CLUSTAL format seed alignment for MF_01916

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLS_CLOPE             ------------------------------------------------------------
CLS_CLOPS             ------------------------------------------------------------
B2TQ76_CLOBB          ------------------------------------------------------------
E3GG29_9FIRM          ------------------------------------------------------------
Q180Q2_CLOD6          ------------------------------------------------------------
Q0SUY9_CLOPS          ------------------------------------------------------------
D9R3X0_CLOSW          ------------------------------------------------------------
E4RNC0_HALHG          ------------------------------------------------------------
CLSA_BACSU            ------------------------------------------------------------
A0A1Y0XPV7_BACAM      ------------------------------------------------------------
E6U0D1_BACCJ          ------------------------------------------------------------
Q5WH00_BACSK          ------------------------------------------------------------
CLS_OCEIH             ------------------------------------------------------------
CLS_LISMO             ------------------------------------------------------------
CLS_LISMH             ------------------------------------------------------------
CLS_LISIN             ------------------------------------------------------------
CLS_LISW6             ------------------------------------------------------------
Q2FWG8_STAA8          ------------------------------------------------------------
A0A0H2XGI3_STAA3      --------------------------------------MIFKLLHDTINKIYYSFKIFDG
CLS_STAAN             ------------------------------------------------------------
CLS2_STAAR            ------------------------------------------------------------
CLS2_STAES            ------------------------------------------------------------
A0A269XG22_9STAP      ------------------------------------------------------------
B9DMH7_STACT          ------------------------------------------------------------
CLS1_STAES            ------------------------------------------------------------
CLS1_STAEQ            ------------------------------------------------------------
CLS1_STAAC            ------------------------------------------------------------
A0A0H2XHS8_STAA3      ------------------------------------------------------------
A0A0H3JKV8_STAAN      ------------------------------------------------------MFFVPF
CLS1_STAAR            ------------------------------------------------------------
A0A0H3JVZ5_STAAW      ------------------------------------------------------MFFVPF
C4L225_EXISA          ------------------------------------------------------------
K0ACB4_EXIAB          ------------------------------------------------------------
D5DYP7_BACMQ          ------------------------------------------------------------
F9VD31_LACGL          ------------------------------------------------------------
D2BQ69_LACLK          ------------------------------------------------------------
A0A2Z5Y2W0_9ENTE      ------------------------------------------------------------
C8WXS3_ALIAD          ------------------------------------------------------------
E4SJR8_LACAR          ------------------------------------------------------------
A8YWN2_LACH4          ------------------------------------------------------------
Q1G7R6_LACDA          ------------------------------------------------------------
Q74LT8_LACJO          ------------------------------------------------------------
A0A087QBG6_LACGS      ------------------------------------------------------------
G4L828_TETHN          ------------------------------------------------------------
Q834N6_ENTFA          ------------------------------------------------------------
A0A0C9NY80_LACPA      ------------------------------------------------------------
Q03D64_PEDPA          ------------------------------------------------------------
A0A4R5NTZ5_LACBU      ------------------------------------------------------------
F8DR80_LACRS          ------------------------------------------------------------
F8DQG8_LACRS          ------------------------------------------------------------
A0A0N7CKV9_LACFE      ------------------------------------------------------------
F0TFK7_LACAM          ------------------------------------------------------------
G2SPV9_LACRR          ------------------------------------------------------------
D5T540_LEUKI          ------------------------------------------------------------
B1MZZ2_LEUCK          ------------------------------------------------------------
Q03YM9_LEUMM          ------------------------------------------------------------
G8PCK9_PEDCP          ------------------------------------------------------------
Q38XB9_LACSS          ------------------------------------------------------------
K8QPY8_LACRH          ------------------------------------------------------------
Q2FM09_METHJ          ------------------------------------------------------------
I7KE57_METBM          ------------------------------------------------------------
A2STU9_METLZ          ------------------------------------------------------------
F4C7E2_SPHS2          ------------------------------------------MPSIDWFL----------
F0REG6_CELLC          ---------------------------------------------MNWIL----------
F0SEL0_PSESL          --------------------------------------MPQIPYQTTLIL----------
A3UAU3_CROAH          ---------------------------------------MQYIQDNIWII----------
G7WDL9_DESOD          ----------------------------------------------MIGY----------
I4D6Z5_DESAJ          ------------------------------------------------MY----------
I4D626_DESAJ          ------------------------------------------MLISILIS----------
L0F6D5_DESDL          -----------------------------------------------MIR----------
F8FPP2_PAEMK          -----------------------------------------------MQL----------
G7W0D8_PAETH          ------------------------------------------------ML----------
Q18CT1_CLOD6          -----------------------------------------MGVIGTIFL----------
A8MKY4_ALKOO          ---------------------------------------------MNLFQ----------
C8W5E6_DESAS          MRNLKLLLVACLLVLFLTLLETNGFAYSVSILNTGYHYIADTNQTVNLFMPNYTKFGKAQ
CLS_GEOSW             --------------------------------------MRNTLRVIIFVLAVAAFLFLTN
A0A150LT19_9BACI      --------------------------------------MRNTLRVIIFVLVVAVFLFLTN
CLS_GEOKA             --------------------------------------MRNTSRVAILVVIVGALLALTN
B7GLL6_ANOFW          -----------------------MIEIGFFLARSGEQQMRNALKVVLFILAFVGFLVATK
CLS_ALKPO             --------------------------------------MKNRLNVLAFFALLFAALYISR
CLS_BACHD             --------------------------------------MKNRLNVLLFLLILSTGLYLTR
D5DAK4_BACMD          --------------------------------------MKNRLQLLIFVIGIIALLYFTK
CLS2_BACAN            --------------------------------------MKNTLKLIFFVLLLFALFVSLR
A0A6L5LQC1_BACTU      --------------------------------------MKNTLKLIFFVLLLFALFVSLR
CLS2_BACCR            --------------------------------------MKNTLKLIFFILLLFALFVSLR
D3EML0_GEOS4          ------------------------------------MDMRKGIEAVLITALLFAFYYFGM
E0RIJ1_PAEP6          --------------------------------------MRRSLLAVLIAAMVFIIYYFGL
C4L577_EXISA          --------------------------------------MLRRIQVLFSLILLAGLIAILS
K0AE21_EXIAB          --------------------------------------MLRRVQLLMTLLLTVSLIGFLS
CLS1_BACSU            --------------------------------------MLKRRLEFFFLYMMLIGAYVIW
I0JTA9_HALH3          ---------------------------------------MKQMRQIVFILLLGITFYLTL
CLS1_BACAN            --------------------------------------MKKPIIQLLLIFTIVSIVPFLL
A0R9Q9_BACAH          --------------------------------------MKKPIVQLLLIFTIVSIVLFLL
CLS1_BACCR            --------------------------------------MKKPIVQLLLIFTIVSIVLFLL
B7IX03_BACC2          --------------------------------------MKKPIVQLLLIFTIVSIVLFLL
