU      RGLEFRLGDRVRIVVLKASMEDRKIDFRLVDDP---------------------------
Q15PA3_PSEA6      --NTHRIGDHLTVVLKSVDIRARKMSFELA------------------------------
A9GZQ2_GLUDA      GGLALRLGQPVTVRLVEATPVTGGLLFALV------------------------------
Q0BU01_GRABC      SRAVWRLAQSVTVRLAEATPITGGLVFNLLP-----------------------------
B0T0I6_CAUSK      TGKRFPLGLAVEVKLREATPVTGGLLFEMLTEALPNDPK---------------------
C6XL74_HIRBI      SEKRYEMGMPVLVKLEEATPLTGGLLFEMLSEPREARED---------------------
Q2RPE7_RHORT      DGLEFHLGAPVEVLLREANPVSGGLVFGLLQGGVAGAAKGRGFSGKTKGRDG--------
Q28VI9_JANSC      TGTMISIGDRVLVKLAEAVPVTGGLILELLEHDGKAPSRG--------------------
A8I2E1_AZOC5      TGEMHRIGDRVEVKLVEAAPVAGALRFELLS---EGSYLG--------------------
E0THA1_PARBH      SGGHYHLGQRVEVRLLEVTPLQGGLRFEMLSSPEAVETAPAASSAEKAAKKRGATDGARG
D5BRG4_PUNMI      TGWTFGIGTELGVQIAEVNAVSGGILLRWVSGGLSGDRPN--------------------
RNR_HELPY         TNKVFKPLEKVRVTITHADLILGQVRGEITERIKEHVS----------------------
RNR_HELPJ         TNKVFKPLEKVRIKITHADLILGQVRGEITERIKEHVS----------------------
A9NF96_ACHLI      RGKRYRLGDKIRVKLIKVDEVENNIDFTIDPQNHAEDYKAHKTSTSKVKRKPNPADMGKS
A9G9F9_SORC5      SGDRIAIGDAMLVQIEDVAILRRAVYGRRLAGEPTADEPKPRRLRRDAADARPPRRVKIS
D0LU85_HALO1      SGLRLGLGDPVTIEVTNVSVARRRIDFKLISVAGRSSPSGGESSGEDEGTPYWKSRRSRN
D5EIW1_CORAD      SGKTYEVADTIEVVVERVDRFKRQIDFRIVSKQDARYDKRSRNAKSDRKSGKPKTAKSAK
                            .                                                 

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      GRGARPGERSGERSGRPEGRDARTGIRQADSVAAAPAGAGAIDDRAARKARARAATDAGL
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      RKGSSSGWKLVSPGDGESRGRNDKPAKNGKNGKKSGAGKSGHSGQPGGQSARKGKNGTGT
Q1MQS9_LAWIP      NSSFRKRKKKSSSLHQKGQ-----------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      SKAPRARTKKAKSPSAAAAPLPHK----------------------------RKGENRRT
C1F8V5_ACIC5      KKTHAAAASERKAERPARTANPKKSGRKKKRFSADAVPDFAKRVAQPPPRGHKKGKKRKP
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         KINYKK------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        VKSVAPKSTDKSANKSKNGRRADEKFEFDKKKKKSAKKPFYSKAAKGKFTDKKDNGKKFT
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         KRVQSTNTPVSPAPSEEKGEWFTKPKKKKKKRGFQNAP-------KQKRKKKK-------
E6SKU1_THEM7      GAGEAGRTGGRGAEREAREAGRAAGRGKNAARRTAAAPGAGGAAARGGRRRRRAAGAAAG
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      KPSRTKEKNMEGTKKRRVVGPPEGRERRERGPKVTMSRMYFGEWQKTEDETPPQNRRSGG
D7CS88_TRURR      PEDEVRER-VEGRRHRRGRRPEEEREAP-------------GESASAETPTAPAQAPSGV
D2QSQ5_SPILD      TRKVGGSRGKESVAAKGENRRGGRGRR---------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      PKDKKKETSSKKKPASGKKPGSSSRKKS--------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         KKKKAVSKAKKNRGGK--------------------------------------------
RNR_CHLTR         KKKKGATKTKKGSGKN--------------------------------------------
RNR_CHLPN         KKKGTKKRAS--------------------------------------------------
D5SPD1_PLAL2      KSSSSPRR--RSQPRFP------------------------------------GDRSNAS
D2R7Z3_PIRSD      DADFPPRRDEGSRPEFPDRGPPREGGARGGYQGGGSRGKSFGSRSGGGRSSGGGDRSGGS
A7HAA8_ANADF      E-EADARGARAPRRGK----PAPASAPPAAGRRQRSG----------EGHREHGVKQG--
Q1D4N8_MYXXD      HRERDGRRERAGRPGRREREAAAASRGAPSGQYEETGPGRPRGRFSREGRREESAPHRKE
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ATKGACGKSPTKSELKPQVEATRRP---------------DSEGRSKPKKTKAPKKRKDQ
RNR_VIBPA         ATRSSS-KESATARAVPAIEPTKRPEQTDSGRKRKGPKRGDDDSAKKPKVKKAHKKKPHS
RNR_ECOLI         QVGKKVNFEPDSAFRGEKKTKPKAA----------------KKDARKAKKPSAKTQKIAA
RNR_SHIFL         QVGKKVNFEPDSAFRGEKKTKPKAA----------------KKDARKAKKPSAKTQKIAA
RNR_HAEIN         --------------------VFKEL----------------PSKASKKRKSAVKKKDVSK
E6WR29_PSEUU      --------------------------------------------AHDAGLPPLPPRGKPA
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      --------------------------------------GANPAAASGP------------
Q0BU01_GRABC      --------------------------------------GASSSASSRPDSTDRTNTQDRF
B0T0I6_CAUSK      --------------------------------APRPRLGVRARPAVKP-----------R
C6XL74_HIRBI      --------------------------------LVKPKRERRGRNHPPRGNKGSKKRPSNR
Q2RPE7_RHORT      --------------------------------LGKTRLKERGAAAKLKKGARGKPKAAGR
Q28VI9_JANSC      --------------------------------SGRGARKGGGRGRGKPPARRKVSASKAR
A8I2E1_AZOC5      --------------------------------RGKSAK---GRGAERPASKAAKARAGFA
E0THA1_PARBH      RPGQ----------------------------KPRGAKRGKRGAEDRPPKSAAQDKPASS
D5BRG4_PUNMI      ---------------------------------------RNSRMAHKKGENRSSAKAAKR
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      RKTKSKAPKSGKKGFGPKKNR---------------------------------------
A9G9F9_SORC5      KSTKPLKGMKTSKRTQGGKSAKVRKKQR--------------------------------
