CLUSTAL format seed alignment for MF_01898

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GYRB_BACAN       ------------------------MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGST
GYRB_BACSU       ------------------------MEQ---QQNSYDENQIQVLEGLEAVRKRPGMYIGST
GYRB_BACHD       ------------------------MTR---EQQAYDESQIQVLEGLEAVRKRPGMYIGST
GYRB_STAA3       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAC       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAARKRPGMYIGST
GYRB_STAAS       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAU       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAW       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAR       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAM       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAAN       ---------------------MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAES       ---------------------MVNTLSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STAEQ       ---------------------MVNTLSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGST
GYRB_STRPN       --------------------MTEEIKNLQ--AQDYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_STRR6       --------------------MTEEIKNLQ--AQDYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_STRP6       --------------------MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_STRP8       --------------------MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_STRP1       --------------------MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_STRP3       --------------------MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGST
GYRB_CLOAB       ---------------------------MSEKNEIYDESQIQVLEGLEAVRKRPGMYIGST
GYRB_THEMA       -------------------------------MEKYSAESIKVLKGLEPVRMRPGMYIGST
GYRB_ARCFU       ----MSPDQ---------------------TAVEYTAKDIEVLDDLEAVRKRPGMYIGGV
TOP4B_AQUAE      --MKKRQSQ---------------------TPQEYTAEAIKAVSGLEHVRLRPAMYIGDI
GYRB_HALVD       -------------MS---------------QDNEYGAGQIQVLEGLEAVRKRPAMYIGST
GYRB_HALL2       -------------MS---------------QDNEYGAGQIQVLEGLEAVRKRPAMYIGST
GYRB_MYXXA       --MEKTPATGSAVAP---------------PPVEYGTDSITKLEGREAVRKRPGMYIGDT
GYRB_MYCTU       --MAAQKKK---------------------AQDEYGAASITILEGLEAVRKRPGMYIGST
GYRB_MYCTA       --MAAQKKK---------------------AQDEYGAASITILEGLEAVRKRPGMYIGST
GYRB_MYCPA       --MAAQKKK---------------------AQDEYGASAITVLEGLEAVRKRPGMYIGST
GYRB_MYCLE       --MAAQRK----------------------AQDEYGAASITILEGLEAVRKRPGMYVGST
GYRB_MYCSM       --MAAQKNN---------------------APKEYGADSITILEGLEAVRKRPGMYIGST
GYRB_MYCS2       --MAAQKNN---------------------APKEYGADSITILEGLEAVRKRPGMYIGST
GYRB_STRCO       --MADSGNPNENNPSTDTGVNDAVSTSHGDASASYDASAITVLEGLDAVRKRPGMYIGST
GYRBS_STRNV      --MADSGNPNENTPSVATGEN-------GEVTGSYNASAITVLEGLDAVRKRPGMYIGST
GYRBR_STRNV      MTTYDTRTATDTRGSEQPG---------HVGTASYDANAITVLDGLDAVRKRPGMYIGST
GYRB_HELPY       -------------------------------MQNYQSHSIKVLKGLEGVRKRPGMYIGDT
GYRB_HELPJ       -------------------------------MQNYQSHSIKVLKGLEGVRKRPGMYIGDT
GYRB_CAMJE       ------------------------------MQENYGASNIKVLKGLEAVRKRPGMYIGDT
GYRB_MYCAT       -------------------------MSKQEEISKYGAKNIQFLEGLEAVRKRPGMYIGSI
GYRB_MYCHP       -------------------------MDKIEEIHKYNADNIQILEGLEAVRKRPGMYIGSI
GYRB_MYCGE       -------------------------MEENNKANIYDSSSIKVLEGLEAVRKRPGMYIGST
GYRB_MYCPN       -------------------------MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGST
GYRB_MYCGA       --------------------------MNNTKKDQYSSQSIKVLEGLSAVRKRPGMYIGST
GYRB_SPICI       ------------------------------MGDNYNSESIQILEGLEAIRKRPGMYIGAT
GYRB_BORBU       --------------------------------MNYVASNIQVLKGLEAVRKRPGMYIGSV
GYRB_BORHE       --------------------------------MSYVASNIQVLKGLEAVRKRPGMYIGSV
GYRB_TREDE       -----------------------------MTKSNYSANNITVLKGLEAVRKRPGMYIGST
GYRB_TREPA       ------------------------------MGIEYSASSITVLEGLEAVRKRPGMYIGST
GYRB_CHLMU       ---------------------------MDAQEKKYDASAITVLEGLQAVRERPGMYIGDT
GYRB_CHLTR       ---------------------------MDAQEKKYDASAITVLEGLQAVRERPGMYIGDT
GYRB_CHLPN       ---------------------------MDPKEKNYDASAITVLEGLQAVRERPGMYIGDT
GYRB_ECOLI       ------------------------------MSNSYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_SHIFL       ------------------------------MSNSYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_ECO57       ------------------------------MSNSYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_SALTI       ------------------------------MSNSYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_SALTY       ------------------------------MSNSYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_VIBCH       ------------------------------MSNNYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_VIBPA       ------------------------------MSENYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_HAEIN       --------------------------MSETTNDNYGASSIKVLKGLDAVRKRPGMYIGDT
GYRB_PSEAE       ----------------------------MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_PSEPU       ----------------------------MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDT
GYRB_NEIGO       --------------------------MTEQKHEEYGADSIQVLEGLEAVPKRPGMYIGDT
GYRB_BUCAI       ------------------------------MKNIYDSSNIKILRGLDAVRKRPGMYIGDT
GYRB_BUCAP       ------------------------------MIDTYDSSKIKILRGLDAVRKRPGMYIGDT
GYRB_BUCBP       ------------------------------MKNTYTSSNIKILKGLDAVKKRPGMYIGNT
GYRB_CAUVN       -------------------------MTTEEAAAQYGADSIKVLKGLDAVRKRPGMYIGDT
GYRB_CAUVC       -------------------------MTTEEAAAQYGADSIKVLKGLDAVRKRPGMYIGDT
GYRB_RICCN       ----------------------MSEIEEKFNESSYGADSIKVLKGLEAVRKRPGMYIGDV
GYRB_RICFE       ----------------------MSEIEEKFNESSYGADSIKVLKGLEAVRKRPGMYIGDV
GYRB_RICBR       ----------------------MSEFEEKLNESSYGADSIKVLKGLEAVRKRPGMYIGDV
GYRB_RICPR       ----------------------MSVIEEKCNESSYSADSIKVLKGLEAVRKRPGMYIGDV
GYRB_RICTY       ----------------------MSGIEEKCNESSYSADSIKVLKGLEAVRKRPGMYIGDV
                                                   *    *  : . .    **.**:*  

GYRB_BACAN       SG-KGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKM----
GYRB_BACSU       NS-KGLHHLVWEIVDNSIDEALAGYCTDINIQIEKDNSITVVDNGRGIPVGIHEKM----
GYRB_BACHD       SS-RGLHHLVWEIVDNSIDEAMAGFCDEIGVVIEEDNSITVTDNGRGIPVGIHEKM----
GYRB_STAA3       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAC       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAS       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAU       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAW       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAR       SE-RGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAM       SE-RGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAAN       SE-RGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAES       SE-RGLHHLVWEIVDNSIDEALAGYASHIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STAEQ       SE-RGLHHLVWEIVDNSIDEALAGYASHIEVVIEKDNWIKVTDNGRGIPVDIQEKM----
GYRB_STRPN       SK-EGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKT----
GYRB_STRR6       SK-EGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKT----
GYRB_STRP6       AK-EGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKT----
GYRB_STRP8       AK-EGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKT----
GYRB_STRP1       AK-EGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKT----
GYRB_STRP3       AK-EGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQVKT----
GYRB_CLOAB       GT-RGLHHLVYEIVDNSIDEALAGYCSHIKVFIHKDNSVTVSDDGRGMPIGIHHKM----
GYRB_THEMA       GK-RGLHHLVYEVVDNSVDEALAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEE----
GYRB_ARCFU       GV-RGLHHLLWEVVDNAVDEALAGYCDTIKVSLHKDGSASVEDNGRGIPTEMH-EL----
TOP4B_AQUAE      GE-RGLHHLIWEILDNAVDEAVAGYARNISVTIHRDNSVTVEDDGRGIPVDIHPET----
GYRB_HALVD       DS-RGLHHLVYEVVDNSIDEALAGHCDAIEVALHEDGSVSVTDNGRGIPVDTHEQY----
GYRB_HALL2       DS-RGLHHLVYEVVDNSIDEALAGHCDAIEVALHEDGSVSVTDNGRGIPVDTHEQY----
GYRB_MYXXA       MA-YGLHKLVYEVVDNAVDESLAGHCTDIEVVIHVDGSLSVQDNGRGIPVGPHPKFP---
GYRB_MYCTU       GE-RGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHAS-----
GYRB_MYCTA       GE-RGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHAS-----
GYRB_MYCPA       GE-RGLHHLIWEVVDNSVDEAMAGYADRVDVRILDDGSVEVADNGRGIPVAMHAT-----
GYRB_MYCLE       GE-RGLHHLIWEVVDNSVDEAMAGYATQVDVRLFDDGSVEVADNGRGIPVAVHAT-----
GYRB_MYCSM       GE-RGLHHLIWEVVDNAVDEAMAGFATRVDVKIHADGSVEVRDDGRGIPVEMHAT-----
GYRB_MYCS2       GE-RGLHHLIWEVVDNAVDEAMAGFATRVDVKIHADGSVEVRDDGRGIPVEMHAT-----
GYRB_STRCO       GE-RGLHHLVQEVVDNSVDEALAGHADTIDVTILPDGGVRVVDNGRGIPVGIVPSE----
GYRBS_STRNV      GE-RGLHHLVTEVVDNSVDEALAGHADTIDVTILADGGVRVVDNGRGIPVGIVPSE----
GYRBR_STRNV      GE-RGLHHLVQELVDNSVDEALAGVADRIDVTVLADGGVRVVDNGRGIPVGMHPVE----
GYRB_HELPY       NV-GGLHHMVYEVVDNAVDESMAGFCDTINITLTDEGSCIVEDNGRGIPVDIHPTE----
GYRB_HELPJ       NV-GGLHHMVYEVVDNAVDESMAGFCDTINITLTEEGSCIVEDNGRGIPVDIHPTE----
GYRB_CAMJE       NI-GGLHHMIYEVVDNSIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTE----
GYRB_MYCAT       GF-RGLHHLIWEIVDNSVDEAMAGFATNIEVKLHPNNEIEVIDNGRGMPVDIHPTT----
GYRB_MYCHP       GF-KGLHHLLWEIVDNSVDEAMAGFATEIKIKLYPNNVIEVEDNGRGMPTGIHSGT----
GYRB_MYCGE       GE-EGLHHMIWEIVDNSIDEAMGGFASFVKLTLEDNFVTRVEDDGRGIPVDIHPKT----
GYRB_MYCPN       GE-EGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKT----
GYRB_MYCGA       DQ-KGLHHMIWEIIDNSVDEMMAGYGTTVKLTLKDNYLVEVEDDGRGIPVDIHEKT----
GYRB_SPICI       NA-RGLHHLVWEIVDNSIDEVLANFANKIKIILNKDESITVIDNGRGIPIEIHPKT----
GYRB_BORBU       SI-NGLHHLVYEVVDNSIDEALAGFCDRIDVIINLDNTITVIDNGRGIPTDIHEEE----
GYRB_BORHE       SI-NGLHHLVYEVVDNSIDEALAGFCDKIEVVINSDNSVTVNDNGRGIPTDVHEEE----
GYRB_TREDE       GP-DGLHHLVYEVVDNCIDEAMAGFCDKILVVLEPNDIVRVEDNGRGIPVDIHPTE----
GYRB_TREPA       GP-NGLHHLVYEVVDNCIDEAMAGYCDRITVVLEQGNVVRVEDNGRGIPVDVHPHE----
GYRB_CHLMU       GV-TGLHHLVYEVVDNSIDEAMAGFCTEVVVRILEDGGISVSDNGRGIPVQIHEKESAKQ
GYRB_CHLTR       GV-TGLHHLVYEVVDNSIDEAMAGFCTEVVVRILEDGGISISDNGRGIPIQIHEKESAKQ
GYRB_CHLPN       GI-TGLHHLVYEVVDNSIDEAMAGYCSRIDVRILEDGGIVIVDNGRGIPIEVHERESAKQ
GYRB_ECOLI       DDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEE----
GYRB_SHIFL       DDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEE----
GYRB_ECO57       DDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEE----
GYRB_SALTI       DDGTGLHHMVFEVVDNAIDEALAGHCKDIVVTIHADNSVSVTDDGRGIPTGIHPEE----
GYRB_SALTY       DDGTGLHHMVFEVVDNAIDEALAGHCKDIVVTIHADNSVSVTDDGRGIPTGIHPEE----
GYRB_VIBCH       DDGTGLHHMVFEVVDNSIDEALAGYCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEE----
GYRB_VIBPA       DDGTGLHHMVFEVVDNSIDEALAGHCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEE----
GYRB_HAEIN       DDGTGLHHMVFEVVDNAIDEALAGHCSDIIVTIHDDNSVSVQDDGGGIPVDIHPEE----
GYRB_PSEAE       DDGTGLHHMVFEVVDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEE----
GYRB_PSEPU       DDGSGLHHMVFEVVDNSIDEALAGHCDDITVIIHTDESISVRDNGRGIPVDVHKEE----
GYRB_NEIGO       QDGSGLHHMVFEVLDNAIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHPKE----
GYRB_BUCAI       DDGSGLHHMVFEIVDNSIDEALSGYCKEIIVTIHSDNSVSVKDDGRGIPTDIHPEE----
GYRB_BUCAP       DDGSGLHHMVFEIVDNSIDEALAGFCKEIKVVIHSDNSVSIKDDGRGIPTDIHPEE----
GYRB_BUCBP       DDGTGLHHMVFEVVDNSIDEALAGFCKNIIVTIHDDNSISIQDDGRGIPTDIHDEE----
GYRB_CAUVN       DDGSGLHHMVYEVVDNAIDEALAGHATKVQVILNADGSVTVTDDGRGIPVDMHEGE----
GYRB_CAUVC       DDGSGLHHMVYEVVDNAIDEALAGHATKVQVILNADGSVTVTDDGRGIPVDMHEGE----
GYRB_RICCN       GDGSGLHHMIYEVVDNAIDESLAGYCDLVRVTLNKNGSVTVSDNGRGIPVEIHGEE----
GYRB_RICFE       GDGSGLHHMIYEVVDNAIDESLAGYCDLVRVTLNKNGSVTVSDNGRGIPVEIHQEE----
GYRB_RICBR       GDGSGLHHMIYEVVDNAIDEALAGYCDLVRVVLNKNGSVTVSDNGRGIPVEIHEEE----
GYRB_RICPR       GDGSGLHHMIYEVVDNSIDEALAGYCDLVQVTLNKNGSVTVSDNGRGIPVEIHEEE----
GYRB_RICTY       GDGSGLHHMIYEVVDNSIDEALAGYCDLIRVTLNKNGSVTVSDNGRGIPVEIHEEE----
                     ***::: *::**.:** :..    : : :       : *:* *:*           