A9VEQ6_BACMK          --------------------------------------MKKPIVQLLLIFTIVSIVLFLL
B1YEW0_EXIS2          --------------------------------------MRNRILQFALVFLVAGGIIWGL
A0A0B8RBT6_LISMN      --------------------------------------MRKLIQFLFIAVVLFLVEYFLI
A0A0E0URT5_LISMM      --------------------------------------MRKLIQFLFIAVVLFLVEYFLI
A0AEJ4_LISW6          --------------------------------------MRKLIQFLFIAVVLLLVEFVLI
E6XF61_CELAD          ------------------------------------------------------------
G2PJ59_MURRD          ------------------------------------------------------------
G0L287_ZOBGA          ------------------------------------------------------------
E1WLD8_BACF6          --------------------------------------MIDWNYIASVIATVA-------
Q64YC9_BACFR          --------------------------------------MIDWNYIASVIATVA-------
E6STH3_BACT6          --------------------------------------MFDWNYIAGQIATIA-------
F2KVH0_PREDF          --------------------------------------MIYVHWFTLVI-----------
A6LEV6_PARD8          --------------------------------------MLAAIHIQLIVGTI--------
F4KNV2_PORAD          ------------------------------------------MWTTVLT-----------
G0EI26_BRAIP          ------------------------------------------------------------
C7N8V3_LEPBD          ------------------------------------------------------------
D1AL33_SEBTE          ------------------------------------------------------------
C0QIT7_DESAH          ------------------------------------------------------------
A5N6C2_CLOK5          ------------------------------------------------------------
C1FU71_CLOBJ          ------------------------------------------------------------
D9SSA2_CLOC7          ------------------------------------------------------------
Q8R663_FUSNN          ------------------------------------------------------------
F4LIP6_TREBD          ------------------------------------------------------------
                                                                                  

CLS_CLOPE             ---------------MHLFINM---IFLINIVFIISIIFIER--RNPQTTWAWILILTFL
CLS_CLOPS             ---------------MHLLINI---IFLINIIFIISIIFIER--RNPQTTWAWILILTFL
B2TQ76_CLOBB          ---------------MNILLGIGMLVLILNIFFSLSLIFIER--KDPTTTWAWLLILIIL
E3GG29_9FIRM          ----------MTFSFFTLASPFSVFVFIVNILFSFTIIFLER--KTPQSTYAWLLFLWII
Q180Q2_CLOD6          -------MFDISFFEMSIYEIAVTTIYIINFMVILNLIFREK--RNINTTLTWLLILVLI
Q0SUY9_CLOPS          ----------------MIFTFFSNLVHIVNLLTIFYMIFKEN--RSSKSIISWTLVLFIL
D9R3X0_CLOSW          -------MEAAWIQTVGIWNWLMDHLIYINLILSIIIVFFQR--RDPKAVWTWLLALYFI
E4RNC0_HALHG          ---------------MNLFTYLPSAIIISNIIFIILLIFFER--RDPTATWGWLLILTLI
CLSA_BACSU            ---------------MSISSILLSLFFILNILLAIIVIFKER--RDASASWAWLLVLFFI
A0A1Y0XPV7_BACAM      ---------------MSISFILFGFFFILNILLAIIMIFKER--RDASASWAWLLVLFFI
E6U0D1_BACCJ          -----------------MASILLTTLFIINILFAIVIIFIER--KDASATWAWLMILFFI
Q5WH00_BACSK          ---------MMIESAFAIPTYLLVALMIVNILLAAILIFIER--KDAQATWAWLLILFFI
CLS_OCEIH             ---------------MGITSLLLGLTFVLNIALAISIIFLER--KDPTSSWAWVMVLLFI
CLS_LISMO             ---------------MGLLAYLLVILLILNVFFAAVTVFLER--RDTSATWAWLLVLTFV
CLS_LISMH             ---------------MGLLAYLLVILLILNVFFAAVTVFLER--RDTSATWAWLLVLTFV
CLS_LISIN             ---------------MGLLAYLLVILLILNVFFAAVTVFLER--RDTSATWAWLLVLTFV
CLS_LISW6             ---------------MGLLAYLLVVLLILNVFFAAVTVFLER--RDTSATWAWLLVLTFV
Q2FWG8_STAA8          ---MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMER--RSANSIWAWLLVLVFL
A0A0H2XGI3_STAA3      RFQMIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMER--RSANSIWAWLLVLVFL
CLS_STAAN             ---MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMER--RSANSIWAWLLVLVFL
CLS2_STAAR            ---MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMER--RSANSIWAWLLVLVFL
CLS2_STAES            ---------MALHQSNIIINILLVSAFLLNLVFAFIIIFMER--RTANSIWAWLLVLVFL
A0A269XG22_9STAP      ---MVEIFTMTFAHSNLIINIILIGAFILNLAFAFTIIFMER--RSANSIWAWLLVLVFL
B9DMH7_STACT          ----MYYLELLLQQTNLVFNIILIALFILNLFFSFTIVFLER--RSPGSIWAWLFVLAFL
CLS1_STAES            ------MNFGF---LGTILTILLVVGFITNVVLAFVIIFLERDRRTASSTWAWLFVLFVL
CLS1_STAEQ            ------MNFGF---LGTILTILLVVGFITNVVLAFVIIFLERDRRTASSTWAWLFVLFVL
CLS1_STAAC            ------MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVL
A0A0H2XHS8_STAA3      ------MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVL
A0A0H3JKV8_STAAN      FIGEKTMRYTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVL
CLS1_STAAR            ------MQFSFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVL
A0A0H3JVZ5_STAAW      FIGEKTMRYTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVL
C4L225_EXISA          ----------MEVTIGLIIVILTWLILLLNLTFAITIIFFER--RDIGTTWAWLLVLFFL
K0ACB4_EXIAB          ------------MDYTLILTILLYVVLIANIAAAIAILFFER--RDVSATWAWLMILFFL
D5DYP7_BACMQ          ------------MEFAHIFTLSVSVVTAINILLAGILIFIER--RDIGSTWAWLLILFFI
F9VD31_LACGL          ---------------MGILAIVELSIFVLNFFLSLTIIFRER--KSTSTTWAWIFVVNLL
D2BQ69_LACLK          ---------------MSFIALFELALFFLNVILSFVIIFRER--KSTAATWSWLFVVNLL
A0A2Z5Y2W0_9ENTE      ---------------MSIINNLFSVIFFINILLSLIIVFRER--KQTAQTWAWLLVLLFI
C8WXS3_ALIAD          ---------------MPWLHIAYLLIFALDLVTACVIIFVER--HNAAVTWAWLMVLLFI
E4SJR8_LACAR          ---------------MIWWHDFIRIIFITNTILAFYIVFHRK--RSVSTTWAWLIILLIL
A8YWN2_LACH4          ---------------MVWWHDFIRIIFITNTLLAFYIVFHRR--RSVSTTWAWLIILLIF
Q1G7R6_LACDA          -------------MTAISWIDIWHIIFFANAILALWTVFHRK--RSVAASWAWLIVLIIL
Q74LT8_LACJO          -----------MGGILIFSNEFWALLWAVNTILAFYVVFHRK--RSVATSWAWLIILLIF
A0A087QBG6_LACGS      -------------------------------------MFHRK--RSVATSWAWLIILLIF
G4L828_TETHN          ---------MDLRTDLAILYQIIWGLILINTVVAFITVFRRP--RSITSILAWMMTLVFL
Q834N6_ENTFA          ---------------MKIFVWILLFLLVINVIAALITVFRKP--RSISSVLAWMMTLIFL
A0A0C9NY80_LACPA      ---------------MSLITWLILIILVLNTFGAIFTVLREV--RDISTTWAWLLVLIFL
Q03D64_PEDPA          -----------MFQIIKDI---IYIILILNIIGAVYTVFRQR--RDIAATWAWLLVLFFL
A0A4R5NTZ5_LACBU      -----------MTIDWSMV---FNVIVVINAILAIFTVFREK--RDIAAIWAWLLVLVFL
F8DR80_LACRS          -----------MALTWTIIWWCLLLVILVNEIAAIYTVFREK--RDIAATWAWLLVLTLI
F8DQG8_LACRS          ---------MDIVWTWDVIRRIIEVLWLINIAFAVWTVFRSR--RDIASTWAWLLVLTIL
A0A0N7CKV9_LACFE      ------------MITWDTIRYVIETIWLINLALAFWTVFRER--RDIASTWAWLLVLSFL
F0TFK7_LACAM          ----------------------------------------------MVATWAWMLVLTIL
G2SPV9_LACRR          ---------------MGTVIWIIILILLLNTTAAIITVFKEK--RDIAATWAWLLVLNLL
D5T540_LEUKI          --------------------MIVSVLLVINTFVAIITVFSQK--RDIATIWAWLLVLIAL
B1MZZ2_LEUCK          -------------MLRDSLWIIVILLLIVNTLGAIVTVFSQK--RDIATIWAWLLVLITM
Q03YM9_LEUMM          -------------MLRTSFWIVILIALVINTIISFIAVFRQK--REIATIWAWMLVLLLL
G8PCK9_PEDCP          ------------------MLIIESALYTVNFFIAVMVALFEK--RDISAAWAWLLVMTLL
Q38XB9_LACSS          --------------MTTIIIIILSLILVINTTGAIITVFRQS--RDIAATWAWLLVLILL
K8QPY8_LACRH          ----------------MWLGLIVGGLYIINAFIAIVTVFRSH--RDISAVWAWLLVLLLL
Q2FM09_METHJ          ---------MIHDLILVIHNFLVPIIFIINIIFAITVVFIER--KNPTTTIAWLMALLLL
I7KE57_METBM          ----------------MALEIILAIILVLNVIFAVTIVFFER--RNPTAALAWLVVLFSL
A2STU9_METLZ          ---MYPMIDLLSVIFGELMWFFQVIVVLMDIAACIVVIFLER--RSPQAALTWVMVMIFL
F4C7E2_SPHS2          ---------------------VAEITYILLVIGVCLRIIYET--RSSTKTLAYLLLTIFV
F0REG6_CELLC          ---------------------LLEILYALLLLFTCLRIIYDT--RGTTKTLAYLLGAVFL
F0SEL0_PSESL          ---------------------IGEVAYIVILIGVCLKIIYDT--RSSSKTVAYLLLVIFI
A3UAU3_CROAH          ---------------------LLIVNYAVALVTAFFVLLHN---RNPSRTLSYFLILIVL
G7WDL9_DESOD          ---------------------LMLLISLLQVVLLGREIILEN--RSPGNTVTWIFILALF
I4D6Z5_DESAJ          ---------------------WLILLLFVQIVLFGSVILLEN--KDPGKTVTWLFILSLL
I4D626_DESAJ          ---------------------TVILITVVQLIILGSVVFLEN--RDPSKTIIWLLILGAL
L0F6D5_DESDL          ---------------------FFIGLALITFFLALVIVYLEK--ENPENTTSWLSFLGVL
F8FPP2_PAEMK          ---------------------WIILALILFILQILTIIIGEF--RHPPKALAWLFILFVI