D0LU85_HALO1      KRPGGRDKDRGKGKNKGKSRSGKRRSRRQ-------------------------------
D5EIW1_CORAD      ALADLRKQRRSDRLKKVRNRNRKR------------------------------------
                                                                              

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      DDPMPTPIPEPLENAPRRARKTSQHGKERVAAEPASDRMDGAAKKADSVFGQAPAKPDQA
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      PAKSGRPVRSGKKTAGKRG-----------------------------------------
Q1MQS9_LAWIP      ------------------------------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      RGGGTQKR----------------------------------------------------
C1F8V5_ACIC5      TASAQQITARPAKFAGKKPGKKR-------------------------------------
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         ------------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        DGRKKPHKRG--------------------------------------------------
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         ------------------------------------------------------------
E6SKU1_THEM7      RDDAGPARSQAR------------------------------------------------
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      RSGQHERAGGERSRSSQAGQPRHEARSSQKPPRYAAKEAPQPQSGNPGERQGKSSRRRRN
D7CS88_TRURR      RKRRVLVFGDVYKK----------------------------------------------
D2QSQ5_SPILD      ------------------------------------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      AKGGFRQKKQSSSP----------KKTRKKPR----------------------------
D2R7Z3_PIRSD      FGSGGKKKKFPGSKPSFGGGGGKGKKGRKKGR----------------------------
A7HAA8_ANADF      ----PRARTG--------------------------------------------------
Q1D4N8_MYXXD      PRFPPRAPEGQEPPRAESPAWPKRRTFIRPERQAPAPVSAETAEPLPPEAPSAPAPWELP
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ARKKSGKVRDKTK-----------------------------------------------
RNR_VIBPA         KPKKTKRTKQDAQ-----------------------------------------------
RNR_ECOLI         ATKAKRAAKKKVAE----------------------------------------------
RNR_SHIFL         ATKAKRAAKKKVAE----------------------------------------------
RNR_HAEIN         KTSRKRK-----------------------------------------------------
E6WR29_PSEUU      KRPKKRY-----------------------------------------------------
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ARRARGTRPR--------------------------------------------------
Q0BU01_GRABC      SSRKRGSPGRSRR-----------------------------------------------
B0T0I6_CAUSK      GGLPKGVR-RGKRR----------------------------------------------
C6XL74_HIRBI      SARSNGSR-SGKKK----------------------------------------------
Q2RPE7_RHORT      DALAGEPVGSGPKKRPPTTTSRRKTR----------------------------------
Q28VI9_JANSC      KTKLRKKQDRSRP-----------------------------------------------
A8I2E1_AZOC5      KRTAGRAPRKGR------------------------------------------------
E0THA1_PARBH      AKRAPATPPRKATKSTKPAAGPPSPGKAPSPGDHAENNGPKIRRRPKKAGPRRSAKPPRS
D5BRG4_PUNMI      SSHRKNKSSRRKSR----------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      ------------------------------------------------------------
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      SRGRGGDAKARTRGDKDPSPVKSGGKERAGDGEKSLAKSPAKSKDSGVAATHAKAGADAV
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      ------------------------------------------------------------
Q1MQS9_LAWIP      ------------------------------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      ------------------------------------------------------------
C1F8V5_ACIC5      ------------------------------------------------------------
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         ------------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        ------------------------------------------------------------
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         ------------------------------------------------------------
E6SKU1_THEM7      ------------------------------------------------------------
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      RWR---------------------------------------------------------
D7CS88_TRURR      ------------------------------------------------------------
D2QSQ5_SPILD      ------------------------------------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      ------------------------------------------------------------
D2R7Z3_PIRSD      ------------------------------------------------------------
A7HAA8_ANADF      GGREQQ-------------GERRGRGGEGRG------------RGGEGR-------GRGG
Q1D4N8_MYXXD      AGEDASRSPHPGFDRIRALASQRQRGPEPRGPSHGRSFQKPKPQGGPGPRFPAPKPGRES
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ------------------------------------------------------------
