CLUSTAL format seed alignment for MF_01903

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

XGPT_AERHH       --------------MPKKFYVSWDNLQREARRLARRQL-PVS---QWKGIIAVSRGGLVP
XGPT_AERS4       --------------MPKKFYVSWDNLQREARRLARRQL-PVS---QWKGIIAVSRGGLVP
XGPT_ACTP2       ---------MSEKYTNEKYVVTWDMFHMHARKLAERLL-PAS---QWKGIIAVSRGGLFP
XGPT_HAEDU       ---------MSGKYTNEKYVVTWDMFHMHTRKLAERLL-PAS---QWKGIIAVSRGGLFP
XGPT_ACTSZ       --------------MSEKYVVTWDMFQMHSRKLAERLL-PAS---QWKGIIAVSRGGLFP
XGPT_MANSM       --------------MSEKYVVTWDMFHMHARKLAERLL-PAS---QWKGIIAVSRGGLFP
XGPT_HAEIN       --------------MSEKYVVTWDMFQMHARRLSERLL-PAS---QWKGIIAVSRGGLFP
XGPT1_HAEI8      --------------MSEKYVVTWDMFQMHARRLSERLL-PAS---QWKGIIAVSRGGLFP
XGPT2_HAEI8      --------------MSEKYVVTWDMFQMHARKLSERLL-PAS---QWKGIIAVSRGGLFP
XGPT_HAES1       --------------MSEKYVVTWDMFQMHTRKLSERLL-PAT---QWKGIIAVSRGGLFP
XGPT_HISS2       --------------MSEKYVVTWDMFQMHTRKLSERLL-PAT---QWKGIIAVSRGGLFP
XGPT_PASMU       --------------MSEKYVVTWDMFQMHARKLSERLL-PAS---QWKGIIAVSRGGLFP
XGPT_ECOLI       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SHISS       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SHIFL       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SHIF8       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SHIBS       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SHIDS       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECO24       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECO57       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOLC       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOHS       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOUT       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOK1       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOL6       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ECOL5       --------------MSEKYIVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_CITK8       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_ENT38       --------------MSEKYVVTWDMLQIHARKLAARLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALAR       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALCH       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALPA       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALPB       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALTI       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_SALTY       --------------MSEKYVVTWDMLQIHARKLASRLM-PSE---QWKGIIAVSRGGLVP
XGPT_KLEP7       --------------MSEKYVVTWDMLQIHARKLASRLL-PVE---QWKGIIAVSRGGLVP
XGPT_CROS8       --------------MSEKYVVTWDMLQIHARKLASRLL-PAE---QWKGIIAVSRGGLVP
XGPT_PECAS       --------------MSEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_PHOLL       --------------MSEKYVVTWDMLQIHARKLAQRLL-PVE---QWKGIIAVSRGGLVP
XGPT_SERP5       --------------MSEKYVVTWDMLQMQARKLAHRLL-PAD---QWTGIIAVSRGGLVP