GYRB_BACAN       --GRPAVEVIMTVLHAGGKFG--GGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHY
GYRB_BACSU       --GRPAVEVIMTVLHAGGKFD--GSGYKVSGGLHGVGASVVNALSTELDVTVHRDGKIHR
GYRB_BACHD       --GRPAVEVIMTVLHAGGKFG--GGGYKVSGGLHGVGASVVNALSTMLEVEVHREGKVHY
GYRB_STAA3       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAC       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAS       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAU       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAW       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAR       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAM       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAAN       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYH
GYRB_STAES       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNGTIYH
GYRB_STAEQ       --GRPAVEVILTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNGTIYH
GYRB_STRPN       --GRPAVETVFTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHY
GYRB_STRR6       --GRPAVETVFTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHY
GYRB_STRP6       --GRPAVETVFTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHY
GYRB_STRP8       --GRPAVETVFTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHY
GYRB_STRP1       --GRPAVETVFTVLHAGGKFG--GGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHY
GYRB_STRP3       --GRPAVETVFTVLHAGGKFG--GGSYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHY
GYRB_CLOAB       --KKPTVEVIMTILHAGGKFG--GGAYRVSGGLHGVGASVVNALSETCEVEVKTEGHIWK
GYRB_THEMA       --GRSALEVVFTVLHAGGKFS--KDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYR
GYRB_ARCFU       --GKSALEIVMTKLHAGGKFS--KKVYRVSGGLHGVGVSVVNALSEWLEVWVKRNGKIYY
TOP4B_AQUAE      --GKPAVEMVFTMLGAGGKFE--KKVYTYSGGLHGVGASVVNALSEWLIVEVYRDGKIYR
GYRB_HALVD       --DRPALEVIMTVLHAGGKFD--NKSYQVSGGLHGVGVSVVNALSSELEVEVKRDGAVWT
GYRB_HALL2       --DRPALEVIMTVLHAGGKFD--NKSYQVSGGLHGVGVSVVNALSSELEVEVKRDGAVWT
GYRB_MYXXA       --GKDTLEVVLTELHAGSKFG--NGAYKVSGGLHGVGVTCVNFLSEWFKVRVHRNGIVYE
GYRB_MYCTU       --GIPTVDVVMTQLHAGGKF--DSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWS
GYRB_MYCTA       --GIPTVDVVMTQLHAGGKF--DSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWS
GYRB_MYCPA       --GAPTVDVVMTQLHAGGKFGGENSGYNVSGGLHGVGVSVVNALSTRLEVNIARDGYEWS
GYRB_MYCLE       --GVPTVDVVMTQLHAGGKFGGKDSGYNVSGGLHGVGVSVVNALSTRVEVDIKRDGYEWS
GYRB_MYCSM       --GMPTIDVVMTQLHAGGKF--DGETYAVSGGLHGVGVSVVNALSTRLEATVLRDGYEWF
GYRB_MYCS2       --GMPTIDVVMTQLHAGGKF--DGETYAVSGGLHGVGVSVVNALSTRLEATVLRDGYEWF
GYRB_STRCO       --GKPAVEVVLTVLHAGGKFG--GGGYAVSGGLHGVGVSVVNALSTRVAVEVKTDGYRWT
GYRBS_STRNV      --GKPAVEVVLTVLHAGGKFG--GGGYSVSGGLHGVGVSVVNALSTKVAVEVKTDGYRWT
GYRBR_STRNV      --KRPAVEVVLTVLHAGGKFG--GGGYGVSGGLHGVGLSVVNALSTRLSAEIWTDGHRWT
GYRB_HELPY       --KIPACTVVLTILHAGGKFD--NDTYKVSGGLHGVGVSVVNALSKRLIMTIKKEGQIYR
GYRB_HELPJ       --KIPACTVVLTILHAGGKFD--NDTYKVSGGLHGVGVSVVNALSKRLIMTIKKEGQIYR
GYRB_CAMJE       --NMPTLTVVLTVLHAGGKFD--KDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYR
GYRB_MYCAT       --KKSAVETILTVLYAGGKFD--STNYKVSGGLHGVGVSVVNALSDSFEVWVKRGGKFYY
GYRB_MYCHP       --KKSAVETILTVLHAGGKFD--GSNYKVSGGLHGVGASVVNALSSEFEVWVKRDGKLHY
GYRB_MYCGE       --NRSTVETVFTVLHAGGKFD--NDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNKKYF
GYRB_MYCPN       --NRSTVETVFTVLHAGGKFD--NDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYF
GYRB_MYCGA       --NKSTVETVLTILHAGGKFD--SDTYSMSGGLHGVGASVVNALSSSFKVWVNRDYKIHY
GYRB_SPICI       --KVSTLETVFTILHAGGKFD--SNTYKISGGLHGVGASVVNALSKYLKVEVRKNNKKYV
GYRB_BORBU       --GISALELVLTKLHSGGKFN--KGTYKVSGGLHGVGISVVNALSSFLEVYVNRDGKIFR
GYRB_BORHE       --GISALELVLTKLHSGGKFN--KGTYKVSGGLHGVGISVVNALSSFLAVIVSRDGKLFK
GYRB_TREDE       --KISALELVLTRLHAGGKFD--KGSYKVSGGLHGVGVSVVNALSVWMEAKVYKDGFEHY
GYRB_TREPA       --GVSALEVVLTKLHAGGKFD--KKSYKVSGGLHGVGVSVVNALSLWVEVTVYRDGAEYY
GYRB_CHLMU       GREISALEVVLTVLHAGGKFD--KDSYKVSGGLHGVGVSCVNALSEKFIANVFKDGQAYS
GYRB_CHLTR       GREISALEVVLTVLHAGGKFD--KDSYKVSGGLHGVGVSCVNALSEKFIAKVFKDGQAYS
GYRB_CHLPN       GREVSALEVVLTVLHAGGKFD--KDSYKVSGGLHGVGVSCVNALSEKLVATVFKDKKCYQ
GYRB_ECOLI       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHR
GYRB_SHIFL       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHR
GYRB_ECO57       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHR
GYRB_SALTI       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSQKLELVIQRDGKIHR
GYRB_SALTY       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSQKLELVIQRDGKIHR
GYRB_VIBCH       --KVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSEKVLLTIYRGGKIHS
GYRB_VIBPA       --KVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSEKVVLTIHRGGHIHT
GYRB_HAEIN       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSDKLQLTIRRQGHVHE
GYRB_PSEAE       --GVSAAEVIMTVLHAGGKFD--DNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWE
GYRB_PSEPU       --GVSAAEVIMTVLHAGGKFD--DNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWE
GYRB_NEIGO       --GRSAAEVIMTVLHAGGKFD--NNSYKISGGLHGVGVSVVNALSDWVTLTIYRDGKEHF
GYRB_BUCAI       --NISAAEVILTVLHSGGKFD--NASYQISGGLHGVGISVVNALSEKLELIIDKNKKKYQ
GYRB_BUCAP       --KISAAEVIMTVLHSGGKFD--NASYKISGGLHGVGISVVNALSEKLELIIYKNKKKYR
GYRB_BUCBP       --GISAAEVIMTVLHAGGKFD--NTSYKVSGGLHGVGVSVVNALSKKLELFIYRDKKIYY
GYRB_CAUVN       --GVSAAEVIMTQLHAGGKFD--QNSYKVSGGLHGVGVSVVNALSDWLELLIHRNGKVHQ
GYRB_CAUVC       --GVSAAEVIMTQLHAGGKFD--QNSYKVSGGLHGVGVSVVNALSDWLELLIHRNGKVHQ
GYRB_RICCN       --GISAAEVIMTQLHAGGKFD--QNAYKVAGGLHGVGVSVVNALSEWLELRIWRNNKEYL
GYRB_RICFE       --GISAAEVIMTQLHAGGKFD--QNSYKVSGGLHGVGVSVVNALSEWLELRIWRNNKEYL
GYRB_RICBR       --GISAAEVIMTQLHAGGKFD--QNSYKVSGGLHGVGVSVVNALSDWLELRIWRNNTEHL
GYRB_RICPR       --GISAAEVIMTQLHAGGKFD--QQSYKISGGLHGVGVSVVNALSEWLELRIWRNNKEYF
GYRB_RICTY       --GISAAEVIMTQLHAGGKFD--QHSYKISGGLHGVGVSVVNALSEWLELRIWRNNKEYF
                      :   ::* * :*.**      *  :******* : ** **      :        

GYRB_BACAN       QKYERGIPVADLKV----IGDTD-------QTGTITRFKPDPEIFQETTVYEFDTLATRM
GYRB_BACSU       QTYKRGVPVTDLEI----IGETD-------HTGTTTHFVPDPEIFSETTEYDYDLLANRV
GYRB_BACHD       QKFHRGVPAADLEV----IGTTD-------RTGTKIHFKPDGDIFTETTVFEYDTLASRL
GYRB_STAA3       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAC       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAS       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAU       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAW       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAR       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAM       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAAN       QAYKKGVPQFDLKE----VGTTD-------KTGTVIRFKADGEIFTETTVYNYETLQQRI
GYRB_STAES       QAYKQGVPQFDLKE----IGDTD-------KTGTAIRFKADKEIFTETTVYNYETLQKRI
GYRB_STAEQ       QAYKQGVPQFDLKE----IGDTD-------KTGTAIRFKADKEIFTETTVYNYETLQKRI
GYRB_STRPN       QEYRRGHVVADLEI----VGDTD-------KTGTTVHFTPDPKIFTETTIFDFDKLNKRI
GYRB_STRR6       QEYRRGHVVADLEI----VGDTD-------KTGTTVHFTPDPKIFTETTIFDFDKLNKRI
GYRB_STRP6       QEFKRGAVVADLEI----IGTTD-------VTGTTVHFTPDPEIFTETTQFDYSVLAKRI
GYRB_STRP8       QEFKRGAVVADLEI----IGTTD-------VTGTTVHFTPDPEIFTETTQFDYSVLAKRI
GYRB_STRP1       QEFKRGAVVADLEV----IGTTD-------VTGTTVHFTPDPEIFTETTQFDYSVLAKRI
GYRB_STRP3       QEFKRGAVVADLEV----IGTTD-------VTGTTVHFTPDPEIFTETTQFDYSVLAKRI
GYRB_CLOAB       QTYHRGKVASPFEK----IGDSD-------EHGTKIYFKPDPEIF-EDTEYDYDTLSQRL
GYRB_THEMA       QRYERG----KPVTPVEVIGETD-------KHGTIVRFKPDPLIFSETE-FDPDILEHRL
GYRB_ARCFU       QKYQRGSRSPEAGHRTEVLGETK-------EHGTTVRFKPDREIFETTE-FKYEIVAQRL
TOP4B_AQUAE      MAFKRG----EVVEPLHVVGETK-------KRGTKVSFKPDPEIFETTE-IKFDIVEKRV
GYRB_HALVD       HRFEVGEPQVEEFERVRDLEPGE-------DTGTTIRFWPDDGIFETTE-FDFKTLENRL
GYRB_HALL2       HRFEVGEPQVEEFERVRDLEPGE-------DTGTTIRFWPDDGIFETTE-FDFKTLENRL
GYRB_MYXXA       QAYAQGVPDTPP----REVGTTD-------KRGTHIAFKPDATVMELVE-FNFETLSQRL
GYRB_MYCTU       QVYEKSEP-LGLKQ----GAPTK-------KTGSTVRFWADPAVFETTE-YDFETVARRL
GYRB_MYCTA       QVYEKSEP-LGLKQ----GAPTK-------KTGSTVRFWADPAVFETTE-YDFETVARRL
GYRB_MYCPA       QYYDHAVP-GTLKQ----GEATK-------RTGTTIRFWADPDIFETTE-YDFETVARRL
GYRB_MYCLE       QFYDKAVP-GILKQ----GEATE-------ATGTTIRFWADPDIFETTK-YDFGTVARRI
GYRB_MYCSM       QYYDRSVP-GKLKQ----GGETK-------ETGTTIRFWADPEIFETTD-YNFETVARRL
GYRB_MYCS2       QYYDRSVP-GKLKQ----GGETK-------ETGTTIRFWADPEIFETTD-YNFETVARRL
GYRB_STRCO       QEYKLGVPTASLAR----HEATE-------ETGTTVTFWADGDIFETTD-YSFETLSRRF
GYRBS_STRNV      QDYKLGVPTRRCAQ----NEATD-------ETGTTVTFWADPDVFETTE-YSFETLSRRF
GYRBR_STRNV      QDYRDGAPTAPLAR----HEATS-------RTGTSLTFWADGDIFETTE-YSFETLARRH
GYRB_HELPY       QEFEKG-IPTSELEIIGKTKSAK-------ESGTTIEFFPDESVMEVVE-FQAGILQKRF
GYRB_HELPJ       QEFEKG-IPISELEIIGKTKSAK-------ESGTTIEFFPDESVMEVVE-FQAGILQKRF
GYRB_CAMJE       QEFSEG-KVISEFGVIGKSK----------KTGTTIEFWPDDQIFEVTE-FDYEILAKRF
GYRB_MYCAT       QKYINGGHPVKPLEVIGEVNKD--------ETGTRIKFHPDYQIMDKVA-FDFGTIIDHA
GYRB_MYCHP       QQFRNGGIPVKPLEVIGNVSEV--------ETGTTIKFHPDYTIMEKEN-FDFDTIIDHS
GYRB_MYCGE       LSFSDGGKVIGDLVQEGNSEK---------EHGTIVEFVPDFSVMEKSD-YKQTVIVSRL
GYRB_MYCPN       LAFHNGGEVIGDLVNEGKCDK---------EHGTKVEFVPDFTVMEKSD-YKQTVIASRL
GYRB_MYCGA       IEFKDGGVPLKPLEIIGTDSK---------KQGTRIQFVPDFSIMEQFE-YDETIIADRI
GYRB_SPICI       MEFHNGGQILTPIKEVGSTSE----------TGTTVTFLPDEKIFKETTIFSFSTIQNRI
GYRB_BORBU       QTFSKGIPTSKVEV----VGESS-------VTGTKVTFLADSEIF-ETLDYNFDVLEKRL
GYRB_BORHE       QTYSRGIPTSEVDI----IGVSS-------ARGTKVTFLADSEIF-ETLEYDFETLSKRL
GYRB_TREDE       AKFEKGSILEPVKK----IGETE-------KSGTVIRWAVDPSIFTETTVYNFEVLATRL
GYRB_TREPA       QKFNVGMPLAPVEK----RGVSE-------KRGTIIRWQADPSIFKETVAYDFDVLLTRL
GYRB_CHLMU       MEFSKGAPLTALQV----LGSTD-------KRGTEILFYPDPTVF-STCVFDRAILMKRL
GYRB_CHLTR       MEFSRGAPLTTLQV----LGPTD-------KRGTEVLFYPDPAIF-STCVFDRAILMKRL
GYRB_CHLPN       MEFSRGIPVTPLQY----VSVSD-------RQGTEIVFYPDPKIF-STCTFDRSILMKRL
GYRB_ECOLI       QIYEHGVPQAPLAVTGET-EKT----------GTMVRFWPSLETFTNVTEFEYEILAKRL
GYRB_SHIFL       QIYEHGVPQAPLAVTGET-EKT----------GTMVRFWPSLETFTNVTEFEYEILAKRL
GYRB_ECO57       QIYEHGVPQAPLAVTGET-EKT----------GTMVRFWPSLETFTNVTEFEYEILAKRL
GYRB_SALTI       QIYEHGVPQAPLAVTGDT-DKT----------GTMVRFWPSHETFTNVTEFEYEILAKRL
GYRB_SALTY       QIYEHGVPQAPLAVTGDT-DKT----------GTMVRFWPSHETFTNVTEFEYEILAKRL
GYRB_VIBCH       QTYHHGVPQAPLAVVGET-ERT----------GTTVRFWPSAQTFTN-IEFHYDILAKRL
GYRB_VIBPA       QTYRHGEPEAPLAVVGDT-DKT----------GTQIRFWPSAETFSN-TEFHYDILAKRL
GYRB_HAEIN       QFYHLGEPQSPLTVIGET-EAT----------GTTVRFWPSSDIFAI-TTFDYKILAKRL
GYRB_PSEAE       QVYHHGVPQFPLREVGET-DGS----------GTEVHFKPSPETFSN-IHFSWDILAKRI
GYRB_PSEPU       QTYVHGVPQAPMAVVGES-ETT----------GTHIHFKPSAETFKN-IHFSWDILAKRI
GYRB_NEIGO       VRFVRGETEEPLKIVGDS-DKK----------GTTVRFLAGTETFGN-IEYSFDILAKRI
GYRB_BUCAI       QIYRHGKPENPLSIIGTT-DTT----------GTYIRFWPSYKTFTNNIKFQYEILSKRL
GYRB_BUCAP       QQYKNGNPESPLCIIGAT-EIT----------GTYIRFWPSYKIFTNKTQFQYEILSKRL
GYRB_BUCBP       QIYKNGYPKNTLSIIGYT-KIT----------GTKIRFWPNLEIFTNVTQFNWEILSKRL
GYRB_CAUVN       MRFERGDAVTSLKVTGDSPVRTEGPKAGETLTGTEVTFFPSKDTFAF-IEFDRKTLEHRL
GYRB_CAUVC       MRFERGDAVTSLKVTGDSPVRTEGPKAGETLTGTEVTFFPSKDTFAF-IEFDRKTLEHRL
GYRB_RICCN       MRFNNGITEAPLAVVKENIDKK----------GTEVTFFPSVETFTN-IEFDFGTIEHRL
GYRB_RICFE       IRFNNGITEAPLAVVNEDINKK----------GTEVTFFPSVETFTN-IEFDFGTIEHRL
GYRB_RICBR       IRFNNGITEAPLAVVKENVDKK----------GTEVTFFPSVETFTN-IEFDFSIIEHRL
GYRB_RICPR       IRFNNGITEAPLSIVKENIDKK----------GTEVTFFPSVGTFTN-IEFDFVTIEHRL
GYRB_RICTY       IRFNNGITEAPLSIVKENIDKK----------GTEVTFFPSVGIFTN-IEFDFVTIEHRL
                   :  .                          *:   :  .   :          :  : 