RNR_VIBPA         ------------------------------------------------------------
RNR_ECOLI         ------------------------------------------------------------
RNR_SHIFL         ------------------------------------------------------------
RNR_HAEIN         ------------------------------------------------------------
E6WR29_PSEUU      ------------------------------------------------------------
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ------------------------------------------------------------
Q0BU01_GRABC      ------------------------------------------------------------
B0T0I6_CAUSK      ------------------------------------------------------------
C6XL74_HIRBI      ------------------------------------------------------------
Q2RPE7_RHORT      ------------------------------------------------------------
Q28VI9_JANSC      ------------------------------------------------------------
A8I2E1_AZOC5      ------------------------------------------------------------
E0THA1_PARBH      ------------------------------------------------------------
D5BRG4_PUNMI      ------------------------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      ------------------------------------------------------------
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      KAGAASDRPVPGTEAAGTTAKRGNAPNAPTRPGNAGTSGPDKPGPDTSGRDKSGRGKATG
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      ------------------------------------------------------------
Q1MQS9_LAWIP      ------------------------------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      ------------------------------------------------------------
C1F8V5_ACIC5      ------------------------------------------------------------
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         ------------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        ------------------------------------------------------------
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         ------------------------------------------------------------
E6SKU1_THEM7      ------------------------------------------------------------
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      ------------------------------------------------------------
D7CS88_TRURR      ------------------------------------------------------------
D2QSQ5_SPILD      ------------------------------------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      ------------------------------------------------------------
D2R7Z3_PIRSD      ------------------------------------------------------------
A7HAA8_ANADF      GEGRGRGGE---------------------------------------------------
Q1D4N8_MYXXD      EDDRAFSMEPPRPPPEAPVEAPPPVPSRAVTETPIPVAPEPVRAEPVRAEPVSVEPPVTP
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ------------------------------------------------------------
RNR_VIBPA         ------------------------------------------------------------
RNR_ECOLI         ------------------------------------------------------------
RNR_SHIFL         ------------------------------------------------------------
RNR_HAEIN         ------------------------------------------------------------
E6WR29_PSEUU      ------------------------------------------------------------
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ------------------------------------------------------------
Q0BU01_GRABC      ------------------------------------------------------------
B0T0I6_CAUSK      ------------------------------------------------------------
C6XL74_HIRBI      ------------------------------------------------------------
Q2RPE7_RHORT      ------------------------------------------------------------
Q28VI9_JANSC      ------------------------------------------------------------
A8I2E1_AZOC5      ------------------------------------------------------------
E0THA1_PARBH      ------------------------------------------------------------
D5BRG4_PUNMI      ------------------------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      ------------------------------------------------------------
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      ------------------------------------------------------------
E4TG32_CALNY      ------------------------------------------------------------
RNR_AQUAE         ------------------------------------------------------------
B8DP48_DESVM      NGSAKGAQSAKGKRASAKAEPAGTESPRAESPRTGAPGPKSPKPAPAKAPKDGKG-----
C6C1J0_DESAD      ------------------------------------------------------------
C7LXJ9_DESBD      ------------------------------------------------------------
B8IYR8_DESDA      ------------------------------------------------------------