G7W0D8_PAETH          ---------------------WLLLVLIVFIFQTGTILLFEF--RKPSKAVAWLFILFCF
Q18CT1_CLOD6          ---------------------FYLIISYLAGAIISVIILLEN--RDPAKTMSWLLMFIIF
A8MKY4_ALKOO          ---------------------VFTTIYTIVNIIIAIDILLDN--RDPSSTVAWIMVLFLV
C8W5E6_DESAS          YWKLAT--------------ELVAVFFGLSNLLIAILIVFEN--RSSSRTVAWLLVLLAF
CLS_GEOSW             DYWEG------------KLLGGLSILISCSVVFIAFVISLEN--RKPAHTITWLVVLGSF
A0A150LT19_9BACI      DYWEG------------RLLGVLSILISCSVIFIAFVISLEN--RRPAHTIAWLVVLGSF
CLS_GEOKA             GFWEG------------KLLGLFSVLMSCSVIFIALVISLEN--RKPAQTIAWLAVLGSF
B7GLL6_ANOFW          NYWEG------------WLLGTFSLFVTLSVIFISFVIFLEN--RHPTKTLTWLVLFSSF
CLS_ALKPO             GFLQS------------WMVGTLSVVFTLSVIFIGIIIFFEN--RHPTKTLTWLLVLAAF
CLS_BACHD             SFWQG------------WIVGAFSVLITITVVFIGIVIFLEN--RHPTKTLTWLMVLAVF
D5DAK4_BACMD          GYWDG------------KFIGVLSILITISVVFIGLVISLEN--RHPTQTLTWLVVLGGF
CLS2_BACAN            MFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLEN--RHPSKTLTWLIVLGIF
A0A6L5LQC1_BACTU      MFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLEN--RHPSKTLTWLIVLGIF
CLS2_BACCR            MFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLEN--RHPSKTLTWLIVLGIF
D3EML0_GEOS4          -HYFGK-----------TTGTVIGIFSTLTVVSIGFMIFMEN--RHPSSTMAWILLLALV
E0RIJ1_PAEP6          FNYIGK-----------NEGTVISIFSTLTVISISLIIFTEN--RNPSTTMSWILLLALL
C4L577_EXISA          YYWSS------------QVIGLFSILVFLTTFSILLVILLEN--RNPQRTLIWAIVMIGF
K0AE21_EXIAB          YYWSV------------YMVGWLSLVIILVVLSVFVIILLEN--RNPERTLVWALVMMAL
CLS1_BACSU            FFPVS-----------RLEFYGGLLCYISIILFSIYSLILEN--RTSQHTLLWIHILVFF
I0JTA9_HALH3          FSEQP-----------FPIRVSAAAVYIVIIVSVCYVLILEN--RSPHKTLLWLYSILFF
CLS1_BACAN            NTSYI------------SLYTFVGVLWSITIVGISFVIFIEN--RSPQSTLAWFLVLALL
A0R9Q9_BACAH          NTSYI------------SLYTFVGVLWSITIVGISFVIFIEN--RSPQSTLAWFLVLALL
CLS1_BACCR            NTSYI------------SLYTFVGALWSITIVGISFVIFIEN--RSPQSTLAWFLVLALL
B7IX03_BACC2          NTSYI------------SLYTFVGALWSITIVGISFVIFIEN--RSPQSTLAWFLVLALL
A9VEQ6_BACMK          NTSVI------------SLYTFVGALWSITIVGISFVIFIEN--RSPQSTLAWFLVLALL
B1YEW0_EXIS2          YQLGY------------LFYVLT-ISATVVPLAVIMIIFIEN--RTAESTIAWFLVLIFL
A0A0B8RBT6_LISMN      NQAAI------------LFLVTSGLIQLCGLIIVIRLLLFDQ--RNTSSKVAWIAVIFIL
A0A0E0URT5_LISMM      NQAAI------------LFLVTSGLIQLCGLIIVIRLLLFDQ--RNTSSKVAWIAVIFIL
A0AEJ4_LISW6          NYATL------------LFLLTSIIIQLCGIIIAIRLLLFDQ--RNTSSKVAWMAVIFIL
E6XF61_CELAD          -----------------MGLHIAYTLYILIALTLVVSILLHG--AKPSKILGWLLAIFTV
G2PJ59_MURRD          --------MNFNESIQLMLIPILIGLYIIIALLMVVSLLLNG--VRPSKTLAWLLAIFTI
G0L287_ZOBGA          -------------------MTIALIVYFSLALFLVGRLLLYG--IRPTKTLAWLLAIFTI
E1WLD8_BACF6          ----------------------FDIIYFGAIIGTIVIVILDN--RNPVKTMAWILILMFL
Q64YC9_BACFR          ----------------------FDIIYFGAIIGTIVIVILDN--RNPVKTMAWILILMFL
E6STH3_BACT6          ----------------------FDIVYFGAIIGTIVVIILDN--RNPVKTMAWILVLMFL
F2KVH0_PREDF          --------------------------YVVVIIMVMVRVLMDN--RQPAKTMAWMLVLTFI
A6LEV6_PARD8          ----------------------FIILYSVTILGLVLVIITEN--RNPLKTIPWVIVLLLA
F4KNV2_PORAD          ------------------------ILYTLLVVGVVVVILTGG--DDIYRMFSWLMVVIFV
G0EI26_BRAIP          ------------------------------MVSIAIKMLLEN--RPPYSFIAWLTVLVFL
C7N8V3_LEPBD          -------MIHELIVILSTWIIPIERIHYLLIAILLVSVLLSD--KSPNAMLAWIFTIFTF
D1AL33_SEBTE          -------MMNSLEIFSW-----FEHLYIVVVLIFVIGILASG--KKSGSIMAWIFTVLFI
C0QIT7_DESAH          ---------------MADWRAVLLVLLYVYIFITIFYLLLDN--RETATTLSWLLVFLVF
A5N6C2_CLOK5          ------------------MRNILYFVIIINAILSVTVIILER--KNPEKTIAWLSVFIVL
C1FU71_CLOBJ          ----------------MSFKNIFSLFFIINIIISIILIVIER--KKPEKTIAWLLIFFIF
D9SSA2_CLOC7          -----------MTIISFSLKVFLNYIIYFNVLISILIIIREK--KQPEKTLSWALFLMAI
Q8R663_FUSNN          -------MQDISKILLTLVQLFLQYVWVANLFFIIVIIMIEK--KNPLYTILWIFLLTLV
F4LIP6_TREBD          ------------------MNILWDIVHTLNILFIGFILFFER--KESARRMAWLLTLVLL
                                                                          :       

CLS_CLOPE             PILGFIIYILFGQNITREKNFKRKILDDKTKQKYLNS-FKSHY------KLDNISLKY--
CLS_CLOPS             PILGFIIYILFGQNITREKNFKRKILDDKTKQKYLNS-FKSHY------KLDNISLKY--
B2TQ76_CLOBB          PGFGFVLYLLFGQNLSRQKIFKEKTQIDEIKRRNLSSRYGNRS------NCHDGGDKF--
E3GG29_9FIRM          PVLGFVFYLFFSQNLTKRKIYRYNTPENEQYQLLLRRQKKALVDRQRIAKNKTIAKKY--
Q180Q2_CLOD6          PALGFILYIAFGRNISKNNMFRLKEKDDKIIKSNILDTQVKLQSTS---EIDSDIHQH--
Q0SUY9_CLOPS          PYIGLILFLMLGRKVNTKDIFIMKKSELTLFDKHI----KKLNNTS---NDKFKISNH--
D9R3X0_CLOSW          PVFGILFYLLLGQDMRKGKMFRVKEVEDRVRYSAKNQEEFLKSHDI--SLVSSLSRDY--
E4RNC0_HALHG          PVLGFILYLFLGLTPKKRKTFRRKQHIDELKNMSKERKEELLAEVR--SNFSKLERN---
CLSA_BACSU            PVLGFILYLLFGHNLRRKHLFQWEDRKKI-GIERLLKHQLEDLETKQFQFNNRATFDN--
A0A1Y0XPV7_BACAM      PILGFILYLLFGHNLRRKHLFQWEDRKKI-GIEKLLKSQLKDLKSRQFQFNNRATVDN--
E6U0D1_BACCJ          PFLGFIIYLFLGQNLTRRRLFDWEGIRKI-GIENLIKEQIRQIKNKNHTFNNPIVDQY--
Q5WH00_BACSK          PLGGFIIYIFLGQTLTRRKMFEWEGIKKV-GLEHFIEEQKRDLLDTSFRFYSPTVDKN--
CLS_OCEIH             PILGFFLYLIFGKPISNRKIFSWDKKSRL-GVKTTVQSQLRLLEENQFEFNQPDLIEH--
CLS_LISMO             PIFGFIIYLIFGRKLSGKKIFDWKGQEKI-GIQESTANQIEMIRQKEFPFSDPNVKKH--
CLS_LISMH             PIFGFIIYLIFGRKLSGKKIFDWKGQEKI-GIQESTANQIEMIRQKEFPFSDPNVKKH--
CLS_LISIN             PIFGFIIYLIFGRKLSGKKIFDWKGQEKI-GIQESTANQIEMIRQKEFPFSDPNVKKH--
CLS_LISW6             PIFGFIIYLIFGRKLSGKKIFDWKGQEKI-GIQESTANQIEMIRQKEFPFSDSNVKKH--
Q2FWG8_STAA8          PLFGFILYLLLGRQIQRDQIFKIDKEDKK-GLELIVDEQLAALKNENFSNSNYQIVKF--
A0A0H2XGI3_STAA3      PLFGFILYLLLGRQIQRDQIFKIDKEDKK-GLELIVDEQLAALKNENFSNSNYQIVKF--
CLS_STAAN             PLFGFILYLLLGRQIQRDQIFKIDKEDKK-GLELIVDEQLAALKNENFSNSNYQIVKF--
CLS2_STAAR            PLFGFILYLLLGRQIQRDQIFKIDKEDKK-GLELIVDEQLAALKNENFSNSNYQIVKF--
CLS2_STAES            PLVGFILYLLLGRQIQREHIFKLAKEDKV-GLEMIVDEQLEALKKQDFSKGNHQIVKF--
A0A269XG22_9STAP      PLLGFILYLLFGRQIQRDHIFTLDKDDKV-GLEMIVDEQLEALKDKNFSKGNHQIVKF--
B9DMH7_STACT          PILGFIIYLLFGRQIQREHIFKINEEDKT-GLEMIVQEQAEALKNDEFSKGNHVIVKH--
CLS1_STAES            PVIGFILYLFLGRTVSKKKMEKNNGDELN-AFEDLVQDQIDSFDKHNYGYINDQVIKH--
CLS1_STAEQ            PVIGFILYLFLGRTVSKKKMEKNNGDELH-AFEDLVQDQIDSFDKHNYGYINDQVIKH--
CLS1_STAAC            PLIGFILYLFFGRTVSARKLNKNNGNVLT-DFDGLLKQQIESFDKGNYGTDNKQVQKH--
A0A0H2XHS8_STAA3      PLIGFILYLFFGRTVSARKLNKNNGNVLT-DFDGLLKQQIESFDKGNYGTDNKQVQKH--
A0A0H3JKV8_STAAN      PLIGFILYLFFGRTVSARKLNKNNGNVLT-DFDGLLKQQIESFDKGNYGTDNKQVQKH--
CLS1_STAAR            PLIGFILYLFFGRTVSARKLNKNNGNVLT-DFDGLLKQQIESFDKGNYGTDNKQVQKH--
A0A0H3JVZ5_STAAW      PLIGFILYLFFGRTVSARKLNKNNGKVLT-DFDGLLKQQIESFDKGNYGTDNKQVQKH--
C4L225_EXISA          PLIGFFVYIFFGRLIKSQNFYEVEEEKRE-AYHHHVAEQLDQLDQSTAPFNHPLLLKH--
K0ACB4_EXIAB          PVIGFLIYLLFGRSLKQETFYHVPEEQRA-ARERLLTEQTTDTISPGTP-----LHPY--
D5DYP7_BACMQ          PIVGFIVYLFFGRQLKQKNFYKLSSDERE-YLRSSVDEQLKELKATHEYRND-LLIQH--
F9VD31_LACGL          PVFGFILYILVGRGIAHYRIFKVQRAFRV-GFEEQLKRTWRVYNEEGFIKKITKNHGI--
D2BQ69_LACLK          PIIGFILYLLIGRGISHYRIFKDRKRFQL-GFEKQLEHAEKSYTDRLFIKKMRQNHVI--
A0A2Z5Y2W0_9ENTE      PILGFVLYIFLGKGISKERIFDMKMQAKI-GMNAEIEKEKQTLIQGMFPHPATGLADS--
C8WXS3_ALIAD          PVGGFILYVLFGQHISRYRLARFRLRNAP-WVARAAERQHRQVESGHVVYKEPAAQRH--
E4SJR8_LACAR          PVVGITLYAFFGRGISQENIFAINKQKHI-GLHNVQESITEAPK---HVSPSDTSSAG--
A8YWN2_LACH4          PVVGITLYAFFGRGISQENIFSINKQHHI-GLRNVQKSIAKAPK---EVSPSDTSKLG--
Q1G7R6_LACDA          PVVGFIIYGFVGRGISQEKLFAINRQKHN-GLSNVQKMITEAPA---KIDQSDTSPSA--
Q74LT8_LACJO          PILGFILYGFIGRGLSQENLFAINNQKHI-GLNKVNKMIPRVPK---SAGPTDTSKEA--
A0A087QBG6_LACGS      PVLGFILYGFIGRGLSQENLFAINNQKHI-GLNKVNKMIPRIPK---DTGPTDTSKEA--
G4L828_TETHN          PGLGFILYAFCGRGIDRETVYLFSEQHQK-RIREINKMIEKNNQ---YYPPKTYPYEA--
Q834N6_ENTFA          PGIGFIIYLFCGRGIDGQEVFKLSDDEKQ-MVQRIKEKVDVDNKKAGRDKRYDLLYDA--
A0A0C9NY80_LACPA      PIVGFGFYLFAGRGLSTKKLQRIQHEYES-GVKAFVSLQKHENARNKLLPPTDYTPAA--
Q03D64_PEDPA          PGVGFVIYAFVGRKLPENKLFPLKSKTRL-QLDQVMEHQRRELKKNEFTAADQVVKDS--
