CLUSTAL format seed alignment for MF_01911

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HPR_BACSU       MNRVEPPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG
HPR_BACVZ       MNRVEPPYDLKEALIYTQKMAQLSKALWKSIEKDWQNWLKPYDLNINEHHILWIAYQLKG
HPR_BACLD       MNRAEEPYTVKEALLFSQRMAQLSKALWKSIEKDWQQWIKPYDLNINEHHILWIAYQLNG
HPR_BACP2       MNHSEQPFDVKEALLFSQRMAQLSKALWKSIEKDWQQWIKPYNLNINEHHILWIAYQLKG
HPR_BACHK       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQMWIKPYDLNINEHHILTIAYHLKG
HPR_BACC1       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQMWIKPYDLNINEHHILTIAYHLKG
HPR_BACAN       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQMWIKPYDLNINEHHILTIAYHLKG
HPR_BACAH       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQMWIKPYDLNINEHHILTIAYHLKG
HPR_BACCZ       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQMWIKPYDLNINEHHILTIAYHLKG
HPR_BACCR       MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQQWIKPYDLNINEHHILTIAYHLKG
HPR_BACMK       MKSGEKNYSVKEAMIFSQRIAQLSKALWKCVEKDWQQWIKPYDLNINEHHILSIAYHLKG
HPR_BACCN       MKSGEKDYSIKEAMIFSQRIAQLSKALWKSVEKDWQQWIKPYDLNINEHHILSIAYHLEG
HPR_GEOTN       MKSTEQHYSIKEAMLFSQRIAQLSKALWKSIEKDWQQWIKPFNLNINEHHILWIAYHFKG
HPR_GEOKA       MKATEQHYSIKEAMLFSQRIAQLSKALWKSIEKDWQRWIKPFDLNINEHHILWIAYHFKG
HPR_LYSSC       MVLSEELYTQKEAMLYSQRIAQLSKALWKAVEKDWQQWIKPYDLNINEHHILWISYHLKG
HPR_EXIS2       -MEHEKLYPGQEALLYSHKIVQLSKALWKTVEKDWQNWIKPFDLNINEHHILWISHALGG
HPR_BACSK       MEEMDLNHPLKESIVFSHKMALLSKALWKSVEKDWQAWIKPFHLNLNEHHILWIAYQLNG
HPR_ALKHC       -MEQQTAYSLKQSIIFSHKFAQLSKALWKSVEKDWQTWIKPFNLNINEHHILWITYHLDG
                    :  .  ::::::::::. ******* :***** *:**:.**:****** *:: : *

HPR_BACSU       ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEE
HPR_BACVZ       ASISEIAKFGVMHVSTAFNFSKKLEERGYLKFSKRLNDKRNTYIQLTEEGENVFESLLEE
HPR_BACLD       ASISEIAKFGVMHVSTAFNFSKKLEERGYLEFSKKLNDKRNTYIQLTPKGEEVFLKILES
HPR_BACP2       ASISEIAKFGVMHVSTAFNFSKKLEERGFLKFSKKLNDKRNTYIELTPKGEETFHKLLED
HPR_BACHK       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACC1       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACAN       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACAH       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACCZ       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACCR       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACMK       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEE
HPR_BACCN       ASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITEKGEELLLKLMEE
HPR_GEOTN       ASISEIAKFGVMHVSTAFNFSKKLEEKGLLSFSKKQDDKRNTYIELTEKGEEVLMKLMET
HPR_GEOKA       ASISEIAKFGVMHVSTAFNFSKKLEEKGLLSFSKKQDDKRNTYIELTEKGEEVLMKLMET
HPR_LYSSC       ASISDVAKFGVMHVSTAFNFSKKLEERGFLKFSKRDDDKRNTYVELTEAGTELIVEMNKN
HPR_EXIS2       ASISEIAKYGVMHVSTAFNFSKKLEDRGLLTFSKKETDKRNTYVQLTPEGESLLLETIQA
HPR_BACSK       ATISDIASHGVMHVSTAFNFSKKLEARGLLSFSKKKDDKRNTYICLTDSGRQLFLETMRA
HPR_ALKHC       ASISDIAKFGVMHVSTAFNFSKKLEERGLLTFSKREHDKRNTYVDLTEQGRELFLETLEA
                *:**::*..**************** :* * ***:  ******: :*  * . :    . 

HPR_BACSU       FDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETSLTNIDNDFESVNG
HPR_BACVZ       FDPSRNAVFKGSQPIYHLFGKFPEVEELTCVIRHIYGEDFMEIFEKSLTNINNDFDSEDG
HPR_BACLD       YDPTRNAVLKGAQPLHQLYGKFPEIVEMMSIIRHIYGDDFMEIFEKSFSNIENEFTSEEG
HPR_BACP2       YDPARTGIVKGAQPLHDIYGKFPEILEMMCIIRNIYGEDFMEIFEKSFSNIEKDFLNERG
HPR_BACHK       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACC1       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACAN       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACAH       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACCZ       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACCR       YDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQ
HPR_BACMK       YDPENNSVFNGALELRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLENIEENFTETDQ
HPR_BACCN       YNPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLENIEENFTEQEQ
HPR_GEOTN       YDPTRNAVFNGALPLRELYGKFPEILEMMCIVRNIYGDDFMEIFERAFENIKEDFVEQDG
HPR_GEOKA       YDPTKNAVFNGALPLRELYGKFPEILEMMCIVRNIYGDDFMEIFERAFENIKEDFIEQDG
HPR_LYSSC       YHNTYHSVLEGSLALKDLYGRFPDFLDVMAVIRNIYGEDFIDIFERSFQHFRDSFDTLEE
HPR_EXIS2       FRPEENGVFRASLPLQELYGKFPELTDISAIVRRLYGDSFMDIFAETSKMITEEADRRPQ
HPR_BACSK       FNEHTYHVYQGAVPMKELYGKFPEFSELICIVRHIYGTEFIEQFDACLTDFQNDVEEKDG
HPR_ALKHC       YKPSTYSVYGGALPIKDLYGKFPEFSELLSIVRHVYGPDFIDMFETALTRLEDGFIEEDG
                :      :  .:  : .::*:**:  :: .::*.:** .*:: *      : .       

HPR_BACSU       KLKKKAK-DSAADEPAE---ELEPVNS
HPR_BACVZ       RLKKKTD-ESAVHETAE---ELEPINS
HPR_BACLD       KMKKKQE-AKEAGESIEVDKPLEPLKN
HPR_BACP2       RVTKKSEELEDSADAAEKAAKANQIV-
HPR_BACHK       KLVKK----------------------
HPR_BACC1       KLVKK----------------------
HPR_BACAN       KLVKK----------------------
HPR_BACAH       KLVKK----------------------
HPR_BACCZ       KLVKK----------------------
HPR_BACCR       KLVKK----------------------
HPR_BACMK       KLVKK----------------------
HPR_BACCN       KLVKK----------------------
HPR_GEOTN       KLVKRAP------KAEEHEKELASPG-
HPR_GEOKA       KLVKRKP------KTEEHEKELASQAN
HPR_LYSSC       RPTVKG---------------------
HPR_EXIS2       DPVIDSIKKA-----------------
HPR_BACSK       HLKLASANLFPLQPAK-----------
HPR_ALKHC       KLKAVDSETKSTV--------------