Q1MQS9_LAWIP      ------------------------------------------------------------
Q6ALZ0_DESPS      ------------------------------------------------------------
E6W3Z0_DESIS      ------------------------------------------------------------
C1F8V5_ACIC5      ------------------------------------------------------------
RNR_MYCGE         ------------------------------------------------------------
RNR_MYCPN         ------------------------------------------------------------
RNR_UREPA         ------------------------------------------------------------
Q7NB22_MYCGA      ------------------------------------------------------------
RNR_MYCPU         ------------------------------------------------------------
C5J794_MYCCR      ------------------------------------------------------------
A5IXZ7_MYCAP      ------------------------------------------------------------
Q4A6A7_MYCS5      ------------------------------------------------------------
D1AQ67_SEBTE      ------------------------------------------------------------
Q6F1Q7_MESFL      ------------------------------------------------------------
RNR2_LACLA        ------------------------------------------------------------
RNR1_LACLA        ------------------------------------------------------------
E6U4I2_ETHHY      ------------------------------------------------------------
E6UGT4_RUMA7      ------------------------------------------------------------
RNR_BACSU         ------------------------------------------------------------
E6SKU1_THEM7      ------------------------------------------------------------
RNR_THEMA         ------------------------------------------------------------
D7BIB2_MEISD      ------------------------------------------------------------
D7CS88_TRURR      ------------------------------------------------------------
D2QSQ5_SPILD      ------------------------------------------------------------
B3ETS7_AMOA5      ------------------------------------------------------------
C7PAC9_CHIPD      ------------------------------------------------------------
D0J9E8_BLASP      ------------------------------------------------------------
D5H9E3_SALRM      ------------------------------------------------------------
RNR_CHLMU         ------------------------------------------------------------
RNR_CHLTR         ------------------------------------------------------------
RNR_CHLPN         ------------------------------------------------------------
D5SPD1_PLAL2      ------------------------------------------------------------
D2R7Z3_PIRSD      ------------------------------------------------------------
A7HAA8_ANADF      -------------------ARGRRGEGRGR---GGEARGRGGEARGRGPSERAGGAPGKV
Q1D4N8_MYXXD      APEAEAAAPKRKAARKKAVAKATRTPARKKTVAAGSARQAAATKAKKPTAKAKKAAPARA
RNR_BUCAI         ------------------------------------------------------------
RNR_BUCAP         ------------------------------------------------------------
RNR_VIBCH         ------------------------------------------------------------
RNR_VIBPA         ------------------------------------------------------------
RNR_ECOLI         ------------------------------------------------------------
RNR_SHIFL         ------------------------------------------------------------
RNR_HAEIN         ------------------------------------------------------------
E6WR29_PSEUU      ------------------------------------------------------------
Q15PA3_PSEA6      ------------------------------------------------------------
A9GZQ2_GLUDA      ------------------------------------------------------------
Q0BU01_GRABC      ------------------------------------------------------------
B0T0I6_CAUSK      ------------------------------------------------------------
C6XL74_HIRBI      ------------------------------------------------------------
Q2RPE7_RHORT      ------------------------------------------------------------
Q28VI9_JANSC      ------------------------------------------------------------
A8I2E1_AZOC5      ------------------------------------------------------------
E0THA1_PARBH      ------------------------------------------------------------
D5BRG4_PUNMI      ------------------------------------------------------------
RNR_HELPY         ------------------------------------------------------------
RNR_HELPJ         ------------------------------------------------------------
A9NF96_ACHLI      ------------------------------------------------------------
A9G9F9_SORC5      ------------------------------------------------------------
D0LU85_HALO1      ------------------------------------------------------------