GYRB_BACAN       RELAFLNRNIKLTIEDKRE-HK-------------------------------QKKE-FH
GYRB_BACSU       RELAFLTKGVNITIEDKREGQE-------------------------------RKNE-YH
GYRB_BACHD       RELAFLNKGLRIKITDMRE-EE-------------------------------KSDE-FH
GYRB_STAA3       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAC       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAS       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAU       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAW       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAR       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAM       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAAN       RELAFLNKGIQITLRDERDEEN-------------------------------VREDSYH
GYRB_STAES       RELAFLNKGIQITLKDEREEE--------------------------------VREDSYH
GYRB_STAEQ       RELAFLNKGIQITLKDEREEE--------------------------------VREDSYH
GYRB_STRPN       QELAFLNRGLQISITDKRQ-GL-------------------------------EQTKHYH
GYRB_STRR6       QELAFLNRGLQISITDKRQ-GL-------------------------------EQTKHYH
GYRB_STRP6       QELAFLNRGLKISITDKRS-GM-------------------------------EQEEHFH
GYRB_STRP8       QELAFLNRGLKISITDKRS-GM-------------------------------EQEEHFH
GYRB_STRP1       QELAFLNRGLKISITDKRS-GM-------------------------------EQEEHFL
GYRB_STRP3       QELAFLNRGLKISITDKRS-GM-------------------------------EQEEHFH
GYRB_CLOAB       RELAFLNKGIKIELTDERH----------------------------------DKNEIFH
GYRB_THEMA       REIAFLVPGLKIEFEDRING----------------------------------EKKTFK
GYRB_ARCFU       KELAYLNRGLKIILFDEREG----------------------------------KEETFH
TOP4B_AQUAE      RELAYLNPEVKFELTDERLG----------------------------------KHLIYK
GYRB_HALVD       RELAFLNSGVEISLSDERTD----------------------------------ESSTFL
GYRB_HALL2       RELAFLNSGVEISLSDERTD----------------------------------ESSTFL
GYRB_MYXXA       RELAFLNAGLHIVVRDERTN----------------------------------KEHDFK
GYRB_MYCTU       QEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAP--KSASERAAESTAPHKVKSRTFH
GYRB_MYCTA       QEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAP--KSASERAAESTAPHKVKSRTFH
GYRB_MYCPA       QEMAFLNKGLTINLTDERVTNEEVVDEVVSDTADAP--KSAQEKAAESAAPHKVKHRTFH
GYRB_MYCLE       QEVAFLNKGLTINLVDERVKQDEVVDDVVSDTAEAPVAMTVEEKSTESSAPHKVRHRTFH
GYRB_MYCSM       QEMAFLNKGLTIELTDERVTAEEVVDDVVKDTAEAP--KTADEKAAEATGPSKVKHRVFH
GYRB_MYCS2       QEMAFLNKGLTIELTDERVTAEEVVDDVVKDTAEAP--KTADEKAAEATGPSKVKHRVFH
GYRB_STRCO       QEMAFLNKGLKINLTDERESAKATAGADEAGEDE----------------KHEVKSVSYH
GYRBS_STRNV      QEMAFLNKGLTLKLTDERESAKAVVGADVAGTDSAE-----------TPGEEPVRSVTYY
GYRBR_STRNV      QEMAFLNGGLTLTLTDERSSARATAAVDEADSDP------------------TAKTVSYR
GYRB_HELPY       KEMAYLNDGLKISFKEEKTQLQ----------------------------------ETYF
GYRB_HELPJ       KEMAYLNDGLKISFKEEKTQLQ----------------------------------ETYF
GYRB_CAMJE       RELAYLNPKITINFKDNRVGKH----------------------------------ESFH
GYRB_MYCAT       KQIAYLNKGLSISC--EDITKN--------------------------------TIRNFC
GYRB_MYCHP       KQIAYLNKGLKITV--ENVEKN--------------------------------IIKVFC
GYRB_MYCGE       QQLAFLNKGIRIDFVDNRKQNP--------------------------------QSFSWK
GYRB_MYCPN       QQLAFLNKGIQIDFVDERRQNP--------------------------------QSFSWK
GYRB_MYCGA       EQLAFLNKGIKFIFNDERTDKK--------------------------------TKQEWL
GYRB_SPICI       KQLVFLNKGLEISLVDLREEDEE-------------------------------KTVLYQ
GYRB_BORBU       KELAFLNDKIYISIEDKRIGKE--------------------------------KSSKFY
GYRB_BORHE       RELAFLNDKIRISIEDRRSGKE--------------------------------KFLEFY
GYRB_TREDE       RELAFLNSKISITMRDERLSTP--------------------------------KEVTFA
GYRB_TREPA       RELAFLNSTVVIQLRDERLATA--------------------------------KQVEFA
GYRB_CHLMU       RELAFLNRGITIIFEDDRDAGF--------------------------------DKVTFF
GYRB_CHLTR       RELAFLNRGVTIVFEDDRDTGF--------------------------------DKVVFF
GYRB_CHLPN       RELAFLNRGITIVFEDDRDVSF--------------------------------DKVTFF
GYRB_ECOLI       RELSFLNSGVSIRLRDKRD----------------------------------GKEDHFH
GYRB_SHIFL       RELSFLNSGVSIRLRDKRD----------------------------------GKEDHFH
GYRB_ECO57       RELSFLNSGVSIRLRDKRD----------------------------------GKEDHFH
GYRB_SALTI       RELSFLNSGVSIRLRDKRD----------------------------------GKEDHFH
GYRB_SALTY       RELSFLNSGVSIRLRDKRD----------------------------------GKEDHFH
GYRB_VIBCH       RELSFLNSGVSIKLTDEREE---------------------------------DKKDHFM
GYRB_VIBPA       RELSFLNSGVSIKLIDEREA---------------------------------DKQDHFM
GYRB_HAEIN       RELSFLNSGVSIRLIDKRD----------------------------------GSEDHFH
GYRB_PSEAE       RELSFLNSGVGILLRDERT----------------------------------GKEELFK
GYRB_PSEPU       RELSFLNSGVGILLKDERS----------------------------------GKEEFFK
GYRB_NEIGO       RELSFLNNGVDIELTDERD----------------------------------GKHESFA
GYRB_BUCAI       RELSFLNSNIAIYLEDNRT----------------------------------SIKNCYH
GYRB_BUCAP       RELSFLNSNILIHLKDNRT----------------------------------NLEEKYH
GYRB_BUCBP       RELSFLNSNVSIYLDDAKK----------------------------------HINENFY
GYRB_CAUVN       RELAFLNSGVTIWFKDHRDVE--------------------------------PWEEKLF
GYRB_CAUVC       RELAFLNSGVTIWFKDHRDVE--------------------------------PWEEKLF
GYRB_RICCN       RELAFLNSGVKILLVDNRFEE--------------------------------VKEVEFY
GYRB_RICFE       RELAFLNSGVKILLVDNRFEE--------------------------------AKEVEFY
GYRB_RICBR       RELAFLNSGVKILLTDNRFEE--------------------------------VKEVEFY
GYRB_RICPR       RELAFLNSGVKILLVDNRFEE--------------------------------VKKVEFY
GYRB_RICTY       RELAFLNSGVKILLIDNRFEE--------------------------------VKKVEFF
                 .:: :*   : :                                                

GYRB_BACAN       YEGGIKSYVEHLNRSKQPIHEEPVYVEGSKD----------GIQVEVSLQYNEGYTNNIY
GYRB_BACSU       YEGGIKSYVEYLNRSKEVVHEEPIYIEGEKD----------GITVEVALQYNDSYTSNIY
GYRB_BACHD       YEGGIASFVEHLNRTRETLHETPIHIEGEKQ----------GVYVEIAVQYNDGFTSNIY
GYRB_STAA3       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAC       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAS       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAU       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAW       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAR       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAM       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAAN       YEGGIKSYVELLNENKEPIHDEPIYIHQSKD----------DIEVEIAIQYNSGYATNLL
GYRB_STAES       YEGGIKSYVDLLNENKEPLHDEPIYIHQSKD----------DIEVEIALQYNSGYATNLL
GYRB_STAEQ       YEGGIKSYVDLLNENKEPLHDEPIYIHQSKD----------DIEVEIALQYNSGYATNLL
GYRB_STRPN       YEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVM
GYRB_STRR6       YEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVM
GYRB_STRP6       YEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVM
GYRB_STRP8       YEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVM
GYRB_STRP1       YEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVM
GYRB_STRP3       YEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVM
GYRB_CLOAB       YEGGLKSFVSYLNRNKEVVFKEPIYVEGSIDS---------NYSVEIALQYNDGYNENIF
GYRB_THEMA       FDGGIVEYVKYLN-RGKKALHDVIHIKRTEKVKTK--NGEDEVIVEIAFQYTDSYSEDIV
GYRB_ARCFU       FEDGIIGLVRSLN-RNRKPLHEPIYIETTK----------DGVSVEVAIQFTDSDVENIQ
TOP4B_AQUAE      FDRGIEELVKYLN-EGKEPLFKDIIRIQGEK---------EGVIVDIAFQYVKDYKERIE
GYRB_HALVD       FEGGIREFVEYLN-ETKTALHDDVIYYDDESEG---------IEVEIAMQATDELQGSIH
GYRB_HALL2       FEGGIREFVEYLN-ETKTALHDDVIYYDDESEG---------IEVEIAMQATDELQGSIH
GYRB_MYXXA       FDGGISSFVEYLN-KSKQTLHDKPISFSTEREG---------VMLDIAMQWNDGYDERIY
GYRB_MYCTU       YPGGLVDFVKHIN-RTKNAIHSSIVDFSGKGTG---------HEVEIAMQWNAGYSESVH
GYRB_MYCTA       YPGGLVDFVKHIN-RTKNAIHSSIVDFSGKGTG---------HEVEIAMQWNAGYSESVH
GYRB_MYCPA       YPGGLVDFVKHIN-RTKNPIHQSIIDFGGKGPG---------HEVEIAMQWNGGYSESVH
GYRB_MYCLE       YPGGLVDFVKHIN-RTKTPIQQSIIDFDGKGAG---------HEVEVAMQWNGGYSESVH
GYRB_MYCSM       YPGGLVDYVKHIN-RTKTPIQQSIIDFDGKGPG---------HEVEIAMQWNAGYSESVH
GYRB_MYCS2       YPGGLVDYVKHIN-RTKTPIQQSIIDFDGKGPG---------HEVEIAMQWNAGYSESVH
GYRB_STRCO       YEGGIVDFVTYLNSRKGELVHPTVIDLEAEDKDK-------SLSLEVAMQWNGGYTEGVY
GYRBS_STRNV      YEGGIVDFVKYLNSRKGDLIHPTVIDIDAEDKER-------MLSVEIAMQWNSQYSEGVY
GYRBR_STRNV      YDGGITDFVVHLNARKGEPAHPSVITIAAEDTER-------LLSAEIALQWNGQYTDSVY
GYRB_HELPY       YEDGLKQFVKDSAK-KELLTPIISFKSM---------DEETRTSIEVALAYADDYNENTL
GYRB_HELPJ       YKDGLKQFVKDSAK-KELLTPIIAFKSM---------DEETRTSIEVALAYADDYNENTL
GYRB_CAMJE       FEGGISQFVTDLNK-KEALTKAIFFSVD---------EED--VNVEVALLYNDTYSENLL
GYRB_MYCAT       FEGGIIDYVSELNRGKKVIIPDIIYAEGTFRDK-TPNAQ--DVIVNVAIQYNETYTSNIV
GYRB_MYCHP       FEGGLIDYVKELNKGKKLIVPEVIYAEGVFNDKNFTNGQ--DVIVEVAMQYNEAYTNSIV
GYRB_MYCGE       YDGGLVEYIHHLNNEKEPLFNEVIADEKTETVKAVNRDENYTVKVEVAFQYNKTYNQSIF
GYRB_MYCPN       YDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIF
GYRB_MYCGA       YEGGIKQYVENLNASKEPIIPQIIYGEKKTKVTLPKRNLEVTMLLEVAFQYTNGYYNSTY
GYRB_SPICI       FNNGIKDYVLELNKTIGTPLNDVFYVEG----------IEDNIVVEFGLQYNDNYSENIF
GYRB_BORBU       FEGGIKSFVDYLTNDSKAFQSEPYYIDGFI----------NDVIVNVGLKWTESYSDNIL
GYRB_BORHE       FEGGIKAFVDYITNNSKNIQNEPYFIEGSC----------DDVIVSVGLKWTEGYSDHIL
GYRB_TREDE       FEGGISQFVSYLNESKQVFPKSPVFIEGEK----------NDILCEVAIQYNDGYNENLL
GYRB_TREPA       FEGGIRHFVSYLNRGKSVVPERPLYIEGSK----------SDVLVEVALQYHDGYTENVQ
GYRB_CHLMU       YEGGIQSFVSYLNQNKESLFPTPIYIQGSKRGDD------GDIEFEAALQWNSGYSELIY
GYRB_CHLTR       YEGGIQSFVSYLNQNKEILFPNPIYMQGSRPGDD------GDIEFEAALQWNSGYSELIY
GYRB_CHLPN       YEGGIQSFVSYLNQNKESLFSEPIYICGTRVGDD------GEIEFEAALQWNSGYSELVY
GYRB_ECOLI       YEGGIKAFVEYLNKNKTPIHPNIFYFSTEK----------DGIGVEVALQWNDGFQENIY
GYRB_SHIFL       YEGGIKAFVEYLNKNKTPIHPNIFYFSTEK----------DGIGVEVALQWNDGFQENIY
GYRB_ECO57       YEGGIKAFVEYLNKNKTPIHPNIFYFSTEK----------DGIGVEVALQWNDGFQENIY
GYRB_SALTI       YEGGIKAFVEYLNKNKTPIHPNIFYFSTEK----------DGIGVEVALQWNDGFQENIY
GYRB_SALTY       YEGGIKAFVEYLNKNKTPIHPNIFYFSTEK----------DGIGVEVALQWNDGFQENIY
GYRB_VIBCH       YEGGIQAFVTHLNRNKTPIHEKVFHFNQERE---------DGISVEVAMQWNDGFQENIY
GYRB_VIBPA       YEGGIQAFVQHLNTNKTPIIEKIFHFDLERE---------DGISVEVAMQWNDGFQENIF
GYRB_HAEIN       YEGGIQAFVEYLNKNKNPIHPKPFYFTAEK----------DGIGVEVALQWNDGVNENVY
GYRB_PSEAE       YEGGLKAFVEYLNTNKTAVN-EVFHFNVQREE--------DGVGVEVALQWNDSFNENLL
GYRB_PSEPU       YEGGLRAFVEYLNTNKTPVNSQVFHFSVQRE---------DGVGVEVALQWNDSFNENLL
GYRB_NEIGO       LSGGVAGFVQYMNRKKTPLHEKIFYAFGEK----------DGMSVECAMQWNDSYQESVQ
GYRB_BUCAI       YKGGIKAFIKFLNAKKTPIHTHIFYFRSTK----------DQIELEIAMQWNNSHQENIL
GYRB_BUCAP       YKGGIKAFIKFLNKNKFPINLNIFYFRCIK----------NQIELEIAIQWNNSHQENIL
GYRB_BUCBP       QQGGLKEFIIYLNKNKKPIHSKIFYFSSKK----------NNVEVEIAMQWNKGFQENIY
GYRB_CAUVN       YEGGIEAFVRHLDKAKTPLLKAPIA-VKGVK---------DKVEIDLALWWNDSYHEQML
GYRB_CAUVC       YEGGIEAFVRHLDKAKTPLLKAPIA-VKGVK---------DKVEIDLALWWNDSYHEQML
GYRB_RICCN       YTGGIEAYVKYIDRAKHAIHPCIVVNTENAE---------SGISLELAMHWNDSYHENIL
GYRB_RICFE       YTGGIEAYVKYIDRAKHAVHPCIVVNTENTE---------SGISLELAMHWNDSYHENIL
GYRB_RICBR       YTGGIEAYVKYLDRAKHAVHSCIVVNADNTE---------SGISLELAMHWNDSYHENIL
GYRB_RICPR       YTGGIEAYVQYIDRAKHAIHPCIVVNTVHVE---------SGISLELALHWNDSYHENIL
GYRB_RICTY       YTGGIEAYVQYIDRAKHAIHPCIVVNTEHVE---------SGISLELAIHWNDSYHENIL
                    *:   :                                    . ..           