XGPT_YERPE       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERPA       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERPN       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERPP       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERPS       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERP3       --------------MNEKYVVTWDMLQIHARKLAQRLL-PAE---QWKGIIAVSRGGLVP
XGPT_YERE8       --------------MSEKYVVTWDMLQIHARKLASRLL-PAD---QWKGIIAVSRGGLVP
XGPT_SODGM       --------------MSEKYVVTWDMLQIHARTMAKLLL-PAE---QWKGIIAVSRGGLVP
XGPT_BUCAI       --------------MSEKYIVTWDMLQIHTRKLANRLVKKIH---SWNGIIAVSRGGLVP
XGPT_BUCAP       --------------MSEKYIVTWDMLQIHTRILAHRLLKTKN---AWNGIIAVSRGGLVP
XGPT_BUCBP       --------------MSKKYIVTWDMLQIYARELAQKLL-PVN---QWKGIIAVSRGGLIP
XGPT_VIBCH       --------------MSKKFVITWDNMQHYCRELAQRQM-PAE---QWKGILGVSRGGLVP
XGPT_VIBC3       --------------MSKKFVITWDNMQHYCRELAQRQM-PAE---QWKGILGVSRGGLVP
XGPT_VIBVU       --------------MSNKFVITWDAMQTYCRQLAEKQM-PAD---QWKGIWAVSRGGLVP
XGPT_VIBVY       --------------MSNKFVITWDAMQTYCRQLAEKQM-PAD---QWKGIWAVSRGGLVP
XGPT_VIBPA       --------------MSKKFIITWDAMQTYCRELAEKQM-PAE---QWKGIWAVSRGGLVP
XGPT_VIBCB       --------------MSKKFIITWDAMQSYCRELAEKQM-PAE---QWKGIWAVSRGGLVP
XGPT_ALIF1       --------------MANKFVITWDNMQMYTRQLAEQLL-PAD---QWKGILAVSRGGLVP
XGPT_PHOPR       --------------MSNKFVITWDNMQMYTRQLAEKLL-PAD---QWKGIIAVSRGGLVP
XGPT_IDILO       ----------MGWHSNREFFVSWEELHRATRELARRQL-PAE---QYKGIIAVSRGGLVP
XGPT_RHIEC       -----------MSLPDKAFPVSWDQFHRDARALAWRLAGLD---QTFKAIVCITRGGLVP
XGPT_RHIL3       -----------MSLPDKAFPVSWDQFHRDARALAWRLAGLN---QTFKAIVCITRGGLVP
XGPT_AGRFC       -----------MSLPDKAFPVSWDQFHRDARALAWRLAGLD---KEFRAIVCITRGGLVP
XGPT_RHIME       -----------MSLPEKAFPVSWDQFHRDARALAWRLADNG---QEWRAMVCITRGGLVP
XGPT_SINMW       -----------MSLPEKAFPVSWDQFHRDARALAWRLADNG---QEWRAMVCITRGGLVP
XGPT_CHESB       -----------MSLPEKAFPVSWDQFHRDARALAWRLAGTN---GRWQAIVCITRGGLVP
XGPT_RHILO       -----------MSLPEKAFPVSWDQFHRDARALSWRLSGANK--GQWKAIVCITRGGLVP
XGPT_BRUA2       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGLD---REWRAIVAITRGGLVP
XGPT_BRUME       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGLD---REWRAIVAITRGGLVP
XGPT_BRUC2       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGLD---REWRAIVAITRGGLVP
XGPT_BRUSI       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGLD---REWRAIVAITRGGLVP
XGPT_BRUSU       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGLD---REWRAIVAITRGGLVP
XGPT_OCHA4       -----------MSLPDKAFPVSWDQFHRDARALAWRIAGMN---RDWHAIVAITRGGLVP
XGPT_RHOPS       ----MGSGAEASVAERRPFPVSWDQFHRDCRALTWRLNAVG----PFHAVVAITRGGLVP
XGPT_RHOP2       ----MGSDADADLGERRPFPVSWDQFHRDCRALTWRLNEVG----PFAAVIAITRGGLVP
XGPT_RHOPA       ---MTQSEPTEQKRAGRPFPVSWDQFHRDCRALSWRLNELG----PFHAVIAITRGGLVP
XGPT_RHOPB       --MIESVDLNAQERAGRAFPVSWDQFHRDCRALTWRLNEVG----PFAAVIAITRGGLVP
XGPT_BRADU       MMGGEAPELSAQERAGKAFPVSWDQFHRDCRALTWRLNEVG----PFHAVIAITRGGLVP
XGPT_NITHX       --------MTANTTPGKAFPVSWDQFHRDCRALTWRLNETG----PFHAVVAITRGGLVP
XGPT_NITWN       --------MSAHKTPDKAFPVSWDQFHRDCRALSWRLNETG----PFHAVVAITRGGLVP