D5EIW1_CORAD      ------------------------------------------------------------
                                                                              

D4H3I7_DENA2      --------------------------------------------------
E4TG32_CALNY      --------------------------------------------------
RNR_AQUAE         --------------------------------------------------
B8DP48_DESVM      --------------------------------------------------
C6C1J0_DESAD      --------------------------------------------------
C7LXJ9_DESBD      --------------------------------------------------
B8IYR8_DESDA      --------------------------------------------------
Q1MQS9_LAWIP      --------------------------------------------------
Q6ALZ0_DESPS      --------------------------------------------------
E6W3Z0_DESIS      --------------------------------------------------
C1F8V5_ACIC5      --------------------------------------------------
RNR_MYCGE         --------------------------------------------------
RNR_MYCPN         --------------------------------------------------
RNR_UREPA         --------------------------------------------------
Q7NB22_MYCGA      --------------------------------------------------
RNR_MYCPU         --------------------------------------------------
C5J794_MYCCR      --------------------------------------------------
A5IXZ7_MYCAP      --------------------------------------------------
Q4A6A7_MYCS5      --------------------------------------------------
D1AQ67_SEBTE      --------------------------------------------------
Q6F1Q7_MESFL      --------------------------------------------------
RNR2_LACLA        --------------------------------------------------
RNR1_LACLA        --------------------------------------------------
E6U4I2_ETHHY      --------------------------------------------------
E6UGT4_RUMA7      --------------------------------------------------
RNR_BACSU         --------------------------------------------------
E6SKU1_THEM7      --------------------------------------------------
RNR_THEMA         --------------------------------------------------
D7BIB2_MEISD      --------------------------------------------------
D7CS88_TRURR      --------------------------------------------------
D2QSQ5_SPILD      --------------------------------------------------
B3ETS7_AMOA5      --------------------------------------------------
C7PAC9_CHIPD      --------------------------------------------------
D0J9E8_BLASP      --------------------------------------------------
D5H9E3_SALRM      --------------------------------------------------
RNR_CHLMU         --------------------------------------------------
RNR_CHLTR         --------------------------------------------------
RNR_CHLPN         --------------------------------------------------
D5SPD1_PLAL2      --------------------------------------------------
D2R7Z3_PIRSD      --------------------------------------------------
A7HAA8_ANADF      GSR---------RGPPGRKGGAGKGAAKPSKGAKGRGGGRRRR--GR---
Q1D4N8_MYXXD      AAKATKVAATKSKAKAPSKKAAKPAVARAAKPAKASGAAKKKAPSGRKKR
RNR_BUCAI         --------------------------------------------------
RNR_BUCAP         --------------------------------------------------
RNR_VIBCH         --------------------------------------------------
RNR_VIBPA         --------------------------------------------------
RNR_ECOLI         --------------------------------------------------
RNR_SHIFL         --------------------------------------------------
RNR_HAEIN         --------------------------------------------------
E6WR29_PSEUU      --------------------------------------------------
Q15PA3_PSEA6      --------------------------------------------------
A9GZQ2_GLUDA      --------------------------------------------------
Q0BU01_GRABC      --------------------------------------------------
B0T0I6_CAUSK      --------------------------------------------------
C6XL74_HIRBI      --------------------------------------------------
Q2RPE7_RHORT      --------------------------------------------------
Q28VI9_JANSC      --------------------------------------------------
A8I2E1_AZOC5      --------------------------------------------------
E0THA1_PARBH      --------------------------------------------------
D5BRG4_PUNMI      --------------------------------------------------
RNR_HELPY         --------------------------------------------------
RNR_HELPJ         --------------------------------------------------
A9NF96_ACHLI      --------------------------------------------------
A9G9F9_SORC5      --------------------------------------------------
D0LU85_HALO1      --------------------------------------------------
D5EIW1_CORAD      --------------------------------------------------