CLUSTAL format seed alignment for MF_01896

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SBMC_SERP5            MTVRIEDKSAERVVGVRVVGPYPQTIPQGCQRLMAWQQQHQVPLGKWLVLYWDDPAEVAP
SBMC_YERE8            MAFKIIEKQPQQIVSIRVVGPYHETIPKGFDQLSSLYTQYQIPGKDWLVLYWDNPETNPP
A0A1X0W0B9_9GAMM      ---MILEKPAKTVASYRVIGPYETSVKQGFEQLMPWAQEHKLGEGEWLTIFWDNPNTTAP
A0A0H3FC23_RAHSY      MALLIVERPAKKLVSYRVVGPYQESIHSGFQQLMKWAARHHQPQNEWLTWFHDNPDTTPA
SBMC_KLEP3            MNYSITTLGKKTIAGFHLVGPWDQTVKQGVEQLMMWVENHQVPAREWLAVYYDNPEEVPA
A6TBB4_KLEP7          MNYSITTLGKKTIAGFHLVGPWDHTVKQGFEQLMMWVENHQVPAREWVAVYYDNPEEVPA
SBMC_ENT38            MDYSIKQQQKRKIAGFHMVGPWEQTVKQGFEQLMMWVDGHHIQPLEWVAVYYDNPDEVPA
A0A0H3CQR3_ENTCC      MDYSIRQEKKRKIAGFHLVGPWEHTVKQGFEQLVMWVDGRHIQPLEWVAVYYDNPDEVPA
SBMC_ENTLS            MEYSIRQEQQRVVAGFHMVGPWEQTVKQGFEQLMMWVDGRDIPAKEWLAVYYDNPDEVPA
SBMC_SALTI            MDYEIRQEQKRKIAGFHMVGPWEHTVKQGFEQLMTWVDRQRIVPVEWIAVYYDNPDVVPA
SBMC_SALAR            MDYEIRQEQKRKIAGFHMVGPWEHTVKQGFKQLMMWVDGKQIVPIEWIAVYYDNPDEVPA
SBMC_CITK8            MDYEIRQAEKRNIAGFHMVGPWEKTVKQGFEQLMMWVDGNQVVPLEWIAVYYDNPDEVPA
A0A027ZUD5_ECOLX      MNYEIKQEDKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVFYDNPDETPA
I6EII0_SHIBO          MNYEIKQEDKRTVAGFHLVGPWEQTVQKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPA
Q3Z0H7_SHISS          MNYEITQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDNKNIVPKEWVAVYYDNPDETPA
SBMC_ECOLI            MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPA
SBMC_ESCF3            MDYEIKQEKKRTIAGFHLVGPWEKTVKQGFDQLMMWVENHNIEPLEWVAVYYDNPDEVPA
SBMC_CITRI            MNYEIRQVDKRTVAGFHLVGPWEQTVKQGFEQLMKWVEGRQIVTDEWIAVYFDNPDVVPA
SBMC_CROS8            MDYTIEHVLTRKIAGFHLVGPWEKTVPQGFEQLSLWVDNFHIQPQAWLAVYYDNPQQVAP
SBMC1_DICD3           MDYNVQHVDKRHAAGFHLVGPWEQTVPQGFEQLMKWVDEHAVQPLEWVAVYYGNPQETPP
SBMC_ERWBE            MNVEIVEREESKTAGFHLVGPWEVTAPEGFDKLVAWTSKHNVMG-PWMGVYHGNPRAVPA
SBMC_PANSA            MKTSIVERPAQHWVGYRLQGPWQETVPQGFAQLKDWVARHALQG-EWMAIYYGNPQVVPP
J3HAD5_9GAMM          MKASIVERNPQSWLGYHLQGPWQETVPRGFNQLKSWVSEHKVEG-EWLAIYYGNPQELPP
SBMC_EDWTE            MQVKIESLAAQPLFALRVQGPFAQSLGPGFERLMAWSTRHGLQG-QWMALYYDNPREVAP
SBMC_EDWI9            MQVRIVSLAAQPLFVLRVQGPFAQSLGPGFERLMAWSARHGLRG-QWMALYYDNPREVAP