XGPT_ROSDO       ----MSSKDQSRLPHEKGFHISWDQIHRDSRALAWRLDGQGPDEGAWRAVVAITRGGMAP
XGPT_RUEST       ----MSTKDPNRLPHEKGFHISWDQIHRDSRALAWRLDGLGPDDGHWRAVVAITRGGMAP
XGPT_JANSC       ----MTTQ----LPHEKGFHISWDQIHRDSRALAWRLDNHGPDDGAWKAVVAITRGGMAP
XGPT_RHOS4       --------MKERLPHEKGFHVSWDQIHRDSRALAWRLDGQGPDNGSWRAVVGITRGGLVP
XGPT_RHOS1       --------MKERLPHEKGFHVSWDQIHRDSRALAWRLDGQGPDNGSWRAVVGITRGGLVP
XGPT_RHOS5       --------MKERLPHEKGFHVSWDQIHRDSRALAWRLDGQGPDNGAWRAVVGITRGGLVP
XGPT_RUEPO       ----MSTKDPHRLPHEKGFHISWDQIHRDSRALAWRLDGQGPDEGAWRAVVAITRGGMAP
XGPT_DESVH       --------MSTADRYRKVFPVTWEQLHRDAKALSWRLLEKG----PYKGIIAIARGGLVP
XGPT_DESVV       --------MSTADRYRKVFPVTWEQLHRDAKALSWRLLEKG----PYKGIIAIARGGLVP
XGPT_DESAG       --------MADPDRYNKMFPVSWEQLHRDTRALSWRLMERG----PFKGIVAITRGGLVP
XGPT_DESPS       --------MS--DQYKRTYPISWDQLHRDSKALAWRLLDKD----FFKGIIAITRGGMVP
XGPT_CHRSD       ---------MSIDRYHQQFTVSWDQLHRDVRALCHQLVERD-----FQGIVAITRGGLIP
XGPT_GLUOX       ------MTANQTPQTVHYATVTWDQLHRDARLLAATLMQKH---GPFRGIVAITRGGLIP
                                 .   ::*: ::   : :             : .:  ::***: *

XGPT_AERHH       AALMARELGIRNVETLCISSY-DHN----NQRDLVVVKAATTAGD------GEGWLVVED
XGPT_AERS4       AALMARELGIRNVETLCISSY-DHN----NQRDLVVVKAATTAGD------GEGWLVVDD
XGPT_ACTP2       AAVLARELSIRHVETVCISSY-DHD----EQGELKVLHAAQTD--------GEGFIVVDD
XGPT_HAEDU       AAVLARELSIRHVETVCISSY-EHD----EQGELKVLHAAQTD--------GEGFIVVDD
XGPT_ACTSZ       AAVLSRELGIRHVETVCIASY-DHD----RQGELRVIHAAETD--------GEGFIVVDD
XGPT_MANSM       AAVLARELGLRHVETVCIASY-DHD----QQGDLKVIHKAETD--------GEGFIVVDD
XGPT_HAEIN       AAVLARELGLRHIETVCIASYHDHN----NQGELQVLHAAQVPNG------GEGFIVVDD
XGPT1_HAEI8      AAVLARELGLRHIETVCIASYHDHN----NQGELQVLHAAQVPNG------GEGFIVVDD
XGPT2_HAEI8      AAVLARELGLRHIETVCIASYHDHN----NQGELQVLHAAQVPNG------GEGFIVVDD
XGPT_HAES1       AAVIARELGIRHIETVCISSY-DHN----QQGNLNVLHAAQVKNG------GEGFIVVDD
XGPT_HISS2       AAVIARELGIRHIETVCISSY-DHN----QQGNLNVLHAAQVKNG------GEGFIVVDD
XGPT_PASMU       AAVLARELGIRHIETVCIASYHDHV----EQGELKVLHRAEG--D------GEGFIVVDD
XGPT_ECOLI       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SHISS       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SHIFL       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SHIF8       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SHIBS       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SHIDS       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECO24       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECO57       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOLC       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOHS       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOUT       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOK1       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOL6       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ECOL5       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_CITK8       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_ENT38       GALLARELGIRHVDTVCISSY-DHD----NQRELTVLKRAEGD--------GEGFIVIDD