A0A4R5NTZ5_LACBU      PLVGFIAYAFLGRKLPKNRLFKLHKHVQM-QLDERLNEQRKQLGHDEKTPADEVVTEA--
F8DR80_LACRS          PGFGFILYAFFGRKLPHKQLARIKSQTQL-KLKQALERQKQQF-INMPKPKDQIVQIY--
F8DQG8_LACRS          PVVGFILYLFVGRQLSHDEIFSIQDEQKQ-LRTKYLEKQRKLSEEHELMPKGSRLSRD--
A0A0N7CKV9_LACFE      PVVGFVAYLFVGRKLSHDQIFTIQDEQRR-ILEQYKHQQQRLLEAQKLLPKEEQSRRD--
F0TFK7_LACAM          PGIGFILYLFFGRQLSQDEIFAIQKEQKE-TRNHYLNQQKKMLQEYDLLPRKERVPRV--
G2SPV9_LACRR          PVVGFVIYLFAGKKISKEKIFDLRTQERT-GISQLVALQKELWNEKELMPSDLLTDEA--
D5T540_LEUKI          PVVGFFIFFLVGSRISNKKIFRLRTQDQR-GLEQIANNQKRQLHKIEQLLP--IPDSA--
B1MZZ2_LEUCK          PVVGFFIFFLVGSRISNKKIFRLRTQEQR-GLEQIADNQRQQLQKIEQLLP--VPDAA--
Q03YM9_LEUMM          PVVGFAIFFLAGSRISSKKIFRLRTQEQR-GLDQIALNQKKQLQDIENLLP--IPYSA--
G8PCK9_PEDCP          PGIGIILYLFLGRKLNKQQIFNLKTQEQF-GIVEMANYQKK--SRHNRIKL--KYELQ--
Q38XB9_LACSS          PVIGFGFYLFFGKKLSAEHLYDLRTQAKL-GIDERVTQQKAELRQRRKQNHHSTTPEI--
K8QPY8_LACRH          PFVGFLIYFVFGRKLRADRMQDLMTQRLL-GINDLVVQQQEALAAGQPLIGTPGSGGV--
Q2FM09_METHJ          PVIGFVLYLFIGQSFYRDRMFHVKKEDDD-ELTQIIESQKKELFVHSVPATHPISDSY--
I7KE57_METBM          PSIGFVLYLLFGQNYTRQKMFVIKREEDRRFLQEVFLEQYREFADPHYRFSTPEAEEF--
A2STU9_METLZ          PFFGLVMYLFFGRHLYGSHIFSKKTQADL-MLAAQAEEQFHKITENALELA-PNISRF--
F4C7E2_SPHS2          PIAGIILYFSIGINYRNRSMYSKKLLSDQKLQERLKIQIYKSSFDALHSVGDYGLSY---
F0REG6_CELLC          PFLGIIIYFSFGINYRKHKMYANKFLLDSKQRKVLEKEIIAHSKEVLENGNEPAKSR---
F0SEL0_PSESL          PIIGIIFYFSFGINYRKSKIYNKKLEIDESLKEVFKRRLIDLYQYFSTSKNPSLLNN---
A3UAU3_CROAH          PFVGIFVYYFFGQEYRKEKLFDKKKVMSNSILKKWEKRLLVDDTDIEGEKNDIIEKQ---
G7WDL9_DESOD          PVLGLILYILFGKSTHGPMFHGK--HYQDNPINRWVSQQQFAIKNKELLSHREMNFD---
I4D6Z5_DESAJ          PVLGFLLYVLFAQRQRNQLFKKK--TLISKRLPYNSDQQETLLEQECPMLYQERSID---
I4D626_DESAJ          PILGALIYLMLGRVVRKHQLSQH--TQL-LPGPTEEILKERQGKSDYDDQTTGILIN---
L0F6D5_DESDL          NVFGFVLYLIFGCTPIKNRLFRR--KHIPGDRLPRLTHHQVESMNQDHVFFQESLIG---
F8FPP2_PAEMK          PVIGFVMYYFLAKEYRQRRKVRRRGLGLVHDLRQIGKHMKAADPQIEEEHLQGWRHE---
G7W0D8_PAETH          PLIGFVVYYFVAQDYKKRKMVRKGGSQLFREFRERLWSQSRVIENVEQMHNPHFKHQ---
Q18CT1_CLOD6          PGVGLMIYAISGRNIRKRKLFKTQKLANNIK-EKKLFDTLEKITEIVELEKESIKQNKLL
A8MKY4_ALKOO          PGVGIFLYFYIGRNHRKQKTFIKKRREDYEI-LNHLLSNQLGFIDYGEMFKRNFDDT---
C8W5E6_DESAS          PILGFVLYILIGQKPRKRKKVKDHLQADDLLQLKSLLDKQLKMLDGPEHAIDKNIYA---
CLS_GEOSW             PLIGFFFYLMFGRNYRKQRLFQKKAMLDEQTFLKFQGQREWAIEQM-PIGEHQ-------
A0A150LT19_9BACI      PVLGFFFYLMFGKNYRKQRLFQKKAMLDEQTFLKFQTHHQWDVEQL-AIAEHQ-------
CLS_GEOKA             PIVGFLFYLLFGRNYWQQRRYKKKADFDEAVLLKFQEPSPIAVERL-PMAPHQ-------
B7GLL6_ANOFW          PLVGFILYFLLGQNYRKKRLFRKKALLDEQTFRKLERNERHDAQTL-YMKPHQ-------
CLS_ALKPO             PVVGFFFYLMFGQNHRKSKRFSKKAIEDERAFQKIEGQRQLNEEQLKKMGGHQ-------
CLS_BACHD             PVVGFIFYLMFGQNHRKSKTFMKKALSDEEAFEKIEGNRQLNEEQLQKMGGHQ-------
D5DAK4_BACMD          PVIGFFFYLLFGRNTRKRRLFAKKAKLDEQVLLKMERDSGILENHFEQLGTSR-------
CLS2_BACAN            PVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERIL-RNHKHQ-------
A0A6L5LQC1_BACTU      PVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERIL-RNHKHQ-------
CLS2_BACCR            PVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERIL-RNHKHQ-------
D3EML0_GEOS4          PIVGLVFYFLFGQNYFKRRKYDKKARKDGLVYT--SEVLRKNTPDVSCFKPEV-------
E0RIJ1_PAEP6          PVVGLPLYFLFGQNVFKRRKYDKKALRDQQAYDRIEKDALRVKRDLTCFTDEQ-------
C4L577_EXISA          PVIGLFAYFVFGQNYRRKRMFKEKAMLDEETYLAYRQKAMTLSPSLMFAHDDY-------
K0AE21_EXIAB          PVVGVFVYFTFGQNYRRKRMFRLKAMLDEESYIKYRTQFDHGVHNPVFKHGHY-------
CLS1_BACSU            PIVGYVFYLFSGQLYVKGKLFKTKRM-YNREKLRKLFDKEETPEVTGLKDNQE-------
I0JTA9_HALH3          PVVGYVFFVYSGQLQVRGHLFESKRE-DNQRYLDSSIDKNTSSGWNQLTS-EE-------
CLS1_BACAN            PVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSERS-------
A0R9Q9_BACAH          PVIGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLNERS-------
CLS1_BACCR            PIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERS-------
B7IX03_BACC2          PIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERS-------
A9VEQ6_BACMK          PVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELSLTVPLHERS-------
B1YEW0_EXIS2          PILGVIIWMMFGRNPRRRRRN-RRSHDERMLLKQAIRPVRSLAVSELPPNH---------
A0A0B8RBT6_LISMN      PVLGTISYLVFGRNPATRKFSTAQVMEKAKLI-NAIHAIPNNTNEKLPRLSKR-------
A0A0E0URT5_LISMM      PVLGTISYLVFGRNPATRKFSTAQVMEKAKLI-HAIHAIPNNTNEKLPRLSKR-------
A0AEJ4_LISW6          PVLGTISYFVFGRNPATRKFSTAQVMEKAKLI-NAIHAIPNNTNEKLPRLSKR-------
E6XF61_CELAD          PVGGILLYLLLGRNRRKNKLILLKK-DRFFKFPKPTIAHMAAMRGQFK------------
G2PJ59_MURRD          PVAGALLYILFGRNRRKSKMFSLK--NQFNPLDELENAHCHSEISANKQ-----------
G0L287_ZOBGA          PVGGMLFYFVLGRNRRKNKFYRLKKTEEISAYLKTVEAYCDDIDRNNGVNVPEPIKG---
E1WLD8_BACF6          PVVGLVFYFFFGRSQRREKIIGKKSYDRLLKKPMA--EYLAQNCCETPKEYER-------
Q64YC9_BACFR          PVVGLVFYFFFGRSQRREKIIGKKSYDRLLKKPMA--EYLAQNCCETPKEYAR-------
E6STH3_BACT6          PVVGLIFYFFFGRSHRRERIIGRNSYGRLLKKPMA--EYLAQDSCSLPMAYSR-------
F2KVH0_PREDF          PMLGIILYFFFGQTTRKERKIWQHSMDQLTKRSML--EFVEQKRLHLPDAYRT-------
A6LEV6_PARD8          PGIGLLFYFFFGQDNRKQRIISRRTYKRIMKRPQE--GKLPQDACVVPDPYKP-------
F4KNV2_PORAD          PVAGVILYLLFGRSTASMRLIPKDFLKKINRMPVEHTDFDFHRATLENPDYSS-------
G0EI26_BRAIP          PYIGVIFYIFLGMDWKKSK--KKISAKLPEDMIKNYFSSLLKEQIKIL------------
C7N8V3_LEPBD          PLGGAVLYLLFGINWRRNKIISKKMAGEGQKLYSRIFNFMQRDVSDIFRSKDFFYYNNLE
D1AL33_SEBTE          PIIGIILYMVLGVNWRRRRILKNKLENSPHKMFVSLSNELAKNELSKYDTRDIFSSYK--
C0QIT7_DESAH          PFVGIVFYFLFGRGMRKKVRKTLLRQNLEGRLAGQGRAMVERQKWVMD------------
A5N6C2_CLOK5          PVLGLIVYIFLGRNWKKHKLHEETNINIEELIYEAIKDIKDN---TYTPLIELLS-----
C1FU71_CLOBJ          PPLGLFLYIFLGRNWKKHKLHDTTNIEIEQLVLEAMGKVKNQ---EYHSLIELLS-----
D9SSA2_CLOC7          PIVGLFFYIFFGRNWKIHKLRDDNNYELTRLIEPIIHKYKFQ---EYEPLIQLTA-----
Q8R663_FUSNN          PYVGFFIYLFFGLTFKKKRVANKIYKIKKLKSRKDVSKSDNEELKRWKGLITYLE-----
F4LIP6_TREBD          PGIGMILYLLFSGHFFTRTKRMSTTTAYINEKLKNLKAEQLAYLKERRHELPNHVIKD--
                         *   :   .                                                

CLS_CLOPE             ------------------------------------KDLIMMNFNNDNSTYTQRNDIDLY
CLS_CLOPS             ------------------------------------KDLIMMNFNNDNSTYTQRNDIDLY
B2TQ76_CLOBB          ------------------------------------FDLRKMNYNHSGSQYTTNNDLDVY
E3GG29_9FIRM          ------------------------------------RYNIEYHLNVSHALYTDNNSIDIY
Q180Q2_CLOD6          ------------------------------------KDMIYALANSNNAHYTNNNDVWIY
Q0SUY9_CLOPS          ------------------------------------SDMIKAIESMEYSPYRDNVETKVF
D9R3X0_CLOSW          ------------------------------------SDLVVYNLETSGAVLTVDNTVDIF
E4RNC0_HALHG          --------------------------------------IIRLGFQAKTTALVGYNELKIY
CLSA_BACSU            ------------------------------------KDLIYMLIMNNHAVFTEDNSVDVI
A0A1Y0XPV7_BACAM      ------------------------------------KDLIYMLVMNNHAVFTEDNSVEIL
E6U0D1_BACCJ          ------------------------------------RDLIFMHLVNNDSILTKGNDINIL
Q5WH00_BACSK          ------------------------------------RELIYMHLMSNDALLTKENRVDIF
CLS_OCEIH             ------------------------------------KDLVYLHLKNDEAIYTQNNGVDIF
CLS_LISMO             ------------------------------------RDLIYLLLVNDGAILTQDNEVELF
CLS_LISMH             ------------------------------------RDLIYLLLVNDGAILTQDNEVELF
CLS_LISIN             ------------------------------------RDLIYLLLVNDGAILTQDNEVELF
CLS_LISW6             ------------------------------------RDLIYLLLVNDGAILTQDNEVELF
Q2FWG8_STAA8          ------------------------------------KEMIQMLLYNNAAFLTTDNDLKIY
A0A0H2XGI3_STAA3      ------------------------------------KEMIQMLLYNNAAFLTTDNDLKIY
CLS_STAAN             ------------------------------------KEMIQMLLYNNAAFLTTDNDLKIY
CLS2_STAAR            ------------------------------------KEMIQMLLYNNAAFLTTDNDLKVY
CLS2_STAES            ------------------------------------KEMVQMLLYNNAAFLTTDNDLTIY
A0A269XG22_9STAP      ------------------------------------KEMVQMLLYNNAAFLTTDNDLMIY