GYRB_BACAN       SFTNNIHTYEGGTHEVGFKTALTRVINDYGRK--NSILKDAD-SNLTGEDVREGLTAIVS
GYRB_BACSU       SFTNNINTYEGGTHEAGFKTGLTRVINDYARK--KGLIKEND-PNLSGDDVREGLTAIIS
GYRB_BACHD       SFANNINTHEGGTHESGFKTGLTRVINDYARK--HNLFKESD-PNLTGEDVREGLTAIIS
GYRB_STAA3       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAC       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAS       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAU       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAW       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAR       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEDK-DRLSGEDTREGMTAIIS
GYRB_STAAM       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAAN       TYANNIHTYEGGTHEDGFKRALTRVLNSYGLS--SKIMKEEK-DRLSGEDTREGMTAIIS
GYRB_STAES       TYANNIHTYEGGTHEDGFKRALTRVLNSYGTQ--SKIIKEDK-DRLSGEDTREGLTAVVS
GYRB_STAEQ       TYANNIHTYEGGTHEDGFKRALTRVLNSYGTQ--SKIIKEDK-DRLSGEDTREGLTAVVS
GYRB_STRPN       SFANNIHTHEGGTHEQGFRTALTRVINDYARK--NKLLKDNE-DNLTGEDVREGLTAVIS
GYRB_STRR6       SFANNIHTHEGGTHEQGFRTALTRVINDYARK--NKLLKDNE-DNLTGEDVREGLTAVIS
GYRB_STRP6       SFANNIHTHEGGTHEQGFRAALTRVINDYAKK--NKILKENE-DNLTGEDVREGLTAVIS
GYRB_STRP8       SFANNIHTHEGGTHEQGFRAALTRVINDYAKK--NKILKENE-DNLTGEDVREGLTAVIS
GYRB_STRP1       SFANNIHTHEGGTHEQGFRAALTRVINDYAKK--NKILKENE-DNLTGEDVREGLTAVIS
GYRB_STRP3       SFANNIHTHEGGTHEQGFRAALTRVINDYAKK--NKILKENE-DNLTGEDVREGLTAVIS
GYRB_CLOAB       SFANNIHTIEGGTHLAGFKTALTRVINDYAKK--FGYLKEND-KNLSGEDIREGLTAVVS
GYRB_THEMA       SFANTIKTVDGGTHVTAFKSTLTRLMNEYGKK--HNFLKKDD--SFQGEDVREGLTAVIS
GYRB_ARCFU       AFANNINTSEGGSHVVGFRAGLTRAVNEYGKK--H--LKKFE--PVTGVDIREGLTAVIS
TOP4B_AQUAE      SFVNNIKTVEGGTHVTGFRSGLSKAVIRMAQG--LKLAKELK-KSFTGEDVREGLTAVVA
GYRB_HALVD       AFANNINTREGGTHLTGFKTALTRVVNDYANT--HDMLDDLDGDNLRGEDVREGLTAVIS
GYRB_HALL2       AFANNINTREGGTHLTGFKTALTRVVNDYANS--HDMLDDLDGDNLRGEDVREGLTAVIS
GYRB_MYXXA       TFANNINTHEGGSHLSGFKAALTRTLNSYAEK--GSLWKDLK-ETPTGEDAREGLSAVIS
GYRB_MYCTU       TFANTINTHEGGTHEEGFRSALTSVVNKYAKD--RKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_MYCTA       TFANTINTHEGGTHEEGFRSALTSVVNKYAKD--RKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_MYCPA       TFANTINTHEGGTHEEGFRSALTSVVNKYAKD--KKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_MYCLE       TFANTINTHEGGTHEEGFRSALTSVVNKYAKD--KKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_MYCSM       TFANTINTHEGGTHEEGFRAALTSVVNRYAKD--KKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_MYCS2       TFANTINTHEGGTHEEGFRAALTSVVNRYAKD--KKLLKDKD-PNLTGDDIREGLAAVIS
GYRB_STRCO       SFANIIHTHEGGTHEEGFRAALTSLINKYARD--KKLLREKD-DNLTGDDIREGLTAIIS
GYRBS_STRNV      SFANTIHTHEGGTHEEGFRAAMTGLVNRYARE--KKFLREKD-DNLAGEDIREGLTAIIS
GYRBR_STRNV      SYANAIHTHEGGTHEEGFRTALTTVVNRYARE--KRLLRDKD-ANLSGEDIREGLTAIIS
GYRB_HELPY       SFVNNIKTSEGGTHEAGFKMGLSKAILQYIGN--NIKTKE---SRPISEDIKEGLIAVVS
GYRB_HELPJ       SFVNNIKTSEGGTHEAGFKMGLSKAILQYIDN--NIKTKE---SRPISEDIKEGLIAVVS
GYRB_CAMJE       SFVNNIKTPDGGTHEAGFRMGLTRVISNYIEA--NASAREKD-NKITGDDVREGLIAIVS
GYRB_MYCAT       SYANNIQTGEGGTHEQGFYDALTRIYNKYAED--NKLFKNNN-EKISREDTKDGLVAIIS
GYRB_MYCHP       SYANNIQTIDGGTHEQGFYDALVRIYNNYAET--NKLFKTSS-EKITREDVKEGLVAIIS
GYRB_MYCGE       SFCNNINTTEGGTHVEGFRNALVKIINRFAVE--NKFLKDSD-EKINRDDVCEGLTAIIS
GYRB_MYCPN       SFCNNINTTEGGTHVEGFRNALVKIINRFAVE--NKFLKETD-EKITRDDICEGLTAIIS
GYRB_MYCGA       SFCNNIHTNQGGTHEEGFKNALYKIINRYALE--KKFIKETD-GKISKEDLSEGLTAIIS
GYRB_SPICI       SFCNNINTHEGGTHEEGARLAIVREINNYFKNQINKNNKGNE-DKFTWDDIKEGMTIIIS
GYRB_BORBU       SFVNNINTREGGTHVMGFRSGLTKAMNEAFKNS-KISKKD--IPNLTGDDFKEGLTAVIS
GYRB_BORHE       SFVNNINTREGGTHVAGFKSGFLKAMSEAFRDS-KISKKD--VPSLTLDDFKEGLTAVIS
GYRB_TREDE       SFVNDINTREGGTHLEGFKTALTRVMNDFLKKYPKLVKKMDKEEKLTGEDVRAGLTAIVS
GYRB_TREPA       SFVNDINTREGGTHLEGFKSALTRVANDFLKKSPKLAKKIEREEKLVGEDVRAGLTVVLS
GYRB_CHLMU       SYANNIPTRQGGTHLTGFSTALTRAVNSYIKSH-NLAKSD--KLSLTGEDIREGLVAIVS
GYRB_CHLTR       SYANNIPTRQGGTHLTGFSTALTRAVNSYIKAH-NLSKSD--KLSLTGEDIKEGLVAIVS
GYRB_CHLPN       SYANNIPTRQGGTHLTGFSTALTRVINTYIKAH-NLAKNN--KLALTGEDIREGLTAVIS
GYRB_ECOLI       CFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDK--EGYSKKAK-VSATGDDAREGLIAVVS
GYRB_SHIFL       CFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDK--EGYSKKAK-VSATGDDAREGLIAVVS
GYRB_ECO57       CFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDK--EGYSKKAK-VSATGDDAREGLIAVVS
GYRB_SALTI       CFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDK--EGYSKKAK-VSATGDDAREGLIAVVS
GYRB_SALTY       CFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDK--EGYSKKAK-VSATGDDAREGLIAVVS
GYRB_VIBCH       CFTNNIPQRDGGTHLAGFRGALTRTLNNYMDK--EGFSKKAQ-AATSGDDAREGLTAVVS
GYRB_VIBPA       CFTNNIPQRDGGTHLAGFRAALTRTLNSFMDK--EGFSKKAK-TATSGDDAREGLTAVVS
GYRB_HAEIN       CFTNNIPQRDGGTHLAGFRGALTRSLNSYMEN--EGMLKKEK-VATSGDDAREGLVAIIS
GYRB_PSEAE       CFTNNIPQRDGGTHLAGFRSALTRNLNNYIEA--EGLAKKFK-IATTGDDAREGLTAIIS
GYRB_PSEPU       CFTNNIPQRDGGTHLVGFRSSLTRSLNSYIEQ--EGLAKKNK-VATTGDDAREGLTAIIS
GYRB_NEIGO       CFTNNIPQRDGGTHLTALRQVMTRTINSYIEA--NEVAKKAK-VETAGDDMREGLTCVLS
GYRB_BUCAI       CFTNNIPQKDGGTHLAGFRSGMTRTLNLHIER--EGYNKKNK-TTIIGEDVREGLTAIIS
GYRB_BUCAP       CFTNNIPQKDGGTHLSGFRAGITRTLNLHIER--EGYNKKNK-TIITGEDTREGLTAIIS
GYRB_BUCBP       CYTNNIPQQDGGTHLSGFRSALTRTMNNYLDK--EGYIKKNK-INIIGDDTREGLTAIIS
GYRB_CAUVN       CFTNNIPQRDGGTHLSAFRAALTRIITSYAES--SGILKKEK-VSLGGEDSREGLTCVLS
GYRB_CAUVC       CFTNNIPQRDGGTHLSAFRAALTRIITSYAES--SGILKKEK-VSLGGEDSREGLTCVLS
GYRB_RICCN       CFTNNIRQRDGGTHLSAFKSAITRVITSYLDT--TGLNKKAK-NYFSGEDTREGLCCVLS
GYRB_RICFE       CFTNNIRQRDGGTHLSAFKSAITRVITSYLDT--TGLNKKSK-NDFSGEDTREGLCCVLS
GYRB_RICBR       CFTNNIRQRDGGTHLSAFKSGLTRVITAYLEN--TGLNKKAK-NAFSGEDTREGICCVLS
GYRB_RICPR       CFTNNIRQRDGGTHLSAFKSAITRVITSYLDT--TGLNKKTK-HDFSGEDTREGICCVLS
GYRB_RICTY       CFTNNIRQRDGGTHLSAFKSAITRVITSYLDT--TGLNKKTK-HDFSGEDTREGICCVLS
                  : * *   :**:*  .    :                           *   *:  :::

GYRB_BACAN       IKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVA
GYRB_BACSU       IKHPDPQFEGQTKTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGLMAARARMA
GYRB_BACHD       VKIPDPQFEGQTKTKLGNSEARTITDSLFTEHFSRFLIEHPQVARKLVDKGLMASRAREA
GYRB_STAA3       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAC       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAS       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAU       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAW       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAR       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAM       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAAN       IKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVA
GYRB_STAES       IKHGDPQFEGQTKTKLGNSEVRQVVDRLFSEHFERFLYENPSVGRIIVEKGIMASRARVA
GYRB_STAEQ       IKHGDPQFEGQTKTKLGNSEVRQVVDRLFSEHFERFLYENPSVGRIIVEKGIMASRARVA
GYRB_STRPN       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVA
GYRB_STRR6       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVA
GYRB_STRP6       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIA
GYRB_STRP8       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIA
GYRB_STRP1       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIA
GYRB_STRP3       VKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIA
GYRB_CLOAB       VKLTEPQFEGQTKTKLGNTEVRGIVDSIISERVSTYLEENPQIGKLVIDKALVASRAREA
GYRB_THEMA       VYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANPELVKTILSKIMSTKQAREA
GYRB_ARCFU       VKVPEPQFEGQTKTKLTNSDVKTVVESAVYSGVLRWLEENPAQAETLLNKFILNKKAREA
TOP4B_AQUAE      CKVPNPQFEGQTKTKLGNQNVKQIVESITYDFLTSYFEKKRDVLKAIVEKAIEAALAREA
GYRB_HALVD       IKHPDPQFEGQTKTKLGNSEVRGIVESVTHQQLGTFFEENPDTATAIISKAVEAARARKA
GYRB_HALL2       VKHPDPQFEGQTKTKLGNSEVRGIVESVTHQQLGTFFEENPDTATAIISKAVEAARARKA
GYRB_MYXXA       VKLTNPQFEGQTKTKLGNSEVKGLVEQMVNDQLGSFLEETPMVAKKVVAKIGDACRARLA
GYRB_MYCTU       VKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
GYRB_MYCTA       VKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
GYRB_MYCPA       VKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPADAKVIVNKAVSSAQARIA
GYRB_MYCLE       VKVSEPQFEGQTKTKLGNTEVKSFVQRVCNEQLIHWFEANPVDAKAVVNKAISSAQARIA
GYRB_MYCSM       VKVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAVSSAQARIA
GYRB_MYCS2       VKVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAVSSAQARIA
GYRB_STRCO       VKLAEPQFEGQTKTKLGNTEVKTFVQKVVYEHLTDWLDRNPNEAADIIRKGIQAAHARVA
GYRBS_STRNV      VKLGEPQFEGQTKTKLGNTEAKTFVQKIVHEHLTDWFDRHPNEAADIIRKSIQAATARVA
GYRBR_STRNV      VNVGEPQFEGQTKTKLGNTEVRTLLQKIVHEHLADWFDRNPNEAVDIVRKAVQAATARVA
GYRB_HELPY       LKMSEPLFEGQTKSKLGSSYARALVSKLVYDKIHQFLEENPNEAKIIANKALLAAKAREA
GYRB_HELPJ       LKMSEPLFEGQTKSKLGSSYARALVSKLVYDKIHQFLEENPNEAKIIANKALLAAKAREA
GYRB_CAMJE       VKVPEPQFEGQTKGKLGSTYVRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREA
GYRB_MYCAT       IKHTDPIFEGQTKGKLENKDARIATNKIISEQLERYMAENPSHAKAIIEKCLLTQRSRLA
GYRB_MYCHP       IKHTDPIFEGQTKGKLENKDARIATNKILSDSLERYLNENPEIARAIIEKCLLSQHTRLL
GYRB_MYCGE       IKHPNPQYEGQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTLLAQEARRR
GYRB_MYCPN       IKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRR
GYRB_MYCGA       IKHSEPQYQGQTKDRLGNTEVREFTNSVVSELLERFFLENPEEAAKITAKAVSAMFSRKR
GYRB_SPICI       IRHPEPQYEGQTNQKLLNSEVKKIVSNIVGKGLSSYLLENPEDAKKIIEKISLSLKATIV
GYRB_BORBU       VKVPEPQFEGQTKSKLGNSEIRKIVEVVVYEHLLEIINLNPLEIDTILGKAIKAARAREA
GYRB_BORHE       IKIPEPQFEGQTKGKLGNSYVKKIVETIVHDGLLKVIDDNLLEVDIILNKAIRAARAREA
GYRB_TREDE       VKVPEPQFEGQTKTKLGNSDVRGIVDSFVNEKLTLFFEQNPNEVEKVLEKCVAEAAARIA
GYRB_TREPA       VKIPEPQFEGQTKTKLGNSEVRGIVDSLVGERLTLYFEQNPGVLTKILEKSIAEAQARLA
GYRB_CHLMU       VKVPNPQFEGQTKQKLGNSDVGSVAQQISGEVLTTFFEENPQIAKTIVDKVFVAAQAREA
GYRB_CHLTR       VKVPNPQFEGQTKQKLGNSDVGSVSQQISGEVLTTFFEENPQIAKTIVDKVFVAAQAREA
GYRB_CHLPN       VKVPNPQFEGQTKQKLGNSDVSSVAQQVVGEALTIFFEENPQIARMIVDKVFVAAQAREA
GYRB_ECOLI       VKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREA
GYRB_SHIFL       VKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREA
GYRB_ECO57       VKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREA
GYRB_SALTI       VKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLSEYLLENPSDAKIVVGKIIDAARAREA
GYRB_SALTY       VKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLSEYLLENPSDAKIVVGKIIDAARAREA
GYRB_VIBCH       VKVPDPKFSSQTKDKLVSSEVKSAVESAMNEKLADFLAENPSEAKNVCSKIIDAARAREA
GYRB_VIBPA       VKVPDPKFSSQTKDKLVSSEVKSAVESAMGEKLSEFLVENPSEAKMVCSKIIDAARAREA
GYRB_HAEIN       VKVPDPKFSSQTKDKLVSSEVKSAVESAMNEKMQEYLLENPADAKIIVNQIIMAARAREA
GYRB_PSEAE       VKVPDPKFSSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREA
GYRB_PSEPU       VKVPDPKFSSQTKDKLVSSEVKTAVEQEMNKYFSDFLLENPNEAKAVVGKMIDAARAREA
GYRB_NEIGO       VKLPDPKFSSQTKDKLVSGEIGPVVNEVINQALTDFLEENPNEAKIITGKIVDAARARQA
GYRB_BUCAI       IKIPDPKFSSQTKDKLVSSEARSVIESLINENLIEYLLENPSDSKFIIQKIINAAKVREA
GYRB_BUCAP       IKIPDPKFSSQTKDKLVSSEVKSVIESLINENLIEYLLENPIDAKFIIQKIINSAKIREA
GYRB_BUCBP       IKINDPKFSSQTKNKLVSSEVKSALESLVNEFLMEFLLENPQESKNIVTKIIESSRVRNA
GYRB_CAUVN       VKVPDPKFSSQTKDKLVSSEVRPAVEGLVSEGLSTWFEEHPNEAKAIVTKIAEAAAAREA
GYRB_CAUVC       VKVPDPKFSSQTKDKLVSSEVRPAVEGLVSEGLSTWFEEHPNEAKAIVTKIAEAAAAREA
GYRB_RICCN       VKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPAEAKAIIAKIMEAANAREA
GYRB_RICFE       VKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPAESKAIIAKIMEAANAREA
GYRB_RICBR       VKVPDPKFSSQTKDKLVSSEVRPIVENAVYTKVLEWFEEHPADAKLIINKIMEAANAREA
GYRB_RICPR       VKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPTEAKAIIAKIMEAANAREA
GYRB_RICTY       VKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPIEAKAIIAKIMEAANAREA
                     :* :..**: :* .              .   :         :  :          