XGPT_SALAR       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SALCH       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SALPA       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SALPB       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SALTI       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_SALTY       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_KLEP7       GALLARELGIRHVDTVCISSY-DHD----NQRELKVLKRAEGD--------GEGFIVIDD
XGPT_CROS8       GALLARELGIRHVDTVCISSY-DHD----NQRELKVIKRAEGD--------GEGFIVVDD
XGPT_PECAS       GALLARELGIRHVDTVCISSY-DHD----NQREMKVIKRAEGD--------GEGFIVVDD
XGPT_PHOLL       GALLARELGIRHVDTVCISSY-DHN----NQRELKVLKKAEGD--------GEGFIVVDD
XGPT_SERP5       AALLARELGIRHVDTVCISSY-DHD----NQREMKVLKRAEGD--------GEGFIVIDD
XGPT_YERPE       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERPA       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERPN       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERPP       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERPS       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERP3       AGILARELGIRYVDTVCISSY-DHD----NQRDLKVLKRAEGD--------GEGFIVIDD
XGPT_YERE8       AGILARELGIRYVDTVCIASY-NHD----NQGELKVLKRAEGD--------GEGFIVIDD
XGPT_SODGM       GALLARELGIRHVDTVCIASY-DHD----NQRDLNVLKRAEAD--------GEGFIVVDD
XGPT_BUCAI       SALLARELGLRCVDTVCIESYNYDC----LKENRKIIKKAEGN--------GEKIIVIDD
XGPT_BUCAP       SAILARELGIRCVDTVCIASYNYDC----LQKNRKIIKKARGD--------GEKIIVVDD
XGPT_BUCBP       SALLARELNIRFVDTICVSSYDHNR----LR-DLKILKYAAGN--------SSQIIIVDD
XGPT_VIBCH       AAILARELGIRYVDTVCISSY-DHD----HQRDMTVLKAPEHD--------GEGFLIIDD
XGPT_VIBC3       AAILARELGIRYVDTVCISSY-DHD----HQRDMTVLKAPEHD--------GEGFLIIDD
XGPT_VIBVU       GAILARELGIRYVDTICISSY-DHD----HQRDMTVLKAPEGD--------GEGYLIVED
XGPT_VIBVY       GAILARELGIRYVDTICISSY-DHD----HQRDMTVLKAPEGD--------GEGYLIVED
XGPT_VIBPA       GAILARELGIRYVDTICISSY-DHD----HQRDMTVLKAPEGD--------GEGYLIVED
XGPT_VIBCB       GAILARELGIRHVDTICISSY-DHD----HQRDMTVVKAPEGD--------GEGFLIVED
XGPT_ALIF1       AAILARELNIRHVDTVCISSY-DHD----HQRDMTVVKAMEGD--------GEGFIIIDD
XGPT_PHOPR       AAILARELNIRHVDTVCISSY-DHD----HQREMKVLKQADGD--------GEGFIVIDD
XGPT_IDILO       AAIVSRELNIRVVDCVAVSSYDHTE----QRDDLQVMKDVTATED------GEGFLVVDD
XGPT_RHIEC       AAIISRELNIRLIETVCIASYHDYV----NQGDMVLLKGIAPELAENG---GEGVLVVDD
XGPT_RHIL3       AAIISRELNIRLIETVCVASYHDYV----NQGDMVLLKGIAPELMENG---GETVLVVDD
XGPT_AGRFC       AAIISRELNIRMIDTVCIATRHDYV----NQGDTVLLKGVAPELTTDA---GEGVLVVDD
XGPT_RHIME       AAIVSRELNIRMIETVCIASYHDYD----TQGQMKVLKSISPEIAKDG---GEGVLIVDD
XGPT_SINMW       AAIVSRELNIRMIETVCIASYHDYD----TQGQMKVLKSISPEIAKSG---GEGVLIVDD
XGPT_CHESB       AAVIARELGIRLIETVCIASYHDYS----EQGELKVLKEISPSLLEED---GQNILIVDD
XGPT_RHILO       AAIIARELGIRVIETVCVASYHDYT----SQGQLQVLKEITPALLADD---GAGVLIIDD
XGPT_BRUA2       AAIICRELGIRLIETVCIASYHDYT----SQGEMQVLKGIGASLLENQ---GEGVIVVDD
XGPT_BRUME       AAIICRELGIRLIETVCIASYHDYT----SQGEMQVLKGIGASLLENQ---GEGVIVVDD