B9DMH7_STACT          ------------------------------------KSMVQMLLYNNSAFLTTDNALTIY
CLS1_STAES            ------------------------------------RDLIRMLLMKQDAFLTENNKIDLF
CLS1_STAEQ            ------------------------------------RDLIRMLLMKQDAFLTENNKIDLF
CLS1_STAAC            ------------------------------------HDLVRMLLMDQDGFLTENNKVDHF
A0A0H2XHS8_STAA3      ------------------------------------HDLVRMLLMDQDGFLTENNKVDHF
A0A0H3JKV8_STAAN      ------------------------------------HDLVSMLLMDQDGFLTENNKVDHF
CLS1_STAAR            ------------------------------------HDLVRMLLMDQDGFLTENNKVDHF
A0A0H3JVZ5_STAAW      ------------------------------------HDLVRMLLMDQDGFLTENNKVDHF
C4L225_EXISA          ------------------------------------RRLARLNLVSTNAMMSFHNDIRVL
K0ACB4_EXIAB          ------------------------------------RKLIAANRTS-GALLTEATDVRTL
D5DYP7_BACMQ          ------------------------------------NKLLFTNLNSSKSLVRTDNEIDIF
F9VD31_LACGL          ------------------------------------TQLIHMLFVEEKAVISANTGVEIF
D2BQ69_LACLK          ------------------------------------GQLIHMLYVEEKSIISTNTGVKIF
A0A2Z5Y2W0_9ENTE      ------------------------------------KQLIYMLTVFEGALYTTDNEIELY
C8WXS3_ALIAD          ------------------------------------ADLIALNLKTAYAVYTEDNRVDVF
E4SJR8_LACAR          ------------------------------------EIAIRFFNQDDESPLTKNNNVELY
A8YWN2_LACH4          ------------------------------------EIAIHFFNQNNESPLTKNNNVELY
Q1G7R6_LACDA          ------------------------------------HILIKYLDKDQESPITKNNKLKLY
Q74LT8_LACJO          ------------------------------------KILIDYFNFKHDSPLSKNNKISFY
A0A087QBG6_LACGS      ------------------------------------KILIDYFNFKHDSPLSKNNKISFY
G4L828_TETHN          ------------------------------------DLLKQYFAGMDESPLTRGNHVEFF
Q834N6_ENTFA          ------------------------------------KVLNRYFRNMDASPLAKRNSLQLF
A0A0C9NY80_LACPA      ------------------------------------KALTAFFLNTAQAPVLAHNQVQLY
Q03D64_PEDPA          ------------------------------------ERMVQFFTKTDYSFLNRRNEVQII
A0A4R5NTZ5_LACBU      ------------------------------------KTAVDMFMTTDHAFLSRQNKVHIF
F8DR80_LACRS          ------------------------------------RRTIMLFQSIDDSFLTRHNAVNIF
F8DQG8_LACRS          ------------------------------------RQSVNLFLSLNDSVVTFNNKVHVF
A0A0N7CKV9_LACFE      ------------------------------------QMMANLLLNTDNALLTFGNQVHLF
F0TFK7_LACAM          ------------------------------------RMLTELNLNNDDAILTFANHVKVY
G2SPV9_LACRR          ------------------------------------RQTVRALLVADDAILTKHNEVKVY
D5T540_LEUKI          ------------------------------------SELVRLFLTSDDAVLTRGNDIQTF
B1MZZ2_LEUCK          ------------------------------------SELVNLFLSSDEAVLTRGNDIKVY
Q03YM9_LEUMM          ------------------------------------TELLKLFLSSDRAVLTRGNKITIF
G8PCK9_PEDCP          ------------------------------------NELVEMFLNSDNAILTQQNDITIF
Q38XB9_LACSS          ------------------------------------QSLINLFLVSNTAVLTQENKVSVL
K8QPY8_LACRH          ------------------------------------SELVRTLLRADDALVTTHNEVQVL
Q2FM09_METHJ          ------------------------------------KRMMLMLMESNKAPVTTSNNVRVF
I7KE57_METBM          ------------------------------------RETIFLLLQNNRAFLTGGNRVDLY
A2STU9_METLZ          ------------------------------------DSTIALLLSLDNAVLTRNNEITLY
F4C7E2_SPHS2          ----------------------------------KGLAHMIL--KDMMSPLTTSNEVKIL
F0REG6_CELLC          ----------------------------------SELVNLLL--KDTASPLTNNNTVKLL
F0SEL0_PSESL          ----------------------------------QELTRLMANKKNGNEGVLPNNVVEPL
A3UAU3_CROAH          ----------------------------------SKLIKLIQ--NKPRKPLTYNNKVELL
G7WDL9_DESOD          ----------------------------------LKLLNLHL--NSGFAPLTINNQAEIL
I4D6Z5_DESAJ          ----------------------------------PKILKLLY--NSGYAPPSVHNRVVVL
I4D626_DESAJ          ----------------------------------RKLARILM--NDASAPITFNNCSEVL
L0F6D5_DESDL          ----------------------------------KHLSKIVL--KSSYAPLSGNNSALLL
F8FPP2_PAEMK          ----------------------------------PRLFALLN--NIPGAMITVQNEVLVL
G7W0D8_PAETH          ----------------------------------ERLFNQLI--RMSENPLTGCNRTRVL
Q18CT1_CLOD6          R-------------------------DEEDGSYRKRVINMLL--KTGMFPFTKNNKVDVF
A8MKY4_ALKOO          ---------------------------------RGKIIPLLL--NNTKAPITVNNKVKVL
C8W5E6_DESAS          ---------------------------------KKRLVNLIL--NNFEEPFTIHNTSQVL
CLS_GEOSW             ------------------------------------RPLLQLAHRIGKSPVSLATETRVL
A0A150LT19_9BACI      ------------------------------------RPLLQLAHRIGKSPVSLATETKVL
CLS_GEOKA             ------------------------------------RPLLRLAYRIGQHPVSLASQTAVL
B7GLL6_ANOFW          ------------------------------------QPLLQLARRMTKESISTATKTRVL
CLS_ALKPO             ------------------------------------QLLFRLAHKLGKNPISFSSETKVL
CLS_BACHD             ------------------------------------QLLFRLAHRLANNPISFSTNTKVL
D5DAK4_BACMD          ------------------------------------KQMLKLAVRLGKSPISFSSDTRAL
CLS2_BACAN            ------------------------------------ELLFRLADRLGALNISFQTETRTL
A0A6L5LQC1_BACTU      ------------------------------------ELLFRLADRLGALNISFQTETRTL
CLS2_BACCR            ------------------------------------ELLFRLADRLGALNISFQTETRTL
D3EML0_GEOS4          ------------------------------------QQLLQLSTRLARTPISFSSDTKVL
E0RIJ1_PAEP6          ------------------------------------QQLMRLARRLARSPIYFATETQIL
C4L577_EXISA          ------------------------------------EKLMHLTSSLNQLPVSSNTYTQIL
K0AE21_EXIAB          ------------------------------------AKVVKLIDSISRLPISYNTHTKVL
CLS1_BACSU            ------------------------------------RFFTYSIRA-AHMNINTKSNIKVL
I0JTA9_HALH3          ------------------------------------QFISNRIEAESGFPISFSSEVSVL
CLS1_BACAN            ------------------------------------VHLTEVVQKFGGGPAADRTTTKLL
A0R9Q9_BACAH          ------------------------------------VHLTEVVQKFGGGPAADRTTTKLL
CLS1_BACCR            ------------------------------------IHLTEVIQKFGGGPAADRTTTKLL
B7IX03_BACC2          ------------------------------------IHLTEVIQKFGGGPAADKTTTKLL
A9VEQ6_BACMK          ------------------------------------IHLTEVLQKFGGGPAADRTTTKLL
B1YEW0_EXIS2          ------------------------------------LKLANTIRNFGGGGVDVHTASQIL
A0A0B8RBT6_LISMN      ------------------------------------IAHLTSIEPIKG------NKIEIL
A0A0E0URT5_LISMM      ------------------------------------IAHLTSIEPIKG------NKIEIL
A0AEJ4_LISW6          ------------------------------------IAHLTSIEPIKG------NKIEIL
E6XF61_CELAD          -------------------------------------RIMTLVYRNSHFPPTEGNNLYLL
G2PJ59_MURRD          -------------------------------------KITSLINNTSKCPVTCLNDLELL
G0L287_ZOBGA          -----------------------------------HIKLVKLIAKNSSFLPSLGNELTPL
E1WLD8_BACF6          --------------------------------------LIQLFQNTNQAFPFEGNRVDIY
Q64YC9_BACFR          --------------------------------------LIQLFQNTNQAFPFEGNRVDIY
E6STH3_BACT6          --------------------------------------LISLFRHTNQAFPFDGNRVEAY
F2KVH0_PREDF          --------------------------------------LINLFMNQNWALPFKNNETEIY
A6LEV6_PARD8          --------------------------------------LSTLLTNTNQSSLLYGTQITIY
F4KNV2_PORAD          --------------------------------------LGKLLYNSDDRTVLAASSMEVI
G0EI26_BRAIP          --DNMQGNYGK------------------------HINLVKLAIKSGYSPITVQNEVYVF
C7N8V3_LEPBD          NVDDIEKNKMSENEKKEKIRQQINTMIKNIKLDNQESEIVKMLYEAEGTFLTNNNSYKLF
D1AL33_SEBTE          --DNVERTDKYMRDMED------------------HSDVAKLLYNTGSTYLTLNTSYDFY
C0QIT7_DESAH          ---VLLGRYVTPV----------------------EKKIIRLMYRNSDSILSSKNKVQVF
A5N6C2_CLOK5          --------------------------------------------KNSESPLFTNNSIKIF
C1FU71_CLOBJ          --------------------------------------------RNSESPLFRDNSIKIF
D9SSA2_CLOC7          --------------------------------------------QNSDSPIFVNNLVTIL
Q8R663_FUSNN          --------------------------------------------MSTDNHISSNNDIQVY
F4LIP6_TREBD          -----------------------------------YFPLVDMNLSKGGSLLTATDSIEIY
                                                                                  