GYRB_BACAN       AKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAIL
GYRB_BACSU       AKKARELTRRKSALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAIL
GYRB_BACHD       AKKARELTRRKSALEVSSLPGKLADCSSRDASISEIYIVEGDSAGGSAKQGRDRHFQAIL
GYRB_STAA3       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAC       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAS       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAU       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAW       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAR       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAM       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAAN       AKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAES       AKKAREVTRRKSALDVSSLPGKLADCSSKNPEESEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STAEQ       AKKAREVTRRKSALDVSSLPGKLADCSSKNPEESEIFLVEGDSAGGSTKSGRDSRTQAIL
GYRB_STRPN       AKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_STRR6       AKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_STRP6       AKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_STRP8       AKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_STRP1       AKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_STRP3       AKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAIL
GYRB_CLOAB       AKKAREITRRKSVLESTSLPGKLADCSSKDAEECEIYIVEGDSAGGSAKQGRNRRFQAIL
GYRB_THEMA       AKRAREMVRRKNVLQNTTLPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVL
GYRB_ARCFU       AKRAKELVKRKNELI-TTLPGKLADCSSKNPEERELFIVEGESAGGSAKQARDRRFQAIL
TOP4B_AQUAE      AKKAKELVRRKSPLEEGVLPGKLADCSETDPSKCEIFLVEGDSAGGSAKQARDRRYQAIL
GYRB_HALVD       AKQAEELTRRKSALESTSLPGKLADCQSRDPAESELFIVEGDSAGGSAKQGRDRKFQAIL
GYRB_HALL2       AKQAEELTRRKSALESTSLPGKLADCQSRDPSESELFIVEGDSAGGSAKQGRDRKFQAIL
GYRB_MYXXA       ARKARETVRRKGVLDGGGLPGKLADCQIRDPNESELYIVEGDSAGGSAKQGRDRRNQAIL
GYRB_MYCTU       ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_MYCTA       ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_MYCPA       ARKARELVRRKSATDLGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_MYCLE       ARKARELVRRKSATDLGGLPGKLADCRSTDPRSSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_MYCSM       ARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_MYCS2       ARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAIL
GYRB_STRCO       ARKARDLTRRKGLLESASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAIL
GYRBS_STRNV      ARKARDLTRRKGLLESASLPGKLSDCQSNDPSKCEIFIVEGDSAGGSAKSGRNPQYQAIL
GYRBR_STRNV      ARKARDLTRRKGLLETAALPGKLSDCQSNDPATSEIFIVEGDSAGGSAKAGRNPQYQAIL
GYRB_HELPY       SKKARELTRKKDNLSVGTLPGKLADCQSKDPLESEIFLVEGDSAGGSAKQGRDRVFQAIL
GYRB_HELPJ       SKKARELTRKKDNLSVGTLPGKLADCQSKDPLESEIFLVEGDSAGGSAKQGRDRVFQAIL
GYRB_CAMJE       AKKARELTRKKESLSVGTLPGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAIL
GYRB_MYCAT       ANAAREASRKKEGSEFGNLPGKLADCSSKNAEVRELFIVEGNSAGGSAKMGRDRATQAIL
GYRB_MYCHP       EIKAREASRKGNGLDLGNLPGKLADCSSKNAEIRELFIVEGNSAGGSAKMGRDRSIQAIL
GYRB_MYCGE       SQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAIL
GYRB_MYCPN       SQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAIL
GYRB_MYCGA       SEAALESAR-KSPFESASLPGKLADCTTKDMEISELYIVEGDSAGGSAKSGRDRFYQAIL
GYRB_SPICI       AQRAKEITRRKIVMDSFSLPGKLSDCETKDAKIAELYIVEGDSAGGSAKSGRNRKFQAIL
GYRB_BORBU       ARKARESERKKNAFESLALPGKLADCTSKNPLEREIYIVEGDSAGGSAKMGRNRFFQAIL
GYRB_BORHE       ARKARESERKKSAFESLALPGKLADCASKNPAEREIYIVEGDSAGGSAKMGRDRFSQAIL
GYRB_TREDE       ARRAKEATRRKSGLDSFGLPGKLADCSLKDPESCEVYIVEGDSAGGSAKKGRDSKTQAIL
GYRB_TREPA       ARRAKEAARRKSGMDSFGLPGKLADCSLKDPAKCEVYIVEGDSAGGSAKKGRDSKTQAIL
GYRB_CHLMU       AKRARELTIRKSALDSARLPGKLVDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAIL
GYRB_CHLTR       AKRARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAIL
GYRB_CHLPN       AKKARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAIL
GYRB_ECOLI       ARRAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_SHIFL       ARRAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_ECO57       ARRAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_SALTI       ARRAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_SALTY       ARRAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_VIBCH       ARKAREMTRRKGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAIL
GYRB_VIBPA       ARKAREMTRRKGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAIL
GYRB_HAEIN       ARKAREMTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKVGRDRKTQAIL
GYRB_PSEAE       ARKAREMTRRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAIL
GYRB_PSEPU       ARKAREMTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAIL
GYRB_NEIGO       ARKAREITRRKGLMDGLGLPGKLADCQEKDPALSELYLVEGNSAGGSAMQGRDRKFQAIL
GYRB_BUCAI       ARRAREINKKKSILDLGALPGKLSDCQENDPKFSEIYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_BUCAP       ARRAREINKKKGTLDLGTLPGKLSDCQENDPKLSEIYLVEGDSAGGSAKQGRNRKNQAIL
GYRB_BUCBP       ARRAREMTRKKGTLDLIGLPGKLSDCQERDPALSEIYLVEGDSAGGSAKQARNRKNQAIL
GYRB_CAUVN       ARKARELTRRKSALDITSLPGKLADCSERDPAKSEIFIVEGDSAGGSAKQARNRDNQAVL
GYRB_CAUVC       ARKARELTRRKSALDITSLPGKLADCSERDPAKSEIFIVEGDSAGGSAKQARNRDNQAVL
GYRB_RICCN       ARKARELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAIL
GYRB_RICFE       ARKARELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAIL
GYRB_RICBR       ARKARELTRRKSVLEVSNLPGKLADCHAKDPAVSELFIVEGDSAGGTAKQGRDSKIQAIL
GYRB_RICPR       ARKARELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAIL
GYRB_RICTY       ARKARELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAIL
                    * :            ***** **        *:::***:****::  .*:   **:*

GYRB_BACAN       PLKGKIINVEKARLDKILSNDEVRTIITAIGTNIG-GDFDIEKARYHKVIIMTDADVDGA
GYRB_BACSU       PLRGKILNVEKARLDKILSNNEVRSMITALGTGIG-EDFNLEKARYHKVVIMTDADVDGA
GYRB_BACHD       PLRGKILNVEKARLDKILANNEIRAIITALGTGIG-DDFDIEKARYHKIIIMTDADVDGA
GYRB_STAA3       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAC       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAS       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAU       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAW       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAR       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAM       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAAN       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GDFDLAKARYHKIVIMTDADVDGA
GYRB_STAES       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GEFDISKARYHKIVIMTDADVDGA
GYRB_STAEQ       PLRGKILNVEKARLDRILNNNEIRQMITAFGTGIG-GEFDISKARYHKIVIMTDADVDGA
GYRB_STRPN       PIRGKILNVEKASMDKILANEEIRSLFTAMGTGFG-AEFDVSKARYQKLVLMTDADVDGA
GYRB_STRR6       PIRGKILNVEKASMDKILANEEIRSLFTAMGTGFG-AEFDVSKARYQKLVLMTDADVDGA
GYRB_STRP6       PIRGKILNVEKATMDKILANEEIRSLFTAMGTGFG-ADFDVSKARYQKLVIMTDADVDGA
GYRB_STRP8       PIRGKILNVEKATMDKILANEEIRSLFTAMGTGFG-ADFDVSKARYQKLVIMTDADVDGA
GYRB_STRP1       PIRGKILNVEKATMDKILANEEIRSLFTAMGTGFG-ADFDVSKARYQKLVIMTDADVDGA
GYRB_STRP3       PIRGKILNVEKATMDKILANEEIRSLFTAMGTGFG-ADFDVSKARYQKLVIMTDADVDGA
GYRB_CLOAB       PLRGKIMNVEKQRIDKILNSEEIKAMATAFGGGIG-KDFDVSKLRYHKIIIMTDADVDGA
GYRB_THEMA       PIRGKILNVEKSSLDRLLKNEQISDIIVAVGTGIG-DDFDESKLRYGRIIIMTDADIDGA
GYRB_ARCFU       PIKGKIINVEKAGMARVLKNDEIKAIISAIGAGIG-KDFDITKARYRRIIIMTDADVDGA
TOP4B_AQUAE      PLRGKIINVEKARIDKVLSNDEIKAIVSALGCGIG-EDLDLKKLRYHKIILMTDADVDGS
GYRB_HALVD       PLKGKILNVEKHRLDRILENDEIRALITAIGGGVG-DEFDIEKARYQRLILMTDADVDGA
GYRB_HALL2       PLKGKILNVEKHRLDRILENDEIRALITAIGGGVG-DEFDIEKARYQRLILMTDADVDGA
GYRB_MYXXA       PLRGKILNVEKL-LREMLTSAEIVTLITALGNGIGAEDYDPEKARYHRIFLMTDADVDGS
GYRB_MYCTU       PLRGKIINVEKARIDRVLKNTEVQAIITALGTGIH-DEFDIGKLRYHKIVLMADADVDGQ
GYRB_MYCTA       PLRGKIINVEKARIDRVLKNTEVQAIITALGTGIH-DEFDIGKLRYHKIVLMADADVDGQ
GYRB_MYCPA       PLRGKIINVEKARIDRVLKNTEVQAIITALGTGIH-DEFDITKLRYHKIVLMADADVDGQ
GYRB_MYCLE       PLRGKIINVEKARIDRVLKNTEVQAIITALGTGIH-DEFDISRLRYHKIVLMADADVDGQ
GYRB_MYCSM       PLRGKIINVEKARIDRVLKNTEVQSIITALGTGIH-DEFDISKLRYHKIVLMADADVDGQ
GYRB_MYCS2       PLRGKIINVEKARIDRVLKNTEVQSIITALGTGIH-DEFDISKLRYHKIVLMADADVDGQ
GYRB_STRCO       PIRGKILNVEKARIDRILQNQEIQAMISAFGTGVH-EDFDIEKLRYHKIILMADADVDGQ
GYRBS_STRNV      PIRGKILNVEKARIDKILQNTEVQALISAFGTGVH-EDFDIEKLRYHKIILMADADVDGQ
GYRBR_STRNV      PIRGKILNVEKARIDKVLQNQENQALISAFGTGVH-EDFDIAKLRYHKIILMADADVDGQ
GYRB_HELPY       PLKGKILNVEKSHLSKILKSEEIKNMITAFGCGIQ-ESFDIERLRYHKIIIMTDADVDGS
GYRB_HELPJ       PLKGKILNVEKSHLSKILKSEEIKNMITAFGCGIQ-ESFDIERLRYHKIIIMTDADVDGS
GYRB_CAMJE       PLRGKILNVEKARLDKILKSEQIQNMITAFGCGIG-EDFDLSKLRYHKIIIMTDADVDGS
GYRB_MYCAT       PLRGKIINAEKQDFTSVMSNKEVSSMIHALGTGIT-DEFNINKLKYHKIVIMTDADVDGA
GYRB_MYCHP       PLRGKVINAEKNSFASVLSNKEIATMIHALGTGIN-TEFDINKLKYHKIIIMTDADVDGA
GYRB_MYCGE       PLRGKILNVEKSNFEQIFNNAEISALVMAIGCGIK-PDFELEKLRYSKIVIMTDADVDGA
GYRB_MYCPN       PLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIK-PDFELEKLRYNKIIIMTDADVDGA
GYRB_MYCGA       PLRGKVLNVEKANHEKIFKNEEIRTLITAIGAGVN-PEFSLDKIRYNKIIIMTDADVDGA
GYRB_SPICI       PLRGKILNVEKAKQIKIFENNEINSIITALGAGIK-DNFNDKKLRYQKVIIMTDADVDGA
GYRB_BORBU       PLWGKMLNVEKTREDKVITNDKLIPIIASLGAGVGKT-FDITKLRYHKIIIMADADVDGS
GYRB_BORHE       PLWGKMLNVEKTREDKVITNDKLIPIIASLGAGVGKT-FYIEKLRYHKIIIMADADVDGS
GYRB_TREDE       PLWGKMLNVEKTRLDKVVNNEKLQPIIATLGTGIGKD-FNIEKLRYHKVIIMADADVDGS
GYRB_TREPA       PLWGKMLNVEKTRLDKVLHNEKLQPIIATLGTGVGKD-FDLTRIRYHKVIIMADADVDGS
GYRB_CHLMU       PIRGKILNVEKARLQKIFQNQEIGSIIAALGCGIGTDNFNLSKLRYKRVIIMTDADVDGS
GYRB_CHLTR       PIRGKILNVEKARLQKVFQNQEIGSIIAALGCGIGKDNFNLSKLRYKRIIIMTDADVDGS
GYRB_CHLPN       PIRGKILNVEKARLQKIFQNQEIGTIIAALGCGIGADNFNLSKLRYRRIIIMTDADVDGS
GYRB_ECOLI       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGS
GYRB_SHIFL       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGS
GYRB_ECO57       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGS
GYRB_SALTI       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGS
GYRB_SALTY       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGS
GYRB_VIBCH       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGS
GYRB_VIBPA       PLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGS
GYRB_HAEIN       PLKGKILNVEKARFDKMLSSQEVGTLITALGCGIGRDEYNPDKLRYHHIIIMTDADVDGS
GYRB_PSEAE       PLKGKILNVEKARFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGS
GYRB_PSEPU       PLKGKILNVEKARFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGS
GYRB_NEIGO       PLKGKILNVEKARFEKMLASQEVATLITALGAGIGKEEFNPEKLRYHRIIIMTDADVDGA
GYRB_BUCAI       PLKGKILNVEKSKFDKMILSQEVASLITALGCGIGKNEYNIDKLRYHYIIIMTDADVDGA
GYRB_BUCAP       PLKGKILNVQKTKFDKIILSQELTSLITALGCSITKSEYSLDKLRYNHIIIMTDADVDGA
GYRB_BUCBP       PLKGKILNVEKARYEKMLSSQEVTTLITALGCGIGKNEYNPEKLRYHRIIIMTDADVDGS
GYRB_CAUVN       PLRGKILNVERARFDKMLSSDQIGTLITALGAGIGRDDFNPDKVRYHKIVLMTDADVDGA
GYRB_CAUVC       PLRGKILNVERARFDKMLSSDQIGTLITALGAGIGRDDFNPDKVRYHKIVLMTDADVDGA
GYRB_RICCN       PLRGKILNVERARFDKMLGSDQIGTLITALGISVE-REFSLEKLRYHKVIIMTDADVDGS
GYRB_RICFE       PLRGKILNVERARFDKMLGSDQIGTLITALGTGVDNREFSLEKLRYHKVIIMTDADVDGS
GYRB_RICBR       PLRGKILNVERARFDKMLGSDQIGTLITALGTGVDNREFSLEKLRYHKVIIMTDADVDGS
GYRB_RICPR       PLRGKILNVERARFDKMLGSDQIGTLITALGISVE-REFSLEKLRYHKVIIMTDADVDGS
GYRB_RICTY       PLRGKILNVERARFDKMLSSEQIGTLITALGISVE-REFSLEKLRYHKVIIMTDADVDGS
                 *: **::*.                :  :.* ..        : :*  :.:*:***:** 