XGPT_BRUC2       AAIICRELGIRLIETVCIASYHDYT----SQGEMQVLKGIGASLLENQ---GEGVIVVDD
XGPT_BRUSI       AAIICRELGIRLIEIVCIASYHDYT----SQGEMQVLKGIGASLLENQ---GEGVIVVDD
XGPT_BRUSU       AAIICRELGIRLIETVCIASYHDYT----SQGEMQVLKGIGASLLENQ---GEGVIVVDD
XGPT_OCHA4       AAIVCRELGIRLIETVCIASYHDYT----SQGDMQILKGVSETLLENG---GEGVIVVDD
XGPT_RHOPS       AAIVARELGLRVIDTICVASYAHD-----KQGELQVLKGVSEQTAALGGGTGKGLLIVDD
XGPT_RHOP2       AAIVARELGLRVIDTICVASYAHD-----KQGDLQVLKGVSEQTAALGHGTGKGLLIVDD
XGPT_RHOPA       AAIVARELGLRVIDTVCIASYEHD-----KQGELQVLKGVSDQTATLGGGTGKGLLIIDD
XGPT_RHOPB       AAIVARELGVRVIDTVCIASYEHD-----RQGELQVLKGVSDSTKALGGGTGKGLLIVDD
XGPT_BRADU       AAIVARELGVRVIDTVCIASYDHN-----KQGELQVLKGISEAAMKLGGGTGKGLLIVDD
XGPT_NITHX       AAIVARELGVRVIDTVCIVSYDHN-----QKSELKVLKDISDATAKLGGGTGKGLLIVDD
XGPT_NITWN       AAIVARELGVRVIDTVCIASYDHL-----HKSELKVLKGISDMTVKLGGGSGRNLLVVDD
XGPT_ROSDO       AMIVARELDIRVVDTISVMSYHSGGGKADQRRDAKVLKAPDADMMGDG----TGILIVDD
XGPT_RUEST       AMIVARELDIRTVDTISVKSYHSGGGKADQRREAEVLKSPDADIMGDG----TGILIVDD
XGPT_JANSC       AMIVARELDIRTVDTISVVSYHSGGGKADERREAKVLKGPDADLMGDG----EGVLIIDD
XGPT_RHOS4       AMIVSRELDIRTVDTISVKSYNWQ-----EQQAPTVIKAPQAELMGDG----HGILIVDD
XGPT_RHOS1       AMIVSRELDIRTVDTISVKSYNWQ-----EQQAPTVIKAPQAELMGDG----HGILIVDD
XGPT_RHOS5       AMIVSRELDIRTVDTISVKSYNWQ-----EQQPPSVIKAPQAELMGDG----HGILIVDD
XGPT_RUEPO       AMIVSRELDIRTVDTISVKSYHHQ-----AQGQAQVLKAPDAGLMGDG----TGILVIDD
XGPT_DESVH       AAVIARELDIHLVETICISSYQWQE----QTSSHKVLKTVEGR--------GEGWLIIDD
XGPT_DESVV       AAVIARELDIHLVETICISSYQWQE----QTSSHKVLKTVEGR--------GEGWLIIDD
XGPT_DESAG       AAILARELEVRLVDTICIASYDWKS----Q-GGISVLKGVEGD--------GEGWLIVDD
XGPT_DESPS       AAIIARELDIHLIDTICISSYDWKE----KKGEADILKGFDGD--------GEGWLLIDD
XGPT_CHRSD       AALIARELNVRLVDTVCIKSYEHQD-----QGGLQVMKGIDHD--------GAGWLLVDD
XGPT_GLUOX       AAILGREMGCRLIESVSVISYAGEEG---TQHEPKVVKPPVAAGD------GEGFLIVDD
                 . :: **:  : :: :.: :               :::                 ::::*

XGPT_AERHH       LVDTGTTAKAIRELYPKAKFIAIFAKPMGEQLLDDFEVAIPQDTWIEQPWDMALEFATPI
XGPT_AERS4       LVDTGGTAKAIRDLYPKAKFITIFAKPMGEPLVDDFEVAIPQDTWIEQPWDMALEFAHPI
XGPT_ACTP2       LVDTGNTAKEIRKMYPKAKFVTVFAKPAGTPLVDDYVIDIPQETWIEQPWDLGITFVPPL
XGPT_HAEDU       LVDTGNTAKEIRRMYPKAKFVTVFAKPLGAPLIDDYVIDIPQETWIEQPWDLGITFVPPL
XGPT_ACTSZ       LVDTGNTAKEIRNMYPKAKFVTVFAKPAGAPLVDDYVIDIPQDTWIEQPWDLGLGFVPPI
XGPT_MANSM       LVDTGNTAREIRNMYPKAKFVTVFAKPAGAPLVDDYVIDIPQNTWIEQPWDLGIGFVPPL
XGPT_HAEIN       LVDTGNTARAIRQMYPNAKFVTVFAKPAGAELVDDYVIDIPQNTWIEQPWDLGLTFVPPL
XGPT1_HAEI8      LVDTGNTARAIRQMYPNAKFVTVFAKPAGAELVDDYVIDIPQNTWIEQPWDLGLTFVPPL
XGPT2_HAEI8      LVDTGNTARAIRQMYPNAKFVTVFAKPAGAELVDDYVIDIPQNTWIEQPWDLGLTFVPPL
XGPT_HAES1       LVDTGNTARAIRELYPNARFVTVFAKPAGANLVDDYVIDIPQNTWIEQPWDMGITFVPPL
XGPT_HISS2       LVDTGNTARAIRELYPNARFVTVFAKPAGANLVDDYVIDIPQNTWIEQPWDMGITFVPPL
XGPT_PASMU       LVDTGNTARAIRDMYPKAKFVTVFAKPAGAALVDDYVIDIPQNTWIEQPWDLGLTFVPPL