CLS_CLOPE             FDANSLFEEMIDEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGN
CLS_CLOPS             FDANSLFQEMIYEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGN
B2TQ76_CLOBB          VNGEDKFRQLIEDIKNAKEYIHIEYYIFRNDCLGKEIIAELTKKAASGVEVRLLADSMGS
E3GG29_9FIRM          TDGHEKFNALFKAIENARSTVHIEYYIIKYDGLGRKFMELLTKKAREGVEVRLLFDEMGG
Q180Q2_CLOD6          AESSQFFNSLLEELKKAKKYINIQFYIFKDDKIGTEIIDILIDKAKEGVEVRLLFDAVGG
Q0SUY9_CLOPS          FDGKELFNDILESLKKAQKSINIEFYIFKNDDIGSKILDILKEKAKAGVEVRLLYDSVGS
D9R3X0_CLOSW          TDGEKKFKDLRAELSAAVRFIHMQYYIIKDDELFDSIIPILIERARAGVEVRILCDGMGG
E4RNC0_HALHG          TNGSDKFNDLFNDIENAQEFIHVNYYIIQNDKLGDKLINLLAKKAAQGLEVRLLYDKMGC
CLSA_BACSU            TDGRDKFQRLLSDISKAKDHIHLQYYIYKGDELGKKLRDALIQKAKEGVQVRVLYDELGS
A0A1Y0XPV7_BACAM      TDGRDKFKRLMKDISNAKDHIHLQYYIYKGDELGKKLRDALVKKAQEGVKVRVLYDELGS
E6U0D1_BACCJ          VDGENKFNELLADIVAAKRFIHIQYYIFKNDELGSKIINLLVEKAKQGVKVRVLYDELGS
Q5WH00_BACSK          SDGKEKFAQLLKDIKQAETFIHIQYYIFRYDEIGKTIVDALTEKARQGVKVRLLYDDLGS
CLS_OCEIH             TDGQTKFDALLEDIEKAKKHIHIQYYIMRSDGLGNRLADMLIKKVNEGVEVRVLYDDMGS
CLS_LISMO             VDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYDAMGS
CLS_LISMH             VDGHEKFDALIADIENAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYDAMGS
CLS_LISIN             IDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYDAMGS
CLS_LISW6             IDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYDAMGS
Q2FWG8_STAA8          TDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKKAEQGVEVKILYDDMGS
A0A0H2XGI3_STAA3      TDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKKAEQGVEVKILYDDMGS
CLS_STAAN             TDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKKAEQGVEVKILYDDMGS
CLS2_STAAR            TDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKKAEQGVEVKILYDDMGS
CLS2_STAES            TDGHQKFDDLINDIRHAQSYIHIQYYIIHSDNLGKQLLHELEKKAEEGIEVKMLYDDMGS
A0A269XG22_9STAP      TDGHQKFDDLLEDIKNAKDYIHIQYYIFHSDELGKTILKALEDKAEAGIEVKMLYDDMGS
B9DMH7_STACT          NDGKEKFEALIHDIENAQSYIHIEYYIFRNDILGKRILKALEDKLDEGLEVKMLYDDMGS
CLS1_STAES            TDGHKLYEKVLEDIYNAQDYIHLEYYTFELDGLGKRILDALETKLKEGLEVKLLYDDVGS
CLS1_STAEQ            TDGHKLYEKVLEDIYNAQDYIHLEYYTFELDGLGKRILDALETKLKEGLEVKLLYDDVGS
CLS1_STAAC            IDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKLKQGLEVKILYDDVGS
A0A0H2XHS8_STAA3      IDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKLKQGLEVKILYDDVGS
A0A0H3JKV8_STAAN      IDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKLKQGLEVKILYDDVGS
CLS1_STAAR            IDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKLKQGLEVKILYDDVGS
A0A0H3JVZ5_STAAW      IDGNDLYDQVLQDIKNAKEYIHLEYYTFALDGLGQRILKALEEKLKQGLEVKILYDDVGS
C4L225_EXISA          HDGKEKFDQLFQDIERATKEVNIQYYIIQNDALGQSLIRLLTEKAKQGLRVRLLYDAVGS
K0ACB4_EXIAB          FDGNQKFDTLVADIQSAQVEINIQYFILKRDPLGDRLLNALFEQAKRGVKVRILYDAVGS
D5DYP7_BACMQ          SDGNQKFDALFEDIRNAKKEINIQYYIIQRDNLGKKLRDELTKKAKEGIKVRVLYDEVGS
F9VD31_LACGL          TDGRAKFDALLDDIHNAQHHIHLEYYIFRMDHLGKELTNALTAAVKRGVEVKVLIDAWGS
D2BQ69_LACLK          NDGRQKFNALIEDINKAKHHVHMEYYIFRMDRMGHEIYDALLAAAKRGVEVKLLIDAWGS
A0A2Z5Y2W0_9ENTE      TDGYEKFDALLADIDRATDHIHMEYYIYRDDRLGKEVREALTRAAKRGVRVRLLLDAWGS
C8WXS3_ALIAD          VRGVDKFEALFEDIRQAKDHIHLEYYIFRPDDLGERFVRLLAEKAREGVEVRLLYDAVGC
E4SJR8_LACAR          TEGETFFHDMLKDIVRAKETINIEFYTFYSDNIGNRVLQLLIKKAQQGVKVRVIYDAWGS
A8YWN2_LACH4          TEGETFFHDLLKDMVRAKETINVEFYTFYSDNIGNRVLQLLIKKAKQGVKVRVIYDAWGS
Q1G7R6_LACDA          TDGHDKFRDLFADIRQAKSSINVEYYTIYNDAIGNEFLKLLIQKAREGVQVRVLYDAWGS
Q74LT8_LACJO          TDGEKKFEALFKDIEQAQETVNVEYYSFMNDDLGNKFLNLLIKKAREGVKVRLIYDPWGS
A0A087QBG6_LACGS      TDGEEKFKALFKDINQAKETINVEYYSFMNDDLGNQFLNLLIKKAREGVKIRLIYDPWGS
G4L828_TETHN          TDGEQKFSHLFEDIRRAKDNVHVEYYAFFNDEIGNAFLDLLVKKAREGVEVRLVFDPWGG
Q834N6_ENTFA          TDGQEKFQALFEDIRAAKETVHVEYYAFFNDTIGNQFLDVLIEKLHEGVEVYLIYDPWGS
A0A0C9NY80_LACPA      TDGEKKFAALFRDIEAAKDYIYVEYYTIYNDELGNQFQQLLIKKAKEGVVVKVLYDAWGS
Q03D64_PEDPA          TDGNELFDDIFAEIKKAKKHIHVEFYTIYDDQIGNQLRELLEEKAREGVEVKVLWDSWGS
A0A4R5NTZ5_LACBU      TDGNSLFHKVIGDIEAAKKSIHIEFYTFYNDQIGNEILNLLVKKAHEGVEVRVIYDSWGS
F8DR80_LACRS          TNGNALFKKMFDDIAAAKKSIHIEFYTIYNDQIGNELRTLLEQKAAEGVKVRVLYDSWGS
F8DQG8_LACRS          IDGKKKFDKLIDDINHATDHVYIEYYSFYADNLGKRVLAALEDAAARGVKVRVLYDLSGS
A0A0N7CKV9_LACFE      TDGHAKFDQLIKDIDQAKRHIHVEYYTFAADQLGHRVLAALERAAERGVEVRVLYDLSGS
F0TFK7_LACAM          TDGPELFDQMIEDIKNAKVAVSLEFYTFYADKLGHRVLAALEQAAKNGAKVRVIYDTSGS
G2SPV9_LACRR          TDGHEKFKALIEDIKKAKDHVHVEYYSFFSDQIGTELLHSLEDACSRGVEVRIIYDSMGS
D5T540_LEUKI          TDGYEKFKALFEDIRHAAHHIHLEYFTIYDDRVGNQLIDLLVQKAREGVEVRVVYDQFGS
B1MZZ2_LEUCK          NNGQDKFAALFEDIRQAKHHIHLEYFTIYDDHIGNQLIDLLTAKAQEGVEVRVIFDQFGS
Q03YM9_LEUMM          SDGQKKFDKLFSDIRAAKEHIHLEYFSIFDDKIGHQLVDLLTEKAGEGVEVRVIYDQFGS
G8PCK9_PEDCP          TDGIKKFKQLFEDLRGAKNHINLEYFTIYDDDLGTQLRKILIDKAKEGVKVRVLYDIFGS
Q38XB9_LACSS          TDTTTAQERLLADMSRARDHIHLEYYAFFDDPFGHILIKTLAYKAYQGVKVRVIYDGFGS
K8QPY8_LACRH          SLREAFFKQLFEDIGLATEHIHIEAYTIQPDAVGRQLRDLLIEKAQAGITVRVLYDTFGS
Q2FM09_METHJ          VDGNEKFKALIEAIQGAKDHIHMEYYILKDDGIGNEVFAALTERARAGVTVRFLGDGLGS
I7KE57_METBM          TRGKDKFDALFAAIRGARHHIHLEYFVINNDELGRAVVHALAEKAREGVEVRLLFDAMGT
A2STU9_METLZ          TDGEMKFEAFKEAIRGAKHHIHLEYFIIRDDELGNQIIELLAEKAAQGVEVRAIFDAAGT
F4C7E2_SPHS2          INGEQTFDAILQAISQAKDHIHLEYYTFENDAIGNTIKDALIRKAKEGVEVRFIYDHFGS
F0REG6_CELLC          LNGENKFPEVLKAIEKAQHHIHIEYYIFRDDKIGNTIEKLLLKKAKEGVKIRFIYDDYGS
F0SEL0_PSESL          FNGEILFPKLITELKKAKKHIHFEYYIYENDFIGNEIKNILIEKAKEGVEVRFIYDDFGS
A3UAU3_CROAH          INGNNTFDAIFEALRQAKDHIHLEYYIFSADKIGKQLINILCDKANEGVSVKVMYDYVGN
G7WDL9_DESOD          LNGGEKFKALFYALEKASHHIHLSYFIFNDDEIGEDVLKILSRKVTEGVAVRVILDGMGS
I4D6Z5_DESAJ          VNGGEKFKALLQALENASHHIHLSYYIFKDDEIGADILKILSRKSSEGVEVRVLLDGVGS
I4D626_DESAJ          TNGIDTFKAIFEAIEIAENHIHLEFFIFHNDSIGRDILNLLIQKASEGVKVRVLVDGLVN
L0F6D5_DESDL          HNGQGKFEALLQDLECAQDHIHMEYYIYHEDKIGETIQKILIRKARAGIKIRLILDGLGS
F8FPP2_PAEMK          ANADEAYPEMLEAIEGAQKHIHFEFYTIRDDPTGRRFQELLIRKARAGVQVRCIFDGIGS
G7W0D8_PAETH          TNGKETFEAMLTAMERAQHHIHVEFYIFRADDIGTQFQEVMIRKAREGVKVRFVVDGVGS
Q18CT1_CLOD6          VDGNEKFKRLIEDIREAKDHIHLEYFIIKDSEIGRVLKEELIKKAKEGIKIRILYDDVGC
A8MKY4_ALKOO          QNGESTFSEMIRAIENAKDHIHIEYFIIKDSHIGRMLQATLIKKAKEGVEVRLIYDAVGS
C8W5E6_DESAS          TNGQETFDAICESINKAEHHVHLEYYTIRPDRIGHKIRDLLIEKAKAGVMVRLLYDAVGS
CLS_GEOSW             TNGEETFSTIFEELEKATHHIHLEYYIVRHDEVGQKLKTILIEKAKKGVHVRFLYDAVGS
A0A150LT19_9BACI      TNGQETFSTIFEELKKATHHIHLEYYIVRHDGVGQQLKAILVEKAKSGVHVRFLYDAVGS
CLS_GEOKA             TNGEETFSSIFAELEKAEHHIHLEYYIVRHDEIGQQLKRVLMEKARQGVRVRFLYDAVGS
B7GLL6_ANOFW          TNGEETFTTIFKELEKAEHHIHLEYYIVRDDDIGQRLKQILMDKAKKGVHVRFLYDAVGS
CLS_ALKPO             TDGKETYAHILQALKMAEHHIHLEYYIVRHDDLGNQIKDILISKAKEGVHVRFLYDGVGS
CLS_BACHD             TDGKETFAHIKQALRMATHHIHLEYYIVRDDEIGQEIKEILMQKAKEGIHVRFLYDGVGS
D5DAK4_BACMD          TNGKETFHEIMESLKHARHHIHLEYYIVRHDHLGEQIKDILIQKVQEGVYVRFLYDAVGS
CLS2_BACAN            TNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGS
A0A6L5LQC1_BACTU      TNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGS
CLS2_BACCR            TNGDETFRAILNGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGS
D3EML0_GEOS4          TDGEETFAALIAELEQAAHHIHMEYYIYRPDAIGTQIQEILIRKARQGIAVRFMVDAVGS
E0RIJ1_PAEP6          NNGDETFSTLLEELRKAQHHIHMEYYIFRSDDIGTSIQKILIEKAKAGVKVRFMYDAVGS
C4L577_EXISA          TNGREKFSKLLPALKGASRHIHLEYYIFREDRISREIQRILIEKAKAGVEVRFLYDAVGS
K0AE21_EXIAB          TNGQEKFPLLLAEIRQAEHHIHLEYYIVRDDELALELQAALIERVQAGVEVRFLYDAVGC
CLS1_BACSU            KNGEETFPDIFKAMRKAESYIHIEYYMFKSDMLGRGMMDIMMEKARQGVEVRFLYDAAGS
I0JTA9_HALH3          KDGDETFPAIKERLREATEYIHMEYYTFRDDQIGQEIIDILKEKAEQGLEVKVIFDAAGS
CLS1_BACAN            TNGDQTFSEILQAIEQAKHHIHIQYYIYKSDEIGTKVRDALIKKAKDGVIVRFLYDGLGS
A0R9Q9_BACAH          TNGDQTFSEILQAIEQAKHHIHIQYYIYKSDEIGTKVRDALIKKAKSGVIVRFLYDGLGS
CLS1_BACCR            TNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGS
B7IX03_BACC2          TNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGS
A9VEQ6_BACMK          TNGDQTFSEILNAIENAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGS
B1YEW0_EXIS2          TNGNETFPEILRMIRSAKHHVHIQYYIYRNDETGQAIREALIDRLNDGVEVRFMFDGLGS
A0A0B8RBT6_LISMN      TNGEETFPVLLDALRKAENHIHIQYYIFKTDEISTKIRDILVEKAKAGVEVRFMFDGLGS
A0A0E0URT5_LISMM      TNGEETFPVLLDALRKAENHIHIQYYIFKTDEISTEIRDILVEKAKAGVEVRFMFDGLGS
A0AEJ4_LISW6          TNGEETFPVLLDALRKAENHIHIQYYIFKTDAISTEIRDILVEKAKSGVEVRFMFDGLGS
E6XF61_CELAD          KDGKTTFEAIFKALEAAKSTIHLQYYIFEEGELADTFLDLFVKKIKEGVSVRMIYDGVGS
G2PJ59_MURRD          KDGKNTFESIFEALEEAKEHIHLQYYIFEDGILADKLLEVFERKVAENVTVRLLYDGIGS
G0L287_ZOBGA          KDGPATFDAIFQAMEGAQKFIHVQYYIFEEGELADRFLALWQRKIKEGVEIRFLYDGLGS
E1WLD8_BACF6          TGGYSKLQALLRELQKARLHIHMEYYIFEDDPVGRLVRDVLIEKAREGVEVRVIYDDVGC
Q64YC9_BACFR          TGGYSKLQALLRELQKARLHIHMEYYIFEDDPVGRLVRDVLIEKAREGVEVRVIYDDVGC
E6STH3_BACT6          TLGVTMLQSLLRELQKARQHIHMEFYIFEDDAIGRLVRDVLMEKARAGVEVRVIYDDVGC
F2KVH0_PREDF          TSGYEFFPSLLMEIGKAEHHIHLDTFIIVDDPLGRIVADALIDKARQGVEVRVIYDDVGS
A6LEV6_PARD8          TNGTDKFKDLLEEIQKATHHIHIQYYIFCDDEIGKQVQQLLIKKVKEGVKVRVLYDDVGC
F4KNV2_PORAD          TVGTDKYRQLFEDIRSAKQEIHLMYYIIMSDELGVELRDLLVDKAREGVKVRVVYDGLGS
G0EI26_BRAIP          DEGDKLFDAIIQDLKLAEKTIHMEYFIWRSDKLGNRIKDVLINKAKQGVEIRLIFDGVGS
C7N8V3_LEPBD          FNGKEAFDSILEDIKNAKRTIYMEYFIWKADELGEKIKNALVEKAREGVKIRLLFDGVGT
D1AL33_SEBTE          FDGGEAFDSIIKDLENAKESIYIEFFIWRSDELGERVKDVLIKKASEGIDIKLIFDGLGS
C0QIT7_DESAH          FNGRDKFDQLLEDLEKAQRYIHMEYFIWKNDYLSQKVVQVLEERVAQGVEVRILYDVIGN
A5N6C2_CLOK5          KDGIEKFQCLKAELLKAQHHIHIEYFIIKNDNIGNEIKDILIEKSLSGVNVRLILDRVGC
C1FU71_CLOBJ          KDGNEKFEYLKKELLKAKHHIHLEYYIVKNDNIGNEIKDILIKKAKEGVKVRFIMDRVGS
D9SSA2_CLOC7          QNGEKKFETLKKELKKAKHHIHLEYYIVRSDTIGTEIKNILVAKANSGVKVRFIMDRFGA
Q8R663_FUSNN          FTGEDFFPELKKEIANAKKFINMEYFIFQFDGIGKEIADLLIEKAKEGVEVNLIIDGVNL
F4LIP6_TREBD          RWGQDMFTQLKKDLQAAERTINMEFFIFHNDATGCEIMEILCRKAREGVDVKLLYDDFGS
                               .   :  *   : .  :    .     .          .  :  : *    

CLS_CLOPE             -SIH----KKDIDKLKAAGGD-FKIFFPGFCKY--INLRINYRNHRKILIIDSKVAFLGG
CLS_CLOPS             -SIH----KKDIDKLKAAGGD-FKIFFPGFCKY--INLRINYRNHRKILIIDSKVAFLGG
B2TQ76_CLOBB          YTLT----KGALKNYLKSGGK-FAIFFPGILPH--INTRINYRNHRKIVVIDGEYGYVGG
E3GG29_9FIRM          RYIP----KSALKELESSGGQ-YGIFFPSRLRF--INLRLNYRDHRKIVIIDGKTGFIGG
Q180Q2_CLOD6          RTLK----NSTLSRLKESGVK-VGSFFPSFLKI--VNFNLNYRNHRKIVVIDGKVGFVGG
Q0SUY9_CLOPS          RTTN----RKKLQSVIDAGVK-VGEFFPSLLRL--ININMNFRNHRKIIVIDNKIGYVGG
D9R3X0_CLOSW          RFMP----KDKWNRLKDNGVK-VGIFFPPYLGR--LQLRVNYRNHRKIVVIDNRVGYVGG
E4RNC0_HALHG          RNLS----THSLNMLEDAGAE-TAPFAP-------FILDINYRNHRKNVIIDGQIGYLGG
CLSA_BACSU            RT----LRKKFFKELREAGGH-VEVFFPSKLRPI--NLRLNYRNHRKLVIIDGMTGYVGG
A0A1Y0XPV7_BACAM      RT----LRKKFFKPLRDAGGH-VEVFFPSRLRPI--NLRLNYRNHRKLVIIDGETGYVGG
E6U0D1_BACCJ          RK----LKRKHFSELEAVGGE-VGVFFPSKLALI--NIRLNYRNHRKLVVIDGVVGYIGG
Q5WH00_BACSK          RS----LRKKYLKAFREAGGE-IGIFFPSRFTIV--NLRLNFRNHRKLVNIDGKCGYVGG
CLS_OCEIH             RS----LKNSYIKRLKRAGVM-VEAFFPSRF-IV--NFKINYRNHRKLAIIDGYIGYLGG
CLS_LISMO             RT----TKKSFFRTFQKNGGL-VRPFFPSKLPLI--NFRLNYRNHRKLAIIDGDVGYIGG
CLS_LISMH             RT----TKKSFFRTFQKNGGL-VRPFFPSKLPLI--NFRLNYRNHRKLAIIDGDVGYIGG
CLS_LISIN             RT----TKKSFFRTFEKNGGL-VRPFFPSKLPLI--NFRLNYRNHRKLAIIDGDVGYIGG
CLS_LISW6             RT----TKKSFFRTFEKNGGL-VRPFFPSKLPLI--NFRLNYRNHRKLAIIDGDISYIGG
Q2FWG8_STAA8          RG----LRKKGLRPFRNKGGH-AEAFFPSKLPLI--NLRMNNRNHRKIVVIDGQIGYVGG
A0A0H2XGI3_STAA3      RG----LRKKGLRPFRNKGGH-AEAFFPSKLPLI--NLRMNNRNHRKIVVIDGQIGYVGG
CLS_STAAN             RG----LRKKGLRPFRNKGGH-AEAFFPSKLPLI--NLRMNNRNHRKIVVIDGQIGYVGG
CLS2_STAAR            RG----LRKKGLHPFRNKGGH-AEAFFPSKLPLI--NLRMNNRNHRKIVVIDGQIGYVGG
CLS2_STAES            RD----LRKKDLKKFRQKGGH-AESFFPSKLPLI--NLRMNNRNHRKIVVIDGTIGYVGG
A0A269XG22_9STAP      RD----LRKKDLKAFRKKGGH-AEAFFPSKLPLI--NLRMNNRNHRKIVVIDGKIGYVGG
B9DMH7_STACT          RG----LTLKDFDEFRKKGGQ-VESFFPSKLPLI--NFRLNYRNHRKIVVIDGVIGYVGG
CLS1_STAES            KK----VRLSKFKHFRALGGE-VEAFFPSKVPLI--NFRMNNRNHRKIIIIDGQIGYVGG
CLS1_STAEQ            KK----VRLSKFKHFRALGGE-VEAFFPSKVPLI--NFRMNNRNHRKIIIIDGQIGYIGG
CLS1_STAAC            KN----VKMANFDHFKSLGGE-VEAFFASKLPLL--NFRMNNRNHRKIIVIDGQLGYVGG
A0A0H2XHS8_STAA3      KN----VKMANFDHFKSLGGE-VEAFFASKLPLL--NFRMNNRNHRKIIVIDGQLGYVGG
A0A0H3JKV8_STAAN      KN----VKMANFDHFKSLGGE-VEAFFASKLPLL--NFRMNNRNHRKIIVIDGQLGYVGG
CLS1_STAAR            KN----VKMANFDHFKSLGGE-VEAFFASKLPLL--NFRMNNRNHRKIIIIDGQLGYVGG
A0A0H3JVZ5_STAAW      KK----VKMANFDHFKSLGGE-VEAFFASKLPLL--NFRMNNRNHRKIIVIDGQLGYVGG
C4L225_EXISA          RG----LRHKHFKDLLAHGGE-VKSFFPSKLGI---NFRVNNRNHRKLCIIDGELGYIGG
K0ACB4_EXIAB          WK----LKAKDFATFKQDGGE-VRSFFSSPLGIF--NLRINNRNHRKLCTIDRQIGYIGG
D5DYP7_BACMQ          RK----MTPSFFKELISYGGE-AQAFFPSILRLI--NFRINNRNHRKLCIIDGEVAYIGG
F9VD31_LACGL          NK----TKMHEFDELTKAGGE-VSYFFPLILSLI--NPRTNYRLHRKIVVIDGQIGYTGG
D2BQ69_LACLK          NK----TKMSNFKELQEAGGH-VAQFFPLIMPLV--NPRTNYRLHRKIVVIDGIIGYTGG
A0A2Z5Y2W0_9ENTE      TH----VNMHFFEKLKAAGGE-ISFFFPLFVPYL--NPRINYRNHRKIVVIDGYIGYTGG
C8WXS3_ALIAD          AW----TPKSFFEPLVRDGGE-VAAFFPSRIPYV--NLRMNNRNHRKIAVVDGRVAYVGG
E4SJR8_LACAR          MG----ATKAWFDQLRDAGGE-VLPFITSKNMI--TRYRINYHLHRKIVVIDGKISWTGG
A8YWN2_LACH4          MG----ATKAWFDQLRKAGGE-VLPFITSRNMI--TRYRINYHLHRKIVVIDGHISWTGG
Q1G7R6_LACDA          FG----ASKSWFNQLTEAGGD-VLPFITSRNMI--SRNRINYHLHRKIVVIDGVTSWTGG
Q74LT8_LACJO          PG----ASKTWFKPLTDLGGE-VVAFITAQNMI--KKYRMNYHLHRKIVVIDGRISWTGG
A0A087QBG6_LACGS      PG----ASKAWFKPLTDLGGE-VAAFITAQNMI--KKYRMNYHLHRKIVVVDGRISWTGG
G4L828_TETHN          -R----TNVRFFKPLQEAGGK-VIPFITSRNLI--RKTRLNYHLHRKIVVIDGEIGWTGG
Q834N6_ENTFA          PG----ANKKFFARYVDAGGK-VAPFITSRDMI--RKTRLNYHLHRKIVVIDGKIGWTGG
A0A0C9NY80_LACPA      MG----ATAKWWRRLTDVGGQ-AESYFSSKHPI--TDFRLNYRDHRKIVVIDDHVGYIGG
Q03D64_PEDPA          LG----TKRSFFKKLNELGGE-AYPFLGTRSAL--TDFRLNFRDHRKIVVIDGKIGYVGG
A0A4R5NTZ5_LACBU      MG----TTRKFFQPLVDAGGK-AFPFLNTRSVL--LDFRINFRDHRKIIVIDGTIGYTGG
F8DR80_LACRS          MG----VWPSFYDHLREVGGY-AAPFLMSRSNF--FDFRINYRDHRKIVVIDGEIGYVGG
F8DQG8_LACRS          HG----TTFKFFKHLEELGGE-AQAFIAAAKAY-FQTPRLNYHLHRKLAIIDGKIGYIGG
A0A0N7CKV9_LACFE      RG----TTYRFFSHLEELGGQ-AQAFISSAKAR-FNTPRLNYHLHRKLVIIDGDLGYIGG
F0TFK7_LACAM          RG----TKPAFFDHLRELGGQ-AQPFISTSKKHWFTTPRLNYHLHRKLVVIDHNTGYIGG
G2SPV9_LACRR          RG----QRRGFFKRLESLGGR-AEVFFGSKAAP-IHSPRLNYRLHRKIVVIDGKIGYIGG
D5T540_LEUKI          HG----QHRDMYKRLRDAGGV-AVPFLMRRFQL--LTLRFNFRNHRKIAIVDGVIGYVGG
B1MZZ2_LEUCK          HG----QHRRLYKRLRLAGGV-ATSFLMRPFQL--LTLRFNFRNHRKLAIIDGMIGYIGG
Q03YM9_LEUMM          HG----QHPKMYRQLRAAGGV-AVPFLMRRFQL--LTLRFNFRNHRKIAIIDGKIGYIGG
G8PCK9_PEDCP          KG----SKQRFFKELIAHGGE-VQPFMQSKWRY--LNFRINFRNHRKIVVIDGTIGYIGG
Q38XB9_LACSS          QK----IPRSFFKPLEEAGGQ-VTPFFSSRFRL--INFRLNFRNHRQLVVIDGNTAYLGN
K8QPY8_LACRH          HG----LPISFWKGLTAAGGQ-VERFVATKLGR--WNPRINFRNHRKLIVIDGHLAYLGG
Q2FM09_METHJ          AG----PRKSFYEPYLNAGGK-LAFFFPSLMNIS--HPRLNYRNHRKIAIIDGKVGFIGG
I7KE57_METBM          RAGG-GSRKAFSE-LTDAGGE-IGVFFPSVY-------RVNYRNHRKIAVIDGTVGFIGG
A2STU9_METLZ          FS----VKKDFFTPLKKAGGD-VRIFFPLKVSFL--NTRLHFRNHRKILVVDGTIGFIGG
F4C7E2_SPHS2          RSID----GSFSDELAAAG---VEVYPFHKITFLLLANRLNYRNHRKIIVIDGYTSFVGG
F0REG6_CELLC          SEIR----KTLSKRLRDAG---IEAVPFYKIKLIAFANSLNYRNHRKIIVIDGKIGFVGG
F0SEL0_PSESL          SGIR----KNIIRELKRNG---VQAFPFNKIKLIYFANRINYRNHRKIVIIDGITSFIGG
A3UAU3_CROAH          Q-LK----SPNVEQLKSCG---VEIHPFMPVWFPNLTRKLNYRDHRKITVIDGVVGFLGG
G7WDL9_DESOD          LSI----SGTMMRRMKTAG---IQAKWFFPIQFPYLTSKLNLRYHRKIVVVDGSIGFIGG
I4D6Z5_DESAJ          LSI----AGNFMGTMRKMG---IQAHWYFPVRFPFLTPRLNLRYHRKIVIVDGSVGFMGG
I4D626_DESAJ          SSL----RKRF-GALREAG---VEAEVFYPVRFPFLSRRLNLRNHRKIVVIDGRIGFVGG
L0F6D5_DESDL          KSL----SKSFIQELKAAG---IEYQWFFPLRFPQLLATLNYRNHRKLVVIDGKIGYLGG
F8FPP2_PAEMK          YHL----PNRFIAELQQAG---CEVYIFLPALIAFFDKRINYRNHRKIIVIDGIVGFLGG
G7W0D8_PAETH          YNL----PYSFIRACSEAG---VEFHYFLPPFFATLDRRINYRNHRKIVVVDGLIGFVGG