GYRB_BACAN       HIRTLLLT----------------------------------------------------
GYRB_BACSU       HIRTLLLT----------------------------------------------------
GYRB_BACHD       HIRTLILT----------------------------------------------------
GYRB_STAA3       HIRTLLLT----------------------------------------------------
GYRB_STAAC       HIRTLLLT----------------------------------------------------
GYRB_STAAS       HIRTLLLT----------------------------------------------------
GYRB_STAAU       HIRTLLLT----------------------------------------------------
GYRB_STAAW       HIRTLLLT----------------------------------------------------
GYRB_STAAR       HIRTLLLT----------------------------------------------------
GYRB_STAAM       HIRTLLLT----------------------------------------------------
GYRB_STAAN       HIRTLLLT----------------------------------------------------
GYRB_STAES       HIRTLLLT----------------------------------------------------
GYRB_STAEQ       HIRTLLLT----------------------------------------------------
GYRB_STRPN       HIRTLLLT----------------------------------------------------
GYRB_STRR6       HIRTLLLT----------------------------------------------------
GYRB_STRP6       HIRTLLLT----------------------------------------------------
GYRB_STRP8       HIRTLLLT----------------------------------------------------
GYRB_STRP1       HIRTLLLT----------------------------------------------------
GYRB_STRP3       HIRTLLLT----------------------------------------------------
GYRB_CLOAB       HIRTLILT----------------------------------------------------
GYRB_THEMA       HIRTLLLT----------------------------------------------------
GYRB_ARCFU       HIRTLLLT----------------------------------------------------
TOP4B_AQUAE      HIRTLLLT----------------------------------------------------
GYRB_HALVD       HIRTLLLT----------------------------------------------------
GYRB_HALL2       HIRTLLLT----------------------------------------------------
GYRB_MYXXA       HIRTLLLTSSSGRCRSSCRRAISTSRSRRSYKVTRNKKDQYVKDEHALNEYLLKIASEHA
GYRB_MYCTU       HISTLLLT----------------------------------------------------
GYRB_MYCTA       HISTLLLT----------------------------------------------------
GYRB_MYCPA       HISTLLLT----------------------------------------------------
GYRB_MYCLE       HISTLLLT----------------------------------------------------
GYRB_MYCSM       HISTLLLT----------------------------------------------------
GYRB_MYCS2       HISTLLLT----------------------------------------------------
GYRB_STRCO       HINTLLLT----------------------------------------------------
GYRBS_STRNV      HINTLLLT----------------------------------------------------
GYRBR_STRNV      HISTLLLT----------------------------------------------------
GYRB_HELPY       HIQTLLMT----------------------------------------------------
GYRB_HELPJ       HIQTLLMT----------------------------------------------------
GYRB_CAMJE       HIQTLLLT----------------------------------------------------
GYRB_MYCAT       HIATLLLT----------------------------------------------------
GYRB_MYCHP       HITTLLLT----------------------------------------------------
GYRB_MYCGE       HIRTLLLT----------------------------------------------------
GYRB_MYCPN       HIRTLLLT----------------------------------------------------
GYRB_MYCGA       HIRILLLT----------------------------------------------------
GYRB_SPICI       HIRILLLT----------------------------------------------------
GYRB_BORBU       HIRTLLLA----------------------------------------------------
GYRB_BORHE       HIRTLLLT----------------------------------------------------
GYRB_TREDE       HIRTLLLT----------------------------------------------------
GYRB_TREPA       HIRTLLLT----------------------------------------------------
GYRB_CHLMU       HIRTLLLT----------------------------------------------------
GYRB_CHLTR       HIRTLLLT----------------------------------------------------
GYRB_CHLPN       HIRTLLLT----------------------------------------------------
GYRB_ECOLI       HIRTLLLT----------------------------------------------------
GYRB_SHIFL       HIRTLLLT----------------------------------------------------
GYRB_ECO57       HIRTLLLT----------------------------------------------------
GYRB_SALTI       HIRTLLLT----------------------------------------------------
GYRB_SALTY       HIRTLLLT----------------------------------------------------
GYRB_VIBCH       HIRTLLLT----------------------------------------------------
GYRB_VIBPA       HIRTLLLT----------------------------------------------------
GYRB_HAEIN       HIRTLLLT----------------------------------------------------
GYRB_PSEAE       HIRTLLLT----------------------------------------------------
GYRB_PSEPU       HIRTLLLT----------------------------------------------------
GYRB_NEIGO       HIRTLLLT----------------------------------------------------
GYRB_BUCAI       HIRTLLLT----------------------------------------------------
GYRB_BUCAP       HIRTLLLT----------------------------------------------------
GYRB_BUCBP       HIRTLLLT----------------------------------------------------
GYRB_CAUVN       HIRTLLLT----------------------------------------------------
GYRB_CAUVC       HIRTLLLT----------------------------------------------------
GYRB_RICCN       HIRTLLLT----------------------------------------------------
GYRB_RICFE       HIRTLLLT----------------------------------------------------
GYRB_RICBR       HIRTLLLT----------------------------------------------------
GYRB_RICPR       HIRALLLT----------------------------------------------------
GYRB_RICTY       HIRTLLLT----------------------------------------------------
                 **  *:::                                                    

GYRB_BACAN       --------FFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYN----------------
GYRB_BACSU       --------FFYRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYN----------------
GYRB_BACHD       --------FFYRYMRPLIEHGYVYIAQPPLYKVQQGKDIQYAYG----------------
GYRB_STAA3       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAC       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAS       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAU       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAW       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAR       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAM       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAAN       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYN----------------
GYRB_STAES       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFN----------------
GYRB_STAEQ       --------FFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFN----------------
GYRB_STRPN       --------LIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQ-----------
GYRB_STRR6       --------LIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQ-----------
GYRB_STRP6       --------LIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQ-----------
GYRB_STRP8       --------LIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQ-----------
GYRB_STRP1       --------LIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQ-----------
GYRB_STRP3       --------LIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQ-----------
GYRB_CLOAB       --------FFYRYMTELISEGHVFIAQPPLYKVTKTRKEYYAYS----------------
GYRB_THEMA       --------LFYRYMRPLIEQGRVYIALPPLYRIKAGREEF-YVYSDQ-------------
GYRB_ARCFU       --------FFYRYMRPLIESGYLYIAQPPLYQIKKGKKSY-YAYSDE-------------
TOP4B_AQUAE      --------FFYRFMPKLVEEGYVYIAEPPLYRVKKGKKEI-YIKDDKEFEHFLLNEIREK
GYRB_HALVD       --------LLYRHMRPLIEAGYVYAAQPPLYRVRY-RGNTYDAMDEAER-----------
GYRB_HALL2       --------LLYRHMRPLIEAGYVYAAQPPLYRVRY-RGNTYDAMDEAER-----------
GYRB_MYXXA       RVLTPGGELGGAELKALLEKVITYEERLEKQAKRR-DARVVDALVQGARL----------
GYRB_MYCTU       --------LLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRER-----------
GYRB_MYCTA       --------LLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRER-----------
GYRB_MYCPA       --------LLFRFMRPLIEHGHVFLAQPPLYKLKWQRSDPEFAYSDRER-----------
GYRB_MYCLE       --------LLFRFMRPLIEHGYVFLAQPPLYKLKWQRMDPEFAYSDSER-----------
GYRB_MYCSM       --------LLFRFMKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRER-----------
GYRB_MYCS2       --------LLFRFMKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRER-----------
GYRB_STRCO       --------FLFRFMRPLVESGHVYLSRPPLYKIKWGRDDFEYAYSDRER-----------
GYRBS_STRNV      --------FLFRFMRPLVEAGHVYLSRPPLYKIKWGRDDFEYAYSDRER-----------
GYRBR_STRNV      --------FLFRFMRPLVEEGHVHLSRPPLYKIKWSREHVEYAYSDRER-----------
GYRB_HELPY       --------FFYRYLRPLIEQGHVYIAQAPLYKYKKGKTEI-YLKDSVAL-----------
GYRB_HELPJ       --------FFYRYLRPLIEQGHVFIAQAPLYKYKKGKTEI-YLKDSVAL-----------
GYRB_CAMJE       --------FFFRFMNELVANGHIYLAQPPLYLYKKAKKQI-YLKDEKAL-----------
GYRB_MYCAT       --------FFYRYMRPLIEYGFVYIAQPPLYKISTAKVTE-YAYNDAQK-----------
GYRB_MYCHP       --------FFYRYMKPLIEYGFVYLAQPPLYKITSGKNVE-YAYNDLQK-----------
GYRB_MYCGE       --------FFFRFMYPLVEQGNIFIAQPPLYKVSYSHKDL-YMHTDVQL-----------
GYRB_MYCPN       --------FFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDL-YMQTDVQL-----------
GYRB_MYCGA       --------FFFRHMFPLIEKGHVYIAQPPLYRVSYNKQNK-YIYSDAQL-----------
GYRB_SPICI       --------FFYRYMKDLIENGNIYIAQPPLYKVENSNQIR-YVYSDNEL-----------
GYRB_BORBU       --------FFFRYMRDLIENGYIYIAMPPLYKIKYDNRIYYFYEEKEK------------
GYRB_BORHE       --------FFFRYMRELIENGHVYIAMPPLYKLKYENREHYFYDDLEK------------
GYRB_TREDE       --------FFFRYMPQVIEKGHVYLAMPPLYKISHNKKEWYVYNDDER------------
GYRB_TREPA       --------FFFRYLPQIIEAGYVYLAMPPLYRIAWSKKELYVYSDTER------------
GYRB_CHLMU       --------FFYRHMSALIENGCVYIAQPPLYRVSKKKDFRYILSEKEM------------
GYRB_CHLTR       --------FFYRHMSALIENECVYIAQPPLYRVSKKKDFRYILSEKEM------------
GYRB_CHLPN       --------FFYRHMTALIENECVYIAQPPLYKVSKKKDFRYILSEKEM------------
GYRB_ECOLI       --------FFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGA
GYRB_SHIFL       --------FFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGA
GYRB_ECO57       --------FFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGA
GYRB_SALTI       --------FFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGA
GYRB_SALTY       --------FFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGA
GYRB_VIBCH       --------FFYRQMPELIERGYIYIAQPPLYKVKKGKQEQYIKDEEAMNQYQVALAMDGA
GYRB_VIBPA       --------FFYRQMPELIERGYVYIAQPPLYKVKKGKQEQYIKDEEAMNQYQVSLALDNA
GYRB_HAEIN       --------FFYRQMPELIERGYVYIAQPPLYKVKKGKQERYIKDADEMEQYELTLALDGA
GYRB_PSEAE       --------FFFRQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDA
GYRB_PSEPU       --------FFFRQLPELVERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDA
GYRB_NEIGO       --------FFYRQMPDLVERGYIYIAQPPLYKAKYGKQERYLKDELEKDQWLLGLALEKA
GYRB_BUCAI       --------FFYRQLPELIEKGYVYIAQPPLYKLKKGRKEKYIKNDEEMNTYQIKNALKDL
GYRB_BUCAP       --------FFYRQLPELIKKGYVYIAQPPLYKVKKGKQEKYIKNDEEMNKYQIKIALKEI
GYRB_BUCBP       --------FFYRYMPEIIQRGYLYIAQPPLYKVTKNNKTRYIKDKNTMENYKLSTALENT
GYRB_CAUVN       --------FFYRQMPELIERGYIYIAQPPLYKASKGKSSRYLKDDAEMDAFLVDEGVDGA
GYRB_CAUVC       --------FFYRQMPELIERGYIYIAQPPLYKASKGKSSRYLKDDAEMDAFLVDEGVDGA
GYRB_RICCN       --------FFYRHMPELINKGYLYIAQPPLYKVKKGAAEFYLKNEQALQDYLIKSTINDA
GYRB_RICFE       --------FFYRHMPELINKGYLYIAQPPLYKVKKGAAEFYLKNEQALQDYLIKSTINDA
GYRB_RICBR       --------FFYRHMPELINKGYLYIAQPPLYKVKKGASELYLKNEQALQDYLVKSAISDA
GYRB_RICPR       --------FFYRHMPELINKGYLYIAQPPLYKVKSGASELYLKNEKALQNYLIKSTINDT
GYRB_RICTY       --------FFYRHMPELINKGYLYIAQPPLYKVKSGASELYLKNEQALQNYLIKSTINDT
                         :    :  ::     .                                    

GYRB_BACAN       ------------------------------------------------------------
GYRB_BACSU       ------------------------------------------------------------
GYRB_BACHD       ------------------------------------------------------------
GYRB_STAA3       ------------------------------------------------------------
GYRB_STAAC       ------------------------------------------------------------
GYRB_STAAS       ------------------------------------------------------------
GYRB_STAAU       ------------------------------------------------------------
GYRB_STAAW       ------------------------------------------------------------
GYRB_STAAR       ------------------------------------------------------------
GYRB_STAAM       ------------------------------------------------------------
GYRB_STAAN       ------------------------------------------------------------
GYRB_STAES       ------------------------------------------------------------
GYRB_STAEQ       ------------------------------------------------------------
GYRB_STRPN       ------------------------------------------------------------
GYRB_STRR6       ------------------------------------------------------------
GYRB_STRP6       ------------------------------------------------------------
GYRB_STRP8       ------------------------------------------------------------
GYRB_STRP1       ------------------------------------------------------------
GYRB_STRP3       ------------------------------------------------------------
GYRB_CLOAB       ------------------------------------------------------------
GYRB_THEMA       ------------------------------------------------------------
GYRB_ARCFU       ------------------------------------------------------------
TOP4B_AQUAE      GRLVDAREKEFKGEELVRLLIDLKDYEDAYRALVKSKGENLVNFLLTHRVREEDLRNPAR
GYRB_HALVD       ------------------------------------------------------------
GYRB_HALL2       ------------------------------------------------------------
GYRB_MYXXA       ------------------------------------------------------------
GYRB_MYCTU       ------------------------------------------------------------
GYRB_MYCTA       ------------------------------------------------------------
GYRB_MYCPA       ------------------------------------------------------------
GYRB_MYCLE       ------------------------------------------------------------
GYRB_MYCSM       ------------------------------------------------------------
GYRB_MYCS2       ------------------------------------------------------------
GYRB_STRCO       ------------------------------------------------------------
GYRBS_STRNV      ------------------------------------------------------------
GYRBR_STRNV      ------------------------------------------------------------
GYRB_HELPY       ------------------------------------------------------------
GYRB_HELPJ       ------------------------------------------------------------
GYRB_CAMJE       ------------------------------------------------------------
GYRB_MYCAT       ------------------------------------------------------------
GYRB_MYCHP       ------------------------------------------------------------
GYRB_MYCGE       ------------------------------------------------------------
GYRB_MYCPN       ------------------------------------------------------------
GYRB_MYCGA       ------------------------------------------------------------
GYRB_SPICI       ------------------------------------------------------------
GYRB_BORBU       ------------------------------------------------------------
GYRB_BORHE       ------------------------------------------------------------
GYRB_TREDE       ------------------------------------------------------------
GYRB_TREPA       ------------------------------------------------------------
GYRB_CHLMU       ------------------------------------------------------------
GYRB_CHLTR       ------------------------------------------------------------
GYRB_CHLPN       ------------------------------------------------------------
GYRB_ECOLI       TLHTN-------------------------------------------------------
GYRB_SHIFL       TLHTN-------------------------------------------------------
GYRB_ECO57       TLHTN-------------------------------------------------------
GYRB_SALTI       TLHAN-------------------------------------------------------
GYRB_SALTY       TLHAN-------------------------------------------------------
GYRB_VIBCH       ELHVN-------------------------------------------------------
GYRB_VIBPA       SLHVN-------------------------------------------------------
GYRB_HAEIN       ELHIS-------------------------------------------------------
GYRB_PSEAE       SLHVN-------------------------------------------------------
GYRB_PSEPU       SLHLD-------------------------------------------------------
GYRB_NEIGO       KIVSD-------------------------------------------------------
GYRB_BUCAI       VLKSE-------------------------------------------------------
GYRB_BUCAP       VIKNK-------------------------------------------------------
GYRB_BUCBP       ILESNT------------------------------------------------------
GYRB_CAUVN       ELDLA-------------------------------------------------------
GYRB_CAUVC       ELDLA-------------------------------------------------------
GYRB_RICCN       TLILD-------------------------------------------------------
GYRB_RICFE       TLTLD-------------------------------------------------------
GYRB_RICBR       TLTLD-------------------------------------------------------
GYRB_RICPR       YLILD-------------------------------------------------------
GYRB_RICTY       KLILD-------------------------------------------------------
                                                                             

GYRB_BACAN       ------------------------------------------------------------
GYRB_BACSU       ------------------------------------------------------------
GYRB_BACHD       ------------------------------------------------------------
GYRB_STAA3       ------------------------------------------------------------
GYRB_STAAC       ------------------------------------------------------------
GYRB_STAAS       ------------------------------------------------------------
GYRB_STAAU       ------------------------------------------------------------
GYRB_STAAW       ------------------------------------------------------------
GYRB_STAAR       ------------------------------------------------------------
GYRB_STAAM       ------------------------------------------------------------
GYRB_STAAN       ------------------------------------------------------------
GYRB_STAES       ------------------------------------------------------------
GYRB_STAEQ       ------------------------------------------------------------
GYRB_STRPN       ------------------------------------------------------------
GYRB_STRR6       ------------------------------------------------------------
GYRB_STRP6       ------------------------------------------------------------
GYRB_STRP8       ------------------------------------------------------------
GYRB_STRP1       ------------------------------------------------------------
GYRB_STRP3       ------------------------------------------------------------
GYRB_CLOAB       ------------------------------------------------------------
GYRB_THEMA       ------------------------------------------------------------
GYRB_ARCFU       ------------------------------------------------------------
TOP4B_AQUAE      VKEITHLMEEELGDYRVDTKYNELEGAYDIIFYDDKLGTKTIIDVNFLSSLSYREVLEGI
GYRB_HALVD       ------------------------------------------------------------
GYRB_HALL2       ------------------------------------------------------------
GYRB_MYXXA       ------------------------------------------------------------
GYRB_MYCTU       ------------------------------------------------------------
GYRB_MYCTA       ------------------------------------------------------------
GYRB_MYCPA       ------------------------------------------------------------
GYRB_MYCLE       ------------------------------------------------------------
GYRB_MYCSM       ------------------------------------------------------------
GYRB_MYCS2       ------------------------------------------------------------
GYRB_STRCO       ------------------------------------------------------------
GYRBS_STRNV      ------------------------------------------------------------
GYRBR_STRNV      ------------------------------------------------------------
GYRB_HELPY       ------------------------------------------------------------
GYRB_HELPJ       ------------------------------------------------------------
GYRB_CAMJE       ------------------------------------------------------------
GYRB_MYCAT       ------------------------------------------------------------
GYRB_MYCHP       ------------------------------------------------------------
GYRB_MYCGE       ------------------------------------------------------------
GYRB_MYCPN       ------------------------------------------------------------
GYRB_MYCGA       ------------------------------------------------------------
GYRB_SPICI       ------------------------------------------------------------
GYRB_BORBU       ------------------------------------------------------------
GYRB_BORHE       ------------------------------------------------------------
GYRB_TREDE       ------------------------------------------------------------
GYRB_TREPA       ------------------------------------------------------------
GYRB_CHLMU       ------------------------------------------------------------
GYRB_CHLTR       ------------------------------------------------------------
GYRB_CHLPN       ------------------------------------------------------------
GYRB_ECOLI       ------------------------------------------------------------
GYRB_SHIFL       ------------------------------------------------------------
GYRB_ECO57       ------------------------------------------------------------
GYRB_SALTI       ------------------------------------------------------------
GYRB_SALTY       ------------------------------------------------------------
GYRB_VIBCH       ------------------------------------------------------------
GYRB_VIBPA       ------------------------------------------------------------
GYRB_HAEIN       ------------------------------------------------------------
GYRB_PSEAE       ------------------------------------------------------------
GYRB_PSEPU       ------------------------------------------------------------
GYRB_NEIGO       ------------------------------------------------------------
GYRB_BUCAI       ------------------------------------------------------------
GYRB_BUCAP       ------------------------------------------------------------
GYRB_BUCBP       ------------------------------------------------------------
GYRB_CAUVN       ------------------------------------------------------------
GYRB_CAUVC       ------------------------------------------------------------
GYRB_RICCN       ------------------------------------------------------------
GYRB_RICFE       ------------------------------------------------------------
GYRB_RICBR       ------------------------------------------------------------
GYRB_RICPR       ------------------------------------------------------------
GYRB_RICTY       ------------------------------------------------------------
                                                                             