XGPT_ECOLI       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SHISS       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SHIFL       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SHIF8       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SHIBS       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SHIDS       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_ECO24       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_ECO57       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_ECOLC       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_ECOHS       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_ECOUT       LVDTGGTAVAIREMYPKAHFITIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMGVVFVPPI
XGPT_ECOK1       LVDTGGTAVAIREMYPKAHFITIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMGVVFVPPI
XGPT_ECOL6       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMGVVFVPPI
XGPT_ECOL5       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMGVVFVPPI
XGPT_CITK8       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQDTWIEQPWDMGVVFVPPI
XGPT_ENT38       LVDTGGTAVAIRDMYPKAHFVTIFAKPAGQPLVDDYVIDIPQDTWIEQPWDMGVAFVPPI
XGPT_SALAR       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_SALCH       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_SALPA       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_SALPB       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_SALTI       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_SALTY       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPI
XGPT_KLEP7       LVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI
XGPT_CROS8       LVDTGGTAVAIREMYPKARFVTIFAKPAGQPLVDDYVIDIPQDTWIEQPWDMGVVFVPPL
XGPT_PECAS       LVDTGGTAKAIRDMYPKAHFVTIFAKPAGQPLVDDYVIDIPQDTWIEQPWDMCVVFVPPL
XGPT_PHOLL       LVDTGGTAQAIREIYPKAHFVTIFAKPAGQPLVDDYIVDIPQDTWIEQPWDMGVVFVPPI
XGPT_SERP5       LVDTGGTAKAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMAVTFVPPI
XGPT_YERPE       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERPA       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERPN       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERPP       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERPS       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERP3       LVDTGGTATAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMAVTFVAPL
XGPT_YERE8       LVDTGGTAKAIREMYPKAHFVTIFAKPAGRPLVDDYEVDIPQGTWIEQPWDMAVTFVAPL
XGPT_SODGM       LVDTGVTAKAIREMYPKAHFVTIFAKPAGRPLVDDYIIDIPQNTWIEQPWDMGVVFVSPL
XGPT_BUCAI       LVDTGGTAKIIRKLYPKACFVTIFAKPMGRSLVDNYIIDIPQNVWIEQPWDMSISYIPPL
XGPT_BUCAP       LVDTGGTAKIIRNLYPKAYFVTIFAKPLGRLLVDDYIIDIDQNIWIEQPWDMSISYISPL
XGPT_BUCBP       LVDTGGTGKIIRNLYPKAKFVTIFAKPMGKLLVDEYIIDIPQKVWIEQPWDMGVTYQSPL
XGPT_VIBCH       LVDSGDTARKIREMYPKAKFVTVCAKPAGKDLVDEYVVDIPQDTWIEQPWDMVLSYVEPV
XGPT_VIBC3       LVDSGDTARKIREMYPKAKFVTVCAKPAGKDLVDEYVVDIPQDTWIEQPWDMVLSYVEPV
XGPT_VIBVU       LVDSGDTARKLREMYPKAKLIAVCAKPSGKELLDDYVVDIAQDTWIEQPWDMALAYAEPV
XGPT_VIBVY       LVDSGDTARKLREMYPKAKLIAVCAKPSGKELLDDYVVDIAQDTWIEQPWDMALAYAEPV