SBMC_PECCP            MSIRIELAESMEVLSLRVVGPYYEKIPQGFDEILSWAREHHLSIDKSLAFYWDDPSKVEA
SBMC2_DICD3           MTLRFDVAPPKKVHCLRVIGPYYQSVPDGFQKLMAWSQEQQLPWTETLAFYWDDPSETEQ
                          .           :: **:  .   *  .:              :  : .:*     

SBMC_SERP5            ERLRADVVFTVADDFVLPTSGSEGFALQTLPAGQYAIYNVRVSDGDFERVWGDFYQRELP
SBMC_YERE8            AELRADVSLSVADDYVLPPELSDHLQLQVIPAGLYAVYHTRVSDDDYAKAWGELYNQHLP
A0A1X0W0B9_9GAMM      QECRADSSVSVAEDFKVDST-AEGITLQTLPAGTYAAFHTTVDDDNFAQAWTDFFNLHIA
A0A0H3FC23_RAHSY      EALRADPSVCVADNFILDD--AEGLALQTLPGGTYAAYHTTITDGNFEKAWREFYSQLLA
SBMC_KLEP3            EKLRCATVVAVDEDYVIPAN-SEGVILAAVAGGDYACARARVVDYDFATPWMQFFDSLLQ
A6TBB4_KLEP7          EKLRCATAVAVDEDYVIPAN-SEGVILAAIAGGDYACARARVVDYDFATPWMQFFDSLQQ
SBMC_ENT38            EKLRCDTVVTVPDDFVIPAN-SEGVILTEVAAGDYAIATARVENYDFGTPWHSFFNSLLQ
A0A0H3CQR3_ENTCC      EKLRCDTAVTVPDDFVIPEN-SEGVMMTEIAAGDYAVAKARVENYDFATPWYQFFNSLLQ
SBMC_ENTLS            EKLRCDTVVTVEPGFQIPAN-SEGVMLTQVSGGEYAVASARVVNHDFATPWYQFFGSVLA
SBMC_SALTI            EKLRCDTVVSVAENFILPDN-SEGVIVTAIEGGEYATAVARVEDRDFAKPWERFFDVLEQ
SBMC_SALAR            EKLRCDTVVSVAENFVLPDN-SEGVIVTEIEGGEYATAVARVEDHDFATPWYQFFDALLQ
SBMC_CITK8            EKLRCDTVVSVPDNFTIPKN-SEGVILTEIAGGQYATAVARVENHDFATPWYQFFNSLLQ
A0A027ZUD5_ECOLX      EKLRCDIVVTVPNNFTLPEN-SEGVILTEISGGQYAVAVARVVGDDFAKPWYQFFNSLLQ
I6EII0_SHIBO          EKLRCDTVVTVPNNFTLPEN-SEGVILTEISGGQYAVAVARVVGDDFAKPWYQFFNSLLQ
Q3Z0H7_SHISS          EKLRCDTVVTVPNNFTLPEN-SEGVILTEISGGQYAVAVARVVGDDFAKPWYQFFNSLLQ
SBMC_ECOLI            EKLRCDTVVTVPGYFTLPEN-SEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQ
SBMC_ESCF3            EKLRCDTVVTVPENFCLPEN-SEGVNVTEIAGGQYAVTVARVQGHDFGTPWYQFINSLLE
SBMC_CITRI            EKLRCSTVVSVPADFVVPAN-SEGVSLSEIDGGQYATAVARVTDNDFSTPWYQFFNSLAQ
SBMC_CROS8            EKLRADTVVEVPADFTLPEN-SVGVILTDLPGGQYAVARARVENNDFGTPWLAFFTRLHQ
SBMC1_DICD3           EKLEADTVVSVSADFHLPAD-GEGAITTEIAAGQYAIARVRVSNDDFGMSWQAFFAALLG
SBMC_ERWBE            EELKIETVIGVPTDFELPEG-SEGARLSIIPAGTYAMNLVHVNDGDFTKPWYAFFDEWLP
SBMC_PANSA            QELSVETVLTVPADFALAV--GEGIQHGTLAGGHYFHTCTEVQNNDFFSAWNAFFAQLQQ
J3HAD5_9GAMM          EELRVETVITAPEEMIPAA--GDDIEKGLLPGGRYFHARVEVLNNDFFSAWRSLFDSLNA