GYRB_BACAN       --------------------EKELEKILAELP----------------------------
GYRB_BACSU       --------------------DKELEELLKTLP----------------------------
GYRB_BACHD       --------------------DAELQEILSQLP----------------------------
GYRB_STAA3       --------------------DRELDKLKSELN----------------------------
GYRB_STAAC       --------------------DRELDKLKSELN----------------------------
GYRB_STAAS       --------------------DRELDKLKSELN----------------------------
GYRB_STAAU       --------------------DRELDKLKSELN----------------------------
GYRB_STAAW       --------------------DRELDKLKSELN----------------------------
GYRB_STAAR       --------------------DRELDKLKSELN----------------------------
GYRB_STAAM       --------------------DRELDKLKSELN----------------------------
GYRB_STAAN       --------------------DRELDKLKSELN----------------------------
GYRB_STAES       --------------------DRELDKLKQELN----------------------------
GYRB_STAEQ       --------------------DRELDKLKQELN----------------------------
GYRB_STRPN       --------------------EIKLQEALARYSE---------------------------
GYRB_STRR6       --------------------EIKLQEALARYSE---------------------------
GYRB_STRP6       --------------------EDQLKTALEKYSI---------------------------
GYRB_STRP8       --------------------EDQLKTALEKYSI---------------------------
GYRB_STRP1       --------------------EDQLKTALEKYSI---------------------------
GYRB_STRP3       --------------------EDQLKTALEKYSI---------------------------
GYRB_CLOAB       --------------------DKELEDVLQDVGG---------------------------
GYRB_THEMA       ---------------------ELAEYKEKLQGKR--------------------------
GYRB_ARCFU       ---------------------ELKRTLEQVGGG---------------------------
TOP4B_AQUAE      HLHLPVQVFFENKKVEINSLGEIYDKFMDFARSG--------------------------
GYRB_HALVD       --------------------DRIIEEECNGNP----------------------------
GYRB_HALL2       --------------------DRIIEEECNGNP----------------------------
GYRB_MYXXA       ------------------SAETLTGRGCPGGGGEGRLMTPSSAACRTCWAACATSWCRTP
GYRB_MYCTU       --------------------DGLLEAGLKAGK----------------------------
GYRB_MYCTA       --------------------DGLLEAGLKAGK----------------------------
GYRB_MYCPA       --------------------DGLLEAGLKAGK----------------------------
GYRB_MYCLE       --------------------DGLLETGLKLGK----------------------------
GYRB_MYCSM       --------------------DGLLEAGRAAGK----------------------------
GYRB_MYCS2       --------------------DGLLEAGRAAGK----------------------------
GYRB_STRCO       --------------------DALIEMGRQAGK----------------------------
GYRBS_STRNV      --------------------DALVELGKQNGK----------------------------
GYRBR_STRNV      --------------------NTLLERGRRDGR----------------------------
GYRB_HELPY       --------------------DHFLIEHGINSVDIEGIGKNDLMNLLKVARHYRYALLELE
GYRB_HELPJ       --------------------DHFLIEHGINSVDIEGIGKNDLMNLLKVARHYRYTLLELE
GYRB_CAMJE       --------------------SEYLIETGIEGLNYEGIGMNDLKDYLKIVAAYRAILKDLE
GYRB_MYCAT       --------------------EEILSK----------------------------------
GYRB_MYCHP       --------------------EQIMAK----------------------------------
GYRB_MYCGE       --------------------EQWKSQ----------------------------------
GYRB_MYCPN       --------------------EEWKQQ----------------------------------
GYRB_MYCGA       --------------------EEWKNQ----------------------------------
GYRB_SPICI       --------------------ELYKEE----------------------------------
GYRB_BORBU       --------------------EKFLDSIETKN-----------------------------
GYRB_BORHE       --------------------EAFLGSIETGK-----------------------------
GYRB_TREDE       --------------------DSVLDQIGRG------------------------------
GYRB_TREPA       --------------------DEALESIGKK------------------------------
GYRB_CHLMU       --------------------DGYLLNLGTRESRVVFDDTARELEGTALESFVNLILEVES
GYRB_CHLTR       --------------------DGYLLNLGTKESQIVFDDTLRDLRGEALETFVNLILEVES
GYRB_CHLPN       --------------------DSYLLMLGTNESSILFKSTERELRGEALESFINVILDVES
GYRB_ECOLI       ---------ASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADL
GYRB_SHIFL       ---------ASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADL
GYRB_ECO57       ---------ASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADL
GYRB_SALTI       ---------AHAPALSGEALEKLVSEYNATQKMIGRMERRFPKALLKELVYQPTLTEADL
GYRB_SALTY       ---------AHAPALSGEALEKLVSEYNATQKMIGRMERRFPKALLKELVYQPTLTEADL
GYRB_VIBCH       ---------ADAPALAGEPLEKLVQQYNAAIKLVERMSRRYPYAMLHELIYVPRINAELC
GYRB_VIBPA       ---------AEAPALAGEALEKLVQQYNAGIKLADRMSRRYPRALVHELIYTSRLTAEQC
GYRB_HAEIN       ---------TNAPAMNALVFEKLVAEYNSVQKLIGRLNRHYPAPVLQGLIYQSPISIEMM
GYRB_PSEAE       ---------EHAPGLSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDL
GYRB_PSEPU       ---------ESAPAVSGVQLESLVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQL
GYRB_NEIGO       ---------GR--TIEGAELADTAKQFLLAKTVIEQESRFVDELVLRAMLHASPIDLTSS
GYRB_BUCAI       --------DNLIINQKLKKFKKIMSEYHYIQIIMKQSKHYFPKLVFNELIYHNHLH--NL
GYRB_BUCAP       --------KNENCNKIIKEFQKIVSDFNHIQIKMKKNKNYFPELILNELIYHPRLY--NL
GYRB_BUCBP       --------DKEIKIKCNYTLKKIISEYKIIQTIFFKIKDNFPLNILNEMLYHPKLN--NL
GYRB_CAUVN       ----------SGERMTGQDLLALVQTCRSAKANIDRLAARAPATAIEQAALSGLLG----
GYRB_CAUVC       ----------SGERMTGQDLLALVQTCRSAKANIDRLAARAPATAIEQAALSGLLG----
GYRB_RICCN       ----------DKERLVGDNLEELINKVVKFNGLLDHASKKFNRSITEILAINDLLNNKIF
GYRB_RICFE       ----------GKEQLVGDNLEELINKVVKFNGLLDHASKKFNRSITEILAINDLLNNKIF
GYRB_RICBR       ----------NKEQLTNENLEELMSKVIKFNSLLDHASKKFNRSITEILAINDLLNNKIF
GYRB_RICPR       ----------GQEQLVGENLEDLINKVVKFNNLLDHVSKKFNRSITEILAINDLFNKKIF
GYRB_RICTY       ----------GQEQLIGYNLEDLINKVVQFNCLLDRASKKFNRSITEILAINDLFNKKIF
                                                                             

GYRB_BACAN       ------------------------------------------------------------
GYRB_BACSU       ------------------------------------------------------------
GYRB_BACHD       ------------------------------------------------------------
GYRB_STAA3       ------------------------------------------------------------
GYRB_STAAC       ------------------------------------------------------------
GYRB_STAAS       ------------------------------------------------------------
GYRB_STAAU       ------------------------------------------------------------
GYRB_STAAW       ------------------------------------------------------------
GYRB_STAAR       ------------------------------------------------------------
GYRB_STAAM       ------------------------------------------------------------
GYRB_STAAN       ------------------------------------------------------------
GYRB_STAES       ------------------------------------------------------------
GYRB_STAEQ       ------------------------------------------------------------
GYRB_STRPN       ------------------------------------------------------------
GYRB_STRR6       ------------------------------------------------------------
GYRB_STRP6       ------------------------------------------------------------
GYRB_STRP8       ------------------------------------------------------------
GYRB_STRP1       ------------------------------------------------------------
GYRB_STRP3       ------------------------------------------------------------
GYRB_CLOAB       ------------------------------------------------------------
GYRB_THEMA       ------------------------------------------------------------
GYRB_ARCFU       ------------------------------------------------------------
TOP4B_AQUAE      ------------------------------------------------------------
GYRB_HALVD       ------------------------------------------------------------
GYRB_HALL2       ------------------------------------------------------------
GYRB_MYXXA       STTPRSWCSTPTRMEPCGRRCS--------------TTPSCRRRSTWSCRLCAEHLRGAG
GYRB_MYCTU       ------------------------------------------------------------
GYRB_MYCTA       ------------------------------------------------------------
GYRB_MYCPA       ------------------------------------------------------------
GYRB_MYCLE       ------------------------------------------------------------
GYRB_MYCSM       ------------------------------------------------------------
GYRB_MYCS2       ------------------------------------------------------------
GYRB_STRCO       ------------------------------------------------------------
GYRBS_STRNV      ------------------------------------------------------------
GYRBR_STRNV      ------------------------------------------------------------
GYRB_HELPY       KRYNLLEILRFLIETKDALSLD--------------MKVLEKSILEKLEGLNYQILRSFA
GYRB_HELPJ       KRYNLLEVLRFLIETKDALSLD--------------MKVLEKSILEKLEGLNYQILRSFA
GYRB_CAMJE       KRFNVISVIRYMIENSNLVKGN--------------NEELFSVIKQFLETQGHNILNHYI
GYRB_MYCAT       ------------------------------------------------------------
GYRB_MYCHP       ------------------------------------------------------------
GYRB_MYCGE       ------------------------------------------------------------
GYRB_MYCPN       ------------------------------------------------------------
GYRB_MYCGA       ------------------------------------------------------------
GYRB_SPICI       ------------------------------------------------------------
GYRB_BORBU       ------------------------------------------------------------
GYRB_BORHE       ------------------------------------------------------------
GYRB_TREDE       ------------------------------------------------------------
GYRB_TREPA       ------------------------------------------------------------
GYRB_CHLMU       FIIALEKRAIPFSEFLDMFRDG-AYPLYYYPPESGKQGGNYLYSNEEKEAAVAANEEAAA
GYRB_CHLTR       FIVSLEKKAIPFSEFLDMFRDG-AYPLYYYPPESGKQGGSYLYSHEEKEAAIAANEESAS
GYRB_CHLPN       FINTLEKKAIPFSEFLEMYKEGIGYPLYYLAPATGMQGGRYLYSDEEKEEALAQEETHKF
GYRB_ECOLI       SDEQTVTRWVNALVSELNDKEQHGSQWKFDVH--------------TNAEQNLFEPIVRV
GYRB_SHIFL       SDEQTVTRWVNALVSELNDKEQHGSQWKFDVH--------------TNAEQNLFEPIVRV
GYRB_ECO57       SDEQTVTRWVNALVSELNDKEQHGSQWKFDVH--------------TNAEQNLFEPIVRV
GYRB_SALTI       SDEQTVTRWVNALITELNEKEQHGSQWKFDVH--------------TNTEQNLFEPIVRV
GYRB_SALTY       SDEQTVTRWVNALITELNEKEQHGSQWKFDVH--------------TNTEQNLFEPIVRV
GYRB_VIBCH       ADKAAVEAWTQRLVEQLNAKEVGASQYSVLVE--------------HNAELNVYLPKIQV
GYRB_VIBPA       HDAAAVEAWTKQLVEQLNAKEVGASQYSYEVE--------------LHAELGLSLPKIIV
GYRB_HAEIN       KEESAVENWGKSFVEQLTAKETEAHQYSVRTQ--------------FNAERQVYEAVITV
GYRB_PSEAE       ANESAMQGWLEKFQARLTAAEKSGLTYKASLR--------------EDRERHLWLPEVEL
GYRB_PSEPU       GDHAVMQAWLAKLQERLNSSQKSGLAYNASLR--------------EDKERNVWLPEVEI
GYRB_NEIGO       EN---ADKAVAELSGLLDEKE------AALER--------------IEGHEGHQFIKITR
GYRB_BUCAI       KDIEIVKEWIYTLAENLNKKDNSNNHYSIEIK--------------ENLDKNIFEPTIKI
GYRB_BUCAP       KNENVVQNWIEKLVEKLNKKDKNNTIYTSKIK--------------RNENDSIFEPSIKL
GYRB_BUCBP       NDEVYVNNWINNFVIQLQKKSSSTRNYSAHIT--------------FNSKDKIFEPLIKI
GYRB_CAUVN       ESPNAAAAATRLDLYAEEGDGP----WSGERG--------------DTG------FVFSR
GYRB_CAUVC       ESPNAAAAATRLDLYAEEGDGP----WSGERG--------------DTG------FVFSR
GYRB_RICCN       EPESDLRLKKALDVLNSLEDSPDKTNWEVLKH--------------ENK------IEFFR
GYRB_RICFE       ELESDSRLQKALDVLNSLEESPDKTNWEVLKH--------------ENK------VEFFR
GYRB_RICBR       DNESDSRLKKALNALNSLEQSPDKTDWEVLKH--------------ENK------IEFFR
GYRB_RICPR       EPESSARLQKALDILNNLEESPDKTNLQVLKH--------------ENK------IEFFH
GYRB_RICTY       EPESGSRLQKALDVLNNLEESPDKTNLQVLKH--------------ENR------IEFFH
                                                                             