XGPT_VIBPA       LVDSGDTARKLREMYPKAKMIAVCAKPSGKELLDDYVVDIAQDTWIEQPWDMSIQYAEPV
XGPT_VIBCB       LVDSGDTARKLREMYPKAKLIAVCAKPAGVELLDDYVVDIAQDTWIEQPWDMSIQFVEPV
XGPT_ALIF1       LVDSGDTAVKLREMYPKGKLVTVCAKPAGVHLVDAYVVDIPQDTWIEQPWDMAVTYVDPI
XGPT_PHOPR       LVDTGGTAELIRAMYPKAKFVTVCAKPAGKHFIDDYVVDIAQDTWIEQPWDMAVTFVDPI
XGPT_IDILO       LVDTGNTMKFLRERLPKAKFVTVYAKPSGMEMVDDFVADLAQDTWIHFPWDMHLHYIEPL
XGPT_RHIEC       LTDTGKTAAQVRTMLPKAHFACVYAKPKGVPTVDTFITEVSQDTWIYFPWDMGFTYQEPI
XGPT_RHIL3       LTDTGKTAAQVRTMLPRAHFACVYAKPKGVPTVDTFITEVSQDTWIYFPWDMGFTYQEPI
XGPT_AGRFC       LTDTGKTALEVREMLPRAHFACVYAKPKGVPTIDTFVTEVSQDTWIYFPWDMGFTYQEPI
XGPT_RHIME       LTDTGKTAAEVRAMLPRAHFAAVYAKPKGRPLVDTFVTEVSQDTWIYFPWDLGFTYQEPI
XGPT_SINMW       LTDTGKTAAEVRAMLPKAHFAAVYAKPKGRPLVDTFVTEVSQDTWIYFPWDLGFTYQEPI
XGPT_CHESB       LTDTGKTAAIVRAMMPKAHFATVYAKPKGRPLVDTFVTEVSQDTWIYFPWDLGFSYQKPI
XGPT_RHILO       LTDTGKTAGIVRAMMPKAHFATVYAKPKGRPLVDTFVTEVSQDTWIYFPWDMGFTYQKPI
XGPT_BRUA2       LTDTGKTAAIVREMMPRAHFATVYAKPKGRPLIDTLRHGGLTGYLDLFPMGYGLHLSGAD
XGPT_BRUME       LTDTGKTAAIVREMMPRAHFATVYAKPKGRPLIDTLRHGGLTGYLDLFPMGYGLHLSGAD
XGPT_BRUC2       LTDTGKTAAIVREMMPRAHFATVYAKPKGRPLIDTFVTEVSQDTWIYFPWDMGFTYQEPI
XGPT_BRUSI       LTDTGKTAAIVREMMPRAHFATVYAKPKGRPLIDTFVTEVSQDTWIYFPWDMGFTYQEPI
XGPT_BRUSU       LTDTGKTAAIVREMMPRAHFATVYAKPKGRPLIDTFVTEVSQDTWIYFPWDMGFTYQEPI
XGPT_OCHA4       LTDTGKTAAIVREMMPKAHFATVYAKPKGRPLIDTFVTEVSQDTWIYFPWDMGFTYQEPI
XGPT_RHOPS       LVDTGKTGRMVRDLLPDAHFATVYAKPKGKPLVDTFITEVSQDTWIFFPWDTGLSFQPPL
XGPT_RHOP2       LVDTGKTGRMVRDLLPDAHFATVYAKPMGKPLVDTFITEVSQDTWIFFPWDTGLSFQPPL
XGPT_RHOPA       LVDTGKTGRMVRSMLPDAHFAAVYAKPKGRPLVDTFITEVSQDTWIFFPWDTGLSFQPPL
XGPT_RHOPB       LVDTGATARLVREMLPDAHFATVYAKPKGRPLVDTFITEVSQDTWIFFPWDLALTFQPPM
XGPT_BRADU       LVDTGKTGKLVREMLPDAHFATVYAKPKGRPLVDTYITEVSQDTWIFFPWDTALSYHPPL
XGPT_NITHX       LVDTGATARVVRAMIPDAHFAAVYAKPLGKPLVDTFITEVSQDTWIYFPWDLDLAFAPPL
XGPT_NITWN       LVDTGATARVVRGMIPDAHFATVYAKPLGKPLVDTFITEVSQDTWIYFPWDLDLAFAPPL
XGPT_ROSDO       LVDSGKTLELVRAQYPNAHFATVYAKPQGEPQVNTFITGVSQDTWIFFPWDMALQYVEPY
XGPT_RUEST       LVDSGKTLELVRTLYPKAHFATVYAKPQGEPQVDTFITGVSQDTWIFFPWDMALQYVEPY
XGPT_JANSC       LVDSGKTLELVRTLYPKAHFATVYAKPEGEPMVDTFITGVSQDTWIFFPWDMALQYVDPY
XGPT_RHOS4       LVDSGKTLELVRTLYPRAHFATVYAKPSGRPMVDTYITEVSQDTWIFFPWDMALQYVEPY
XGPT_RHOS1       LVDSGKTLELVRTLYPRAHFATVYAKPSGRPMVDTYITEVSQDTWIFFPWDMALQYVEPY
XGPT_RHOS5       LVDSGKTLELVRTLYPRAHFATVYAKPSGRPMVDTYITEVSQDTWIFFPWDMALQYVEPY
XGPT_RUEPO       LVDSGKTLELVREMYPNAHFATVYAKPKGRPMVDTFITEVSQDTWIFFPWDMALQYVEPY
XGPT_DESVH       LADTGGTARLVREMLPEAHFATVYAKPAGRPLVDTFITEVSQDTWILFPWDSEVQYVVPL
XGPT_DESVV       LVDTGGTARLVREMLPEAHFATVYAKPAGRPLVDTFITEVSQDTWILFPWDSEVQYVVPL
XGPT_DESAG       LVDTGTTARAVREMLPKAHFATVYAKPSGRPVVDTYITEVSQDTWILFPWDSEIQYVQPL
XGPT_DESPS       LVDTGRTAEVVKNLIPKAHFATVYAKPSGRPLVDTFVTEVSQDTWILFPWDTESQFAAPL
XGPT_CHRSD       LVDTGNTARAVREMLPEAHFVTVYAKPEGRPLVDQYLTEVAQDCWIQFPWDMGVAYVEPL
XGPT_GLUOX       LVDSGVTARIVRELLPKAVFACLYAKPEGKPFTDHYVTEVAQDTWVLFPWDTAPLFVPPL
                 *.*:* *   ::   * . :  : *** *    :              * .       . 