SBMC_EDWTE            EALRADVALTTATTALPSDGEASGIRWDTLAGGLYALAQVRVIDNDFATPWVALFDQALP
SBMC_EDWI9            DALRADVALTTASVTLPSDGEAYGIRRGALAGGLYALAQVRVTDNDFATPWIALFDQALP
SBMC_PECCP            DELRADVAITCKEMPSTLPE-DVGIRREVIPGGLYAVTHTIVENGDFAKAWDDFYKAI-N
SBMC2_DICD3           DQLRADVALVLPEGTAIGEN-TLGVREETVPGGLFAVLHTIVSNGEFAKAWNELYDLI-A
                              .                    : .* :    . : . ::   *  :      

SBMC_SERP5            ASGYQPVEGVSYEHYLNDCEADGYFDLDIYQTVKKG----
SBMC_YERE8            QSGYRPTEGACYEVYLNDGRADGYFDIDIYQSVEKDQ---
A0A1X0W0B9_9GAMM      NSGYRPDGRACYEEYLNDGRQTGMFEVVLYQSVEKIATIR
A0A0H3FC23_RAHSY      STSYRPDGKACFEHYLSDGSKNGIWEVVFYQSVEKIPAIR
SBMC_KLEP3            STTYRVAPRPCFEIYLNDGNHDGYWDIDMYVPVERVAS--
A6TBB4_KLEP7          STAYRIAPQPCFEVYLNDGNHDGYWDIDMYVPVERVAS--
SBMC_ENT38            DNHYQIAPKPCFERYLNDGNADGYWDIEMFVPVQNKAG--
A0A0H3CQR3_ENTCC      DNKFQMALKPCFERYLNDGNADGYWDIEMFIAVEHKAG--
SBMC_ENTLS            DTAWEMAAKPCFERYLNDGNQDGYWDIEMYIAVSRRAG--
SBMC_SALTI            DSAYQIASAPCFETYLNNGMEDGYWDIEMYIPVQRK----
SBMC_SALAR            DSAYQITSEPCFETYLNNGVEDGYWDIEMYIPVRRK----
SBMC_CITK8            DNHYQIAAKPCFEVYLNNGTEDGYWDIEMYVPVQSK----
A0A027ZUD5_ECOLX      DSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH--
I6EII0_SHIBO          DSAYEMLPKPCFEVYLNNGAEDGDWDIEMYVAVQPKHH--
Q3Z0H7_SHISS          DSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH--
SBMC_ECOLI            DSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH--
SBMC_ESCF3            DSQYQMAHKPCFEVYLNNGAVDGYWDIEMYVPVLPK----
SBMC_CITRI            DNKYEMACKPCFEVYLNDGCTEGYWDIEMYIAVQPLSR--
SBMC_CROS8            DVRYQMAARPCFEIYLNDGKRDGYWDIDMYIPVQTSGE--
SBMC1_DICD3           DGKTIDPARACFEVYLNDGYSDGFWDIDMHIPVQ------
SBMC_ERWBE            DSGYVMAEGPCFDHYLNDGSQSGEWDIELYIPVSKAE---
SBMC_PANSA            RSDWQVDDRPCYEHYLSDGSQSGNWLLNMYIPVRPV----
J3HAD5_9GAMM          LGGWQVDNRPCFEHYLSDGSDSGDWLVDMYIPVRAAD---
SBMC_EDWTE            ASGYRPDGGPCFERYLSDGRASGEWLLELGVPVRKS----
SBMC_EDWI9            ACGYRPDGGPCFERYLSDGRGSGEWLLELGVPVRKN----
SBMC_PECCP            AQGYCPAGDICYESYLCDGS-NGKWDIEIWQSVEAAN---
SBMC2_DICD3           QNGYKPARGICFESYLCDGS-SGNWEIEIWQSVDPNDGAQ
                                .:: ** :    * : : :  .*