GYRB_BACAN       ------------------------------------------------------------
GYRB_BACSU       ------------------------------------------------------------
GYRB_BACHD       ------------------------------------------------------------
GYRB_STAA3       ------------------------------------------------------------
GYRB_STAAC       ------------------------------------------------------------
GYRB_STAAS       ------------------------------------------------------------
GYRB_STAAU       ------------------------------------------------------------
GYRB_STAAW       ------------------------------------------------------------
GYRB_STAAR       ------------------------------------------------------------
GYRB_STAAM       ------------------------------------------------------------
GYRB_STAAN       ------------------------------------------------------------
GYRB_STAES       ------------------------------------------------------------
GYRB_STAEQ       ------------------------------------------------------------
GYRB_STRPN       ------------------------------------------------------------
GYRB_STRR6       ------------------------------------------------------------
GYRB_STRP6       ------------------------------------------------------------
GYRB_STRP8       ------------------------------------------------------------
GYRB_STRP1       ------------------------------------------------------------
GYRB_STRP3       ------------------------------------------------------------
GYRB_CLOAB       ------------------------------------------------------------
GYRB_THEMA       ------------------------------------------------------------
GYRB_ARCFU       ------------------------------------------------------------
TOP4B_AQUAE      ------------------------------------------------------------
GYRB_HALVD       ------------------------------------------------------------
GYRB_HALL2       ------------------------------------------------------------
GYRB_MYXXA       QGAVQGPRGRGEITVF-----------------------------------SVQEVLAAV
GYRB_MYCTU       ------------------------------------------------------------
GYRB_MYCTA       ------------------------------------------------------------
GYRB_MYCPA       ------------------------------------------------------------
GYRB_MYCLE       ------------------------------------------------------------
GYRB_MYCSM       ------------------------------------------------------------
GYRB_MYCS2       ------------------------------------------------------------
GYRB_STRCO       ------------------------------------------------------------
GYRBS_STRNV      ------------------------------------------------------------
GYRBR_STRNV      ------------------------------------------------------------
GYRB_HELPY       TEESLHLHTQTPKGLVEFNLDDNLFKEVLFEEANYTYQKLMEYNLDFLENKDILAFLEEV
GYRB_HELPJ       TEESLHLHAQTPKGLVEFNLDDNLFKDVLFEEAHYTYQKLMEYNLDFLENKDILAFLEEV
GYRB_CAMJE       NENEIRAFVQTQNGLEELVINEELFTHPLYEEASYIFDKIKDRSLEF--DKDILEVLEDV
GYRB_MYCAT       ------------------------------------------------------------
GYRB_MYCHP       ------------------------------------------------------------
GYRB_MYCGE       ------------------------------------------------------------
GYRB_MYCPN       ------------------------------------------------------------
GYRB_MYCGA       ------------------------------------------------------------
GYRB_SPICI       ------------------------------------------------------------
GYRB_BORBU       ------------------------------------------------------------
GYRB_BORHE       ------------------------------------------------------------
GYRB_TREDE       ------------------------------------------------------------
GYRB_TREPA       ------------------------------------------------------------
GYRB_CHLMU       RIIELYKASAFEEIQHNLNEYGYDIRHYLHPKGTGITVSTEDSKTPNYTCYTLKEVIDYL
GYRB_CHLTR       RILELYKGSVLEELQRDLGDYGYDIRNYLHPKGSGITVSTEDPKISPYVCYTLKEVIDYL
GYRB_CHLPN       KIIELYKVAVFVDIQNQLKEYGLDISSYLIPQKNEIVIGNEDSPSCNYSCYTLEEVINYL
GYRB_ECOLI       RTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFEQALDWL
GYRB_SHIFL       RTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFEQALDWL
GYRB_ECO57       RTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFEQALDWL
GYRB_SALTI       RTHGVDTDYPLDHEFVTGAEYRRICTLGEKLRGLIEEDAFIERGERRQPVTSFEQALEWL
GYRB_SALTY       RTHGVDTDYPLDHEFVTGAEYRRICTLGEKLRGLIEEDAFIERGERRQPVTSFEQALEWL
GYRB_VIBCH       RTHGVTHEYLLSADLINSKEYAKLADLSEALDGLIEAGAFIKRGERVQPISSFAAALDWL
GYRB_VIBPA       RTHGVTHEHALSVDFLNSKEYGKLADLSEVLDGLLEEGAYIKRGERTLPVSSFAEALEWL
GYRB_HAEIN       RKHGIDTDYFLNFDFVHGNEYAKIVSLNKQLNGLLEEGAYVIRGEKVQPVRSFEQAVEWL
GYRB_PSEAE       VAHGLSSYVTFNRDFFASNDYRSVSLLGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWL
GYRB_PSEPU       TSHGLASYITFNRDFFGSNDYRTVVNIGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWL
GYRB_NEIGO       KLHGNVMVSYIEPKFLNSKAYQTLTQTAAALKGLVGEGAKLYKGENEYDADSFETALDIL
GYRB_BUCAI       SRYAHYTKYDFKEEFLKSKEYLLITNLGESFKKYFSDKVLIEKSGSTYKIDSIKNTWKWL
GYRB_BUCAP       SRYANHTQYDLKNDFLESKEYFLITNLGEKFKKFQENENFIEKGEKIYKINDIKNTLEWL
GYRB_BUCBP       QKNAEVKEYKFDITFINSYEYQKIYSLGKKLQEMIQKNIHIKKNNKTYSIKNFQKNFELL
GYRB_CAUVN       VRRGVSERVVLDDVLLHAADARRLAERAVKLTEIFSGRAIFRRKDKSTTVRGPLDLVNAV
GYRB_CAUVC       VRRGVSERVVLDDVLLHAADARRLAERAVKLTEIFSGRAIFRRKDKSTTVRGPLDLVNAV
GYRB_RICCN       FSRGLKESKILLKEQLESFEFVQISKFALTIFDIFSKQLKLIVKSQEFDILTPSQLLNTI
GYRB_RICFE       FSRGLKESKILLKEQLESFEFVQISKLALTIFDIFDKQLKLIVKSQEFGILTASQLLNAI
GYRB_RICBR       FSRGLKERKILLREQLESFEFINISKLALTIFDVFNKQLKLVVKNQEFDILTPSILLNTI
GYRB_RICPR       FSRGLKETKILLKEQLELFEFVEISQFALSIFDIFSKRLKLIVKSKAFDILTPSQLLNTI
GYRB_RICTY       FSRGLKNTKILLKEQLELFEFVEISQFALSIFDIFSKRLKLIVKGKEFDVVTPSQLLNTI
                                                                             

GYRB_BACAN       ---AQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVE
GYRB_BACSU       ---QTPKPGLQRYKGLGEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVE
GYRB_BACHD       ---DKAKPGIQRYKGLGEMNPSQLWETTMDPGQRTVLQVTLEDAMKADEIFEILMGDRVE
GYRB_STAA3       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAC       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAS       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAU       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAW       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAR       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAM       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAAN       ---PTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVE
GYRB_STAES       ---PSPKWSIARYKGLGEMNADQLWETTMNPEHRSMLQVRLEDAIDADQTFEMLMGDVVE
GYRB_STAEQ       ---PSPKWSIARYKGLGEMNADQLWETTMNPEHRSMLQVRLEDAIDADQTFEMLMGDVVE
GYRB_STRPN       ---GRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVE
GYRB_STRR6       ---GRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVE
GYRB_STRP6       ---GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVE
GYRB_STRP8       ---GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVE
GYRB_STRP1       ---GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVE
GYRB_STRP3       ---GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVE
GYRB_CLOAB       ---KDKNTDIQRYKGLGEMNPEQLWETTMNPEQRTLIKVNIEDAMAADEIFTILMGDKVD
GYRB_THEMA       -------IEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIEDAEEADRLFEILMGNDPS
GYRB_ARCFU       --------EVQRYKGLGEMNPQQLWETTMNPENRILIQVTLEDAKRADELFSILMGEDVE
TOP4B_AQUAE      -------MEVQRYKGLGEMNPEQLWETTMNPKTRRLKKVKIEDAAEADRIFTILMGEQVE
GYRB_HALVD       -------TQVQRFKGLGEMNPDQLWDTTMNPENRVLKRITVEDAAAADRMFNILMGDAVG
GYRB_HALL2       -------TQVQRFKGLGEMNPDQLWDTTMNPENRVLKRITVEDAAAADRMFNILMGDAVG
GYRB_MYXXA       RKDAQRGLGLQRYKGLGEMNPEQLWDTTMNPATRTLLQVRVEDAVESDEIFSLLMGEAVE
GYRB_MYCTU       --KINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVD
GYRB_MYCTA       --KINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVD
GYRB_MYCPA       --KINKDDGIQRYKGLGEMDAKELWETTMDPTVRVLRQVTLDDAAAADELFSILMGEDVD
GYRB_MYCLE       --KINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVD
GYRB_MYCSM       --KINVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVE
GYRB_MYCS2       --KINVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVE
GYRB_STRCO       --RIR-EDSVQRFKGLGEMNAEELRITTMDQEHRVLGQVTLDDAAQADDLFSVLMGEDVE
GYRBS_STRNV      --RIK-EDSIQRFKGLGEMNAEELRITTMDVDHRVLGQVTLDDAAQADDLFSVLMGEDVE
GYRBR_STRNV      --RIR-DDSIQRFKGLGEMNAEELRVTTMDPDHRVLGQVTLDDAAFADDLFSVLMGEDVE
GYRB_HELPY       ENHAKKGANIQRYKGLGEMNPNDLWETTMHKENRSLIKLKIEDLEKTDAVFSLCMGDEVE
GYRB_HELPJ       ENYAKKGANIQRYKGLGEMNPNDLWETTMHKENRSLIKLKIEDLEKTDAVFSLCMGDEVE
GYRB_CAMJE       ETNAKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVE
GYRB_MYCAT       LEDS-KNISIQRYKGLGEMDPEQLWETTMNPATRKY----------CKFKSMTLLAAIQS
GYRB_MYCHP       LEDK-RNVAIQRYKGLGEMDPEQLWETTMDPETRKMLQVQIDDAAICDTVFATLMGEEIE
GYRB_MYCGE       NPN--VKFGLQRYKGLGEMDALQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVP
GYRB_MYCPN       HPN--LKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVP
GYRB_MYCGA       NPN--VRYELQRYKGLGEMDDVQLWETTMDPEKRTLLKVSINDAANADKTFSLLMGDEVS
GYRB_SPICI       LLKQNKNYTIQRYKGLGEMNPEQLWETTMDPERRLLLKVSVNNAFEANLICNELMGENVE
GYRB_BORBU       ----RNSISLQRYKGLGEMNPTQLWETTMDPARRKMRLMNIDDAIEAEKIFVTLMGDLVE
GYRB_BORHE       ----RDKVSLQRYKGLGEMNPTQLWETTMNPATRKMKLIKINDAIQAEKIFVTLMGDDVE
GYRB_TREDE       -----NNAAVQRYKGLGEMDGTQLWETTMDPARRKMMRVTLPDAVEADRIFSTLMGEEVE
GYRB_TREPA       -----SGVAVQRYKGLGEMDGTQLWETTMNPVRRKMMQVVLSDAVEADRVFSTLMGEDVE
GYRB_CHLMU       KGLGRKGIEIQRYKGLGEMNADQLWDTTMNPEQRTLVRVSLKDAVEADHIFTMLMGEEVP
GYRB_CHLTR       KGLGRKGIEIQRYKGLGEMNADQLWDTTMNPEQRTLVRVSLKDAVEADHIFTMLMGEEVP
GYRB_CHLPN       KNLGRKGIEIQRYKGLGEMNADQLWDTTMNPEQRTLIHVSLKDAVEADHIFTMLMGEEVP
GYRB_ECOLI       VKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVE
GYRB_SHIFL       VKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVE
GYRB_ECO57       VKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVE
GYRB_SALTI       VKESRRGLAIQRYKGLGEMNPDQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVE
GYRB_SALTY       VKESRRGLAIQRYKGLGEMNPDQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVE
GYRB_VIBCH       IKESRRGLSIQRYKGLGEMNPDQLWETTMDPETRRMMQVTIEDAVGADELFTTLMGDQVE
GYRB_VIBPA       VKESMRGLSRQRYKGLGEMNPDQLWETTMDPETRRMMQVTIEDAVGADQLFTTLMGDQVE
GYRB_HAEIN       VKESRKGLEVQRYKGLGEMNADQLWETTMDPNSRRMLKVSIKDAVAADQLFTTLMGDEVE
GYRB_PSEAE       MAEGTKRHSIQRYKGLGEMNPEQLWETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVE
GYRB_PSEPU       MNETTKRHTIQRYKGLGEMNPDQLWETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVE
GYRB_NEIGO       MSVAQKGMSIQRYKGLGEMNPEQLWETTMDPTVRRLLKVRIEDRI-ADEVFVTLMGDEVE
GYRB_BUCAI       IKQSKRGLFIQRYKGLGEMNPEQLWNTTMNPETRNMLQVTIKDAVSANNLFNTLMGEAVE
GYRB_BUCAP       IKETKRGFFVQRYKGLGEMNPDQLWNTTMNPETRNMLQVTIKDAISANNLFNTLMGDLVE
GYRB_BUCBP       IQNSFKNVLIQRYKGLGEMNPEQLWKTTMNPETRRMLKITLHNIDTTNKLFNTLMGDSVE
GYRB_CAUVN       LDAGRKGLTIQRYKGLGEMNPDQLWETTLDAEARTLLQVRVNHADDADDMFSRLMGDLVE
GYRB_CAUVC       LDAGRKGLTIQRYKGLGEMNPDQLWETTLDAEARTLLQVRVNHADDADDMFSRLMGDLVE
GYRB_RICCN       IECGKRGINIQRFKGLGEMNSDQLWETTLDPTKRTLLQVRVAEIDEAEGIFSTLMGDVVE
GYRB_RICFE       IECGKRGISIQRFKGLGEMNSNQLWETTLDPAKRTLLQVRVAEVDEAEGIFSTLMGDVVE
GYRB_RICBR       IECGKKGISVQRFKGLGEMNSDQLWDTTLDPKKRTLMQVRVAEVDEAEGIFSTLMGDVVE
GYRB_RICPR       IECGKKGITIQRFKGLGEMNSDQLWETTLDPTKRTLLQVRVAEVDEAEGIFSTLMGDVVE
GYRB_RICTY       IECGKKGITIQRFKGLGEMNSDQLWDTTLDPTKRTLLQVRVSEVDEAEGIFSTLMGDVVE
                            *:******:  :*  **:.   *             .      :.    

GYRB_BACAN       PRRNFIQENAKYVK--NLDI-
GYRB_BACSU       PRRNFIEANARYVK--NLDI-
GYRB_BACHD       PRRDFIQENARYVK--NLDI-
GYRB_STAA3       NRRQFIEDNAVYA---NLDF-
GYRB_STAAC       NRRQFIEDNAVYA---NLDF-
GYRB_STAAS       NRRQFIEDNAVYA---NLDF-
GYRB_STAAU       NRRQFIEDNAVYA---NLDF-
GYRB_STAAW       NRRQFIEDNAVYA---NLDF-
GYRB_STAAR       NRRQFIEDNAVYA---NLDF-
GYRB_STAAM       NRRQFIEDNAVYA---NLDF-
GYRB_STAAN       NRRQFIEDNAVYA---NLDF-
GYRB_STAES       NRRQFIEDNAVYA---NLDF-
GYRB_STAEQ       NRRQFIEDNAVYA---NLDF-
GYRB_STRPN       PRREFIEENAVYS---TLDV-
GYRB_STRR6       PRREFIEENAVYS---TLDV-
GYRB_STRP6       PRRDFIEENAVYS---TLDI-
GYRB_STRP8       PRRDFIEENAVYS---TLDI-
GYRB_STRP1       PRRDFIEENAVYS---TLDI-
GYRB_STRP3       PRRDFIEENAVYS---TLDI-
GYRB_CLOAB       PRRKFIEENATKVV--NLDV-
GYRB_THEMA       SRREFIERHALKVK--ELDI-
GYRB_ARCFU       SRRNFIMAHSKEVK--NLDI-
TOP4B_AQUAE      PRREFIEAYAKEVK--HLDV-
GYRB_HALVD       PRKQFIKDHANDAE--WVDI-
GYRB_HALL2       PRKQFIKDHANDAE--WVDI-
GYRB_MYXXA       PRREFIERNALDVQ--NLDI-
GYRB_MYCTU       ARRSFITRNAKDVR--FLDV-
GYRB_MYCTA       ARRSFITRNAKDVR--FLDV-
GYRB_MYCPA       ARRSFITRNAKDVR--FLDV-
GYRB_MYCLE       ARRSFITRNAKDVR--FLDV-
GYRB_MYCSM       ARRSFITRNAKDVR--FLDV-
GYRB_MYCS2       ARRSFITRNAKDVR--FLDV-
GYRB_STRCO       ARRAFIQRNAKDVR--FLDI-
GYRBS_STRNV      ARRSFIQRNAKDVR--FLDI-
GYRBR_STRNV      ARRHFIQRNAQDVR--FLDI-
GYRB_HELPY       PRRAFIQAHAKDVK--QLDV-
GYRB_HELPJ       PRRAFIQAHAKDVK--QLDV-
GYRB_CAMJE       PRRDYIQAHAKDVK--HLDV-
GYRB_MYCAT       FQHWWVKKLNLVMT--SFKKC
GYRB_MYCHP       PRHDFIQENAKYAN--NIDI-
GYRB_MYCGE       PRREFIEKNARSVK--NIDI-
GYRB_MYCPN       PRREFIEQNARNVK--NIDI-
GYRB_MYCGA       PRRDFIEKNAKSVK--NIDF-
GYRB_SPICI       PRKKFIRENAKYVK--NLDV-
GYRB_BORBU       PRKEFIEQNALNVI--NLDV-
GYRB_BORHE       PRREFIEQNALDVV--NLDV-
GYRB_TREDE       PRRKFIEENAVYA---NLDV-
GYRB_TREPA       PRRKFIEENAIYA---RLDV-
GYRB_CHLMU       PRREFIESHALSIRMSNLDI-
GYRB_CHLTR       PRREFIESHALSIRMNNLDI-
GYRB_CHLPN       PRREFIESHALSIRINNLDI-
GYRB_ECOLI       PRRAFIEENALKAA--NIDI-
GYRB_SHIFL       PRRAFIEENALKAA--NIDI-
GYRB_ECO57       PRRAFIEENALKAA--NIDI-
GYRB_SALTI       PRRAFIEENALKAA--NIDI-
GYRB_SALTY       PRRAFIEENALKAA--NIDI-
GYRB_VIBCH       PRRAFIETNALKVA--NLDV-
GYRB_VIBPA       PRRHFIEENALKVA--NLDV-
GYRB_HAEIN       PRREFIELNALR-A--NLDV-
GYRB_PSEAE       PRRDFIESNALAVS--NLDV-
GYRB_PSEPU       PRREFIESNALSVS--NLDF-
GYRB_NEIGO       PRRAFIENNALIAQ--NIDA-
GYRB_BUCAI       PRRQFIENNALKAE--NIDV-
GYRB_BUCAP       PRRKFIQKNALKAE--NIDI-
GYRB_BUCBP       PRKLFIELYALKAS--NIDI-
GYRB_CAUVN       PRREFIQENALDA---EVDV-
GYRB_CAUVC       PRREFIQENALDA---EVDV-
GYRB_RICCN       PRRLFIQANALNVV--NLDV-
GYRB_RICFE       PRRLFIQANALNVV--NLDV-
GYRB_RICBR       PRRQFIQSNALNVV--NLDV-
GYRB_RICPR       PRRLFIQANALNVM--NLDV-
GYRB_RICTY       PRRLFIQANALNVM--NLDI-
                  :: ::           ..