XGPT_AERHH       CDEE-------
XGPT_AERS4       CDEE-------
XGPT_ACTP2       A-RK-------
XGPT_HAEDU       A-RK-------
XGPT_ACTSZ       A-RK-------
XGPT_MANSM       A-RK-------
XGPT_HAEIN       S-RK-------
XGPT1_HAEI8      S-RK-------
XGPT2_HAEI8      S-RK-------
XGPT_HAES1       A-RK-------
XGPT_HISS2       A-RK-------
XGPT_PASMU       A-RK-------
XGPT_ECOLI       S-GR-------
XGPT_SHISS       S-GR-------
XGPT_SHIFL       S-GR-------
XGPT_SHIF8       S-GR-------
XGPT_SHIBS       S-GR-------
XGPT_SHIDS       S-GR-------
XGPT_ECO24       S-GR-------
XGPT_ECO57       S-GR-------
XGPT_ECOLC       S-GR-------
XGPT_ECOHS       S-GR-------
XGPT_ECOUT       S-GR-------
XGPT_ECOK1       S-GR-------
XGPT_ECOL6       S-GR-------
XGPT_ECOL5       S-GR-------
XGPT_CITK8       S-GR-------
XGPT_ENT38       S-GR-------
XGPT_SALAR       S-GR-------
XGPT_SALCH       S-GR-------
XGPT_SALPA       S-GR-------
XGPT_SALPB       S-GR-------
XGPT_SALTI       S-GR-------
XGPT_SALTY       S-GR-------
XGPT_KLEP7       A-GR-------
XGPT_CROS8       S-GR-------
XGPT_PECAS       S-GR-------
XGPT_PHOLL       CEGR-------
XGPT_SERP5       G-GR-------
XGPT_YERPE       S-GK-------
XGPT_YERPA       S-GK-------
XGPT_YERPN       S-GK-------
XGPT_YERPP       S-GK-------
XGPT_YERPS       S-GK-------
XGPT_YERP3       S-GK-------
XGPT_YERE8       S-AK-------
XGPT_SODGM       A-GK-------
XGPT_BUCAI       IQNYKIK----
XGPT_BUCAP       IKK--------
XGPT_BUCBP       VRDL-------
XGPT_VIBCH       NRKQK------
XGPT_VIBC3       NRKQK------
XGPT_VIBVU       NRKQK------
XGPT_VIBVY       NRKQK------
XGPT_VIBPA       NRKQK------
XGPT_VIBCB       NRKQK------
XGPT_ALIF1       AKK--------
XGPT_PHOPR       SKK--------
XGPT_IDILO       AGQES------
XGPT_RHIEC       AKGAR------
XGPT_RHIL3       AKGAG------
XGPT_AGRFC       AKGSRG-----
XGPT_RHIME       AKGTRG-----
XGPT_SINMW       AKGTRG-----
XGPT_CHESB       ADGEIG-----
XGPT_RHILO       ADDHAG-----
XGPT_BRUA2       CWRKTRLNETK
XGPT_BRUME       CWRKTRLNETK
XGPT_BRUC2       AGGKRG-----
XGPT_BRUSI       AGGKRG-----
XGPT_BRUSU       AGGKRG-----
XGPT_OCHA4       AGDKRG-----
XGPT_RHOPS       KDGAA------
XGPT_RHOP2       KDGAA------
XGPT_RHOPA       KDGAG------
XGPT_RHOPB       KDGAG------
XGPT_BRADU       RDGAA------
XGPT_NITHX       RDGAA------
XGPT_NITWN       RDGAA------
XGPT_ROSDO       RGTD-------
XGPT_RUEST       RGTD-------
XGPT_JANSC       RGKD-------
XGPT_RHOS4       RGRD-------
XGPT_RHOS1       RGRD-------
XGPT_RHOS5       RGRD-------
XGPT_RUEPO       RGTD-------
XGPT_DESVH       VNQPQQS----
XGPT_DESVV       VNQPQQS----
XGPT_DESAG       VNRRQEG----
XGPT_DESPS       IGREQR-----
XGPT_CHRSD       VDQVRSRDS--
XGPT_GLUOX       VRSEGE-----