CLUSTAL format seed alignment for MF_01901

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGO_SALTI        MISYYFQGVALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA
ARGO_SALTY        MISYYFQGFALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA
ARGO_ECO57        MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
ARGO_SHIFL        MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
ARGO_ECOL6        MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
ARGO_ECOLI        MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
ARGO_PECAS        MWAVYLQGVLLGAAMILPLGPQNAFVMNQGIRRQYHLMVALLCAVSDMVLISAGIFGGSA
D4HVW4_ERWAC      MLLTYFQGVALGLALILPLGPQNAFVMNQGVRRQYHLMTAALCTLSDILLICAGIFGGSA
D2T6D6_ERWP6      MLSVYFQGVALGATLILPLGPQNAFVLNQGVRRQYHLMTAALCTLSDILLIFFGIFGGSA
B2VF20_ERWT9      MLSVYFQGVAMGAALILPLGPQNIFVLNQGIRRRFHLMTAALCALSDILLICGGIFGGSA
D4GM99_PANAM      MLTIYFQGLALGAALILPLGPQNAFVLNQGVKRQYHLMTAALCALSDIALICAGIFGGSA
C6C9B7_DICP7      --MIYWQGFFLGAAMILPLGPQNMFVMNQGIRRHYHLTIALICSLSDMALICAGVFGGSA
D0ZEE1_EDWTE      MFSVFAQGFALGAALILPLGPQNMFVLSHGIQRRYHLTIAALCALSDLALICAGVFGGSA
ARGO_YERPE        MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA
ARGO_PHOLL        MLSTFVQGFFLSAAMILPLGPQNAFVMQQGSRRQFHLMSATLCAISDGFLIGVGVFGGSA
D3V8W8_XENNA      MLLTLIQGFFLSAAMILPLGPQNVFVMQQGSRKQFHLMSAALCSTSDALLMMAGVFGGSA
B4F0Y0_PROMH      MLTTFFQGFLLSAAMILPIGAQNAFVLQQGSKKQYHLMSAFLCALSDVILISGGVFGGSA
                        :*. :. ::***:*.** **:.:* :::.*:  * :*: **  *:  *:*****

ARGO_SALTI        LLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTW
ARGO_SALTY        LLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTW
ARGO_ECO57        LLMQSPWLLALVTWGGVVFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTW
ARGO_SHIFL        LLMQSPWLLALVTWGGVVFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTW
ARGO_ECOL6        LLMQSPWLLALVTWGGVAFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTW
ARGO_ECOLI        LLMQSPWLLALVTWGGVAFLLWYGFGAFKTAMSSNIELASAEVMKQGRWKIIATMLAVTW
ARGO_PECAS        LLNQSSLLLGAVTCGGVAFLLWFGWGAMKTAFSKNIALTSADVMKQSRWRIIATMLAVTW
D4HVW4_ERWAC      LLSQSVLLLSLITWSGVAFLLWYGAGALRTACSGDIQLASAAALKHSRWRIVATMLAVTW
D2T6D6_ERWP6      LLNQSVLLLSLVTWGGVAFLLWYGWGALRNACCGDIQLASAAALQHTRWRIMATMMAVTW
B2VF20_ERWT9      LLSQSVLLLNLVTWGGVAFLLWYGWGALHNAWRGHIHMASEGALQHGRWRIIVTLIAVTW
D4GM99_PANAM      LLNQSPLLLMLITCAGVAFLLWFGWGALRTAFSRNIELASGSHATQSRKRIIATMLAVTW
C6C9B7_DICP7      LLTQSVLLMMLVTWGGVAFLLWYGWGAIRIACQRDIQLNDAKISRESRWRIMLTLLAVTW
D0ZEE1_EDWTE      LLLRSPLLLQLVTWGGVVFLLWYGWGAWRTALRPVQAQLDDSLMQQGRWRIIVTLLAVTW
ARGO_YERPE        LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW
ARGO_PHOLL        LLSQSTLLLQFVTWGGVAFLFWYGWGALRVVLFANVELAQVNNSVKNRWRVVAIIFAVTW
D3V8W8_XENNA      LLGQSTFLLQAVTWGGVAFLLWYGWDAFRTALSGEIELASAKNISQSRWRVIMTLFAVTW
B4F0Y0_PROMH      LLSQSEYLLLLITWGGVAFLLWYGWNAFKTAFTKEIELSQHKNQVKSRWRVIVTLVAVTW
                  ** :*  *:  :* .**.**:*:* .*   .        .     . * :::  :.****

ARGO_SALTI        LNPHVYLDTFVVLGSLGGQLA-MEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKA
ARGO_SALTY        LNPHVYLDTFVVLGSLGGQLA-MEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKA
ARGO_ECO57        LNPHVYLDTFVVLGSLGGQLD-VEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKS
ARGO_SHIFL        LNPHVYLDTFVVLGSLGGQLD-VEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKS
ARGO_ECOL6        LNPHVYLDTFVVLGSLGGQLD-VEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKS
ARGO_ECOLI        LNPHVYLDTFVVLGSLGGQLD-VEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKA
ARGO_PECAS        LNPHVYLDTFVVLGSLGSQFA-DDARRWFALGTMTASFTWFFALALLAAWLAPWLNTPRV
D4HVW4_ERWAC      LNPHVYLDTFVVLGSLGGQLP-PEGRRWFALGSASASLLWFFGLALLAAWLAPLLSTTRA
D2T6D6_ERWP6      LNPHVYLDTFVILGSLGGQLP-PEARRWFALGTASASLLWFFGLAILAAWLAPLLSTTRA
B2VF20_ERWT9      LNPHVYLDTFVVLGSLGGQMP-SEARRWFALGSVSASLLWFFGLALLAAWLAPLLNTTRA
D4GM99_PANAM      LNPHVYLDTFVVLGSLGGQLPGTVARQWFALGTISASVLWFFGLALLAAWLAPLLQTARA
C6C9B7_DICP7      LNPHVYLDTFVVLGSLGGRLD-TGERSWFALGSVTASFVWFFGLAVLASWLAPWLRSVRC
D0ZEE1_EDWTE      LNPHVYLDTFVVLGSLGGQLV-ADARRWFAFGAVSASVVWFFSLALLAAWLAPWLSRPRA
ARGO_YERPE        LNPHVYLDTFVVLGSLGGQLL-PDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVA
ARGO_PHOLL        LNPHVYLDTIVVLGSIGGQLS-SDLRPWFTFGAASASVSWFFSLSLLAAWFSPVLSKPLS
D3V8W8_XENNA      LNPHVYLDTFVVLGSIGSQLP-IDHRLWFTIGAITASISWFFALSFLSAWCSPVLNQPRS
B4F0Y0_PROMH      LNPHVYLDTFVVLGSIGGQLS-AELRPWFTFGAVFASISWFFALSLLAAWFSPILSQVTA
                  *********:*:***:*.::     : **::*:  **. ***.*:.*::* :* *     

ARGO_SALTI        QRIINILVGVVMWLIAFQLAREGVAHMHALFN
ARGO_SALTY        QRIINILVGVVMWLIAFQLAREGVAHMHALFN
ARGO_ECO57        QRIINLVVGCVMWFIALQLARDGIAHAQALFS
ARGO_SHIFL        QRIINLVVGCVMWFIALQLARDGIAHAQALFS
ARGO_ECOL6        QRIINLVVGCVMWFIALQLARDGIAHAQALFS
ARGO_ECOLI        QRIINLVVGCVMWFIALQLARDGIAHAQALFS
ARGO_PECAS        QRVINFFVGMVMWGIALQLARHGWQ-------
D4HVW4_ERWAC      QRIINLLVGLVMWAIAIKLAWQAVSF------
D2T6D6_ERWP6      QRVINLLVGLVMWAIASKLAWQAISVW-----
B2VF20_ERWT9      QRTINLLVGSVMWALAVKLAWQAISS------
D4GM99_PANAM      QRIINLLVGAVMWFIAFQLARQVITGF-----
C6C9B7_DICP7      QRVINLFVGAVMWSMALQLARDGWQHL-----
D0ZEE1_EDWTE      QRAINLAVGGVMWFIAIALARQGLVM------
ARGO_YERPE        QRIINLFVGGVMGFIAFQLARQGFGL------
ARGO_PHOLL        QRIINGFICIIMWYIAWQLAKQGLLISD----
D3V8W8_XENNA      QRIINIFVGCVMWYIAWGLMKQGLQIFH----
B4F0Y0_PROMH      QRIINLFVGCVMWFIALQLAAQGWKNLF----
                  ** **  :  :*  :*  *  .