Q18CT1_CLOD6          WRFWF--NRKFFREMREVG---IEIAAFLPTKFPIIGGKLNYRNHRKIVVIDGIIGYTGG
A8MKY4_ALKOO          FRL----GKDFLNPLREAG---VHLKVFLPVTLPFFGSRLNYRNHRKILVVDGTIGFVGG
C8W5E6_DESAS          RSL----NRKFLEPLWRAK---AEVGVFLPVKLPFFHSKMNYRNHRKILVVDGRTGYVGG
CLS_GEOSW             WKLS----KTYIQELRDAG---VEMIPFSPVRLPFLSNTINFRNHRKIIVIDGTIGFVGG
A0A150LT19_9BACI      WKLS----KTYIQELRDAG---VEMIPFSPVRLPFLNNKINFRNHRKIIVIDGTVGFVGG
CLS_GEOKA             WKLS----NAYIEELRAAG---VEMIPFSPVRLPFLSNQINFRNHRKIIVIDGGVGFVGG
B7GLL6_ANOFW          WKLS----KTYIQEMREAG---VDIIPFSPVRLPFLNNTINFRNHRKIIVVDGKVGFVGG
CLS_ALKPO             WKLS----KSYVEELRDAG---VEMVSFSPVKLPFLTHTINYRNHRKIIVIDGVVGFVGG
CLS_BACHD             WKLS----KSYIQDLKQAG---VEIVPFAPVKLPFINHTINYRNHRKIIVIDGTVGFVGG
D5DAK4_BACMD          FQLS----PHYIHELRNAG---VEMIPFLPVRLPFLNNKINFRNHRKIVVIDGTIGFVGG
CLS2_BACAN            FKLS----KSYIEELNDAG---VEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGG
A0A6L5LQC1_BACTU      FKLS----KSYIEELNDAG---VEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGG
CLS2_BACCR            FKLS----KSYIEELNDAG---VEMIPFFPVRFPILNDKINYRNHRKIVVIDGNEGFVGG
D3EML0_GEOS4          LQLP----PSFLQEMRDAG---VQVAVFGSPKTIFFTSRVNYRNHRKIVVIDGSVGFVGG
E0RIJ1_PAEP6          IQLP----KSFLKEMRDAG---VEVVAYGGARILFFSSRVNYRNHRKIVVIDGNIGLIGG
C4L577_EXISA          IHTS----GTFFEEMKQAG---VQVQAFFPVVLPLVSSKTNYRNHRKIVVIDGTEAFTGG
K0AE21_EXIAB          FSTD----KAYFKKMKDAG---IEVHAFFPVVLPFISSKSNYRNHRKIVVIDGTVAFTGG
CLS1_BACSU            MKLA----RRDIMRMKQAG---VDIVPFSPLKYGFFNQKLNFRNHRKIVIIDGKTGFVGG
I0JTA9_HALH3          IGMS----GNAKRSMKKAG---VDMACFHSITSGFFTQKINFRTHRKIIVVDGDTAFVGG
CLS1_BACAN            NTLR----RRFLQPMKEAG---IEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGG
A0R9Q9_BACAH          NTLR----RRFLQPMKEAG---IEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGG
CLS1_BACCR            NTLR----RRFLQPMKEAG---IEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGG
B7IX03_BACC2          NTLR----RRFLQPMKEAG---IEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGG
A9VEQ6_BACMK          NTLR----RRFLQPMKKAG---IEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGG
B1YEW0_EXIS2          YMLG----EGFLKPLREAG---AKIAAYDPISSPLFIFTANFRNHRKIVVVDGKIGFTGG
A0A0B8RBT6_LISMN      SKLG----KAFLAPLKEAG---VSIHAFDPITSPWIVRTANLRNHRKIVVIDGQIGFTGG
A0A0E0URT5_LISMM      SKLH----KAFLAPLKEAG---VSIHAFDPITSPWIVRTANLRNHRKIVVIDGQIGFTGG
A0AEJ4_LISW6          SKLS----KSFLAPLKEAG---VSIHAFDPITSPWIVRTANLRNHRKIVVIDGQIGFTGG
E6XF61_CELAD          FSLS----KKYLAKLQEIG---VEVYPFLPFKFGRFFRTLNYRNHRKIIVVDGFIGFTGG
G2PJ59_MURRD          YSLS----KKYLKRLKQIG---VETAQFLPFKFGRFLSALNYRNHRKIIVIDNKVGFTGG
G0L287_ZOBGA          NTLS----KAYVNQLKESG---VEVFSFLPIRFKRLLSSINYRNHRKIVVVDGHTAFTGG
E1WLD8_BACF6          WHVP----HRFFEEMRDAG---IEVRSFLKVRFPLFTSKVNYRNHRKIVVIDGRIGFIGG
Q64YC9_BACFR          WHVP----HRFFEEMRDAG---IEVRSFLKVRFPLFTSKVNYRNHRKIVVIDGRIGFIGG
E6STH3_BACT6          WHVP----NSFFEEMREAG---VEVRSFLKVRFPLFTSKVNYRNHRKIVVIDGRIGFIGG
F2KVH0_PREDF          WKTK----NRFFDRMRAEG---IEVYPFMPVRFPVFTSKVNYRNHRKICVIDGEVGFIGG
A6LEV6_PARD8          WNVK----DGFFKEMKEAG---IEVYAFLRVAFPVFTSKVNYRNHRKIIVIDGKVGFMGG
F4KNV2_PORAD          IRSDL---KGFWKPLRRAG---GEVYAFLPVRFPFFNLRINYRNHRKVVVIDQRIGYFGG
G0EI26_BRAIP          LKR-I--SRKYRKELKANG---IKFLYYHDPFSILWTRFVNYRNHRKIVVVDGVVAYMGG
C7N8V3_LEPBD          W-K-L--PKEYKKELRNAG---IETRWFLDVKFFMSK--MNYRNHRKIALFDNQIVHTGG
D1AL33_SEBTE          FGR-I--SRKYKKALEKAG---IKYRYFLDVRYNILK--LNYRNHRKMVIVDGNVLHTGG
C0QIT7_DESAH          Y---L--NSRYRRKLRAMG---IKIYPYFNFASPLRIHTLNYRNHRKIVVIDGTTGYLGG
A5N6C2_CLOK5          IRLG----RKYISDLKDSGVDVVQYSYFLAPILRHINTQINYRNHRKTVVIDGKVGFVGG
C1FU71_CLOBJ          IGIK----RFYIKELKDNGIDVVQYSYFLAPLLRHINTQINYRNHRKIVVIDGKTGFIGG
D9SSA2_CLOC7          ITCK----KSFIEEMKNNGIEIVYYDYFLAPLFRHINTQINYRNHRKIVVIDGIVGFIGG
Q8R663_FUSNN          ANFR----LKQYFKNTG-----VNLHLFFRTYIPIFNIRLNYRNHRKVTIIDNRIAFVGG
F4LIP6_TREBD          ISTP----TGFFRKLDKAGGK----SLAFFPVRRGLPFSINFRNHRKITVIDGTIAYMGG
                                                              : : **:   .*      *.

CLS_CLOPE             FNIGDEYLGK--DKNIGHWRDTHTKIKGLAINDLEGRFLLDWSYANESDLDIDLKKYFIN
CLS_CLOPS             FNIGDEYLGK--DKNIGNWRDTHTKIKGLAINDLEARFLLDWSYANESDLDIDLKKYFIN
B2TQ76_CLOBB          FNVGKEYINR--DPKVGFWRDTHVRIRGGAVNDLNERFLLDWCYASE-EVISDYNKYLSD
E3GG29_9FIRM          FNVGDEYLGL--KKKMGYWRDTHLKIEGYAAYELQMRFFLDWRTSGNKAKLNINSENIHR
Q180Q2_CLOD6          YNVGDEYLGR--NPKFGLWRDTHTKLTGDCVIDLNMRFILDWRYTTKEDLDLEKYFIEED
Q0SUY9_CLOPS          FNVGDEYLGK--DPKFGYWRDTHIKFMGDSVRDLDLRFWADWKYATKEDIDLIHLMDYKN
D9R3X0_CLOSW          FNIGREYISK--DTRFGYWRDTHLKLMGGSVLSLQIRFALDWNYAAGENLFRNMKYFCED
E4RNC0_HALHG          INVGEEYIGH--SKRFADWRDTHLRIKGKNVDSMQHRFLLDWNFAYGKELFNEEKYFPPK
CLSA_BACSU            FNVGDEYLGL--NPKFGYWRDTHIRLQGTAVHAIQTRFILDWNQA-SHHH----TLTYIP
A0A1Y0XPV7_BACAM      FNVGDEYLGL--NPKFGYWRDTHLRLQGTAVHAIQTRFILDWNQA-SHHH----TLTYVP
E6U0D1_BACCJ          FNVGDEYLGK--SKKFGYWKDTHLRIKGPAVDAIQTRFILDWNQA-SKRY----QIDYHE
Q5WH00_BACSK          FNVGDEYLGK--SKKFGYWRDTHLRIVGPAVQAIQTRFILDWNQA-SKQY----HISYHD
CLS_OCEIH             FNVGDEYLGI--NKKFGYWRDTHLRVIGDAVQSMQTRFILDWNQA-SRD-----TILYNE
CLS_LISMO             FNIGDEYLGA--SKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSA-SSTH----KIDYKA
CLS_LISMH             FNIGDEYLGA--SKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSA-SSTH----KIDYKA
CLS_LISIN             FNIGDEYLGR--SKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSA-SSTH----KIDYKA
CLS_LISW6             FNIGDEYLGL--SKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSA-SSTN----KIDYKP
Q2FWG8_STAA8          FNVGDEYLGK--SKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQ-ATRD----HISYDD
A0A0H2XGI3_STAA3      FNVGDEYLGK--SKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQ-ATRD----HISYDD
CLS_STAAN             FNVGDEYLGK--SKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQ-ATRD----HISYDD
CLS2_STAAR            FNVGDEYLGK--SKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQ-ATRD----HISYDD
CLS2_STAES            FNVGDEYIGK--SKKFGYWRDTHLRIKGDAVNALQLRFILDWNSQ-STRD----NLTYES
A0A269XG22_9STAP      FNVGDEYLGK--SKKFGYWRDTHLRVEGDAVNALQLRFILDWNSQ-STRD----NITYEE
B9DMH7_STACT          FNVGKEYLGM--SKRFGYWRDTHLRIVGDAVNALQLRFILDWNSQ-AKRH----NITYSD
CLS1_STAES            FNVGDDYLGL--GK-LGYWRDTHTRVQGEGIDALQLRFILDWNSQ-SHRP----QFKFDQ
CLS1_STAEQ            FNVGDDYLGL--GK-LGYWRDTHTRVQGEVIDALQLRFILDWNSQ-SHRP----QFKFDQ
CLS1_STAAC            FNIGDEYLGL--GK-LGYWRDTHLRIQGDAVDALQLRFILDWNSQ-AHRP----QFEYDV
A0A0H2XHS8_STAA3      FNIGDEYLGL--GK-LGYWRDTHLRIQGDAVDALQLRFILDWNSQ-AHRP----QFEYDV
A0A0H3JKV8_STAAN      FNIGDEYLGL--GK-LGYWRDTHLRIQGDAVDALQLRFILDWNSQ-AHRP----QFEYDV
CLS1_STAAR            FNIGDEYLGL--GK-LGYWRDTHLRIQGDAVDALQLRFILDWNSQ-AHRP----QFEYDV
A0A0H3JVZ5_STAAW      FNIGDEYLGL--GK-LGYWRDTHLRIQGDAVDALQLRFILDWNSQ-AHRP----QFEYDV
C4L225_EXISA          FNVGDEYLGK--DEHFGYWRDVHLRISGDAVKELLERFILDWNRSVPTKT----KARKDD
K0ACB4_EXIAB          FNVGSEYLGE--DEQFGYWRDTHLRVLGPIVEELEFHFEQDWDAASNERT----DWSTA-
D5DYP7_BACMQ          FNVGDEYLGL--DPKMGYWRDTHFRIKGESVNDIQGRFILDWHQATKQPI----ELEQF-
F9VD31_LACGL          FNVGDEYATE--TAKFGYWRDTHLRLTGDVVYSLQNRFIMDWNSQ--HKF----EISEAE
D2BQ69_LACLK          FNVGDEYASI--TKKFGYWRDNHLRLTGDIVYSLQHRFILDWNSQ--HHF----EVTEGE
A0A2Z5Y2W0_9ENTE      FNVGIEYLGE--VEKFGYWRDNHLRIHGSAVYSLQNRFLMDWNSQ--HTK----EIGYEK
C8WXS3_ALIAD          FNVGDEYLGK--DERFGFWRDTHLRIEGSAILELQSIFLLDWNSS--SKH----PIEFED
E4SJR8_LACAR          FNIGDQYLGK--KKKFGHWRDSQVRIVGSASLLLQERFVMDWNASVKEA--DQI-IRFNS
A8YWN2_LACH4          FNIGDQYLGR--KKKFGHWRDSQVRIVGSASLLLQERFVMDWNASIKCP--EQL-IRFNS
Q1G7R6_LACDA          FNVGDQYLGR--KKKFGYWRDTHLRLVGSASLLLQERFVMDWNASAVKE--EEL-ISFDE
Q74LT8_LACJO          FNVGDQYVSK--SKKFGYWRDTHLRIVGSASLLLQERFVMDWNASITDK--NQT-ISFNE
A0A087QBG6_LACGS      FNVGDQYVSK--SKKFGYWRDTHLRIVGSASLLLQERFVMDWNASVTNK--NET-ISFNE
G4L828_TETHN          FNVGDQYVGT--TEKFGYWRDTHARIVGTASFSLQEIFIRDWNASIKNK--KDL-LEYEE
Q834N6_ENTFA          FNVGDQYLNV--TEKFGYWRDTHIRLVGTAVFSLQEIFIMDWNASVKYP--EER-MTYHE
A0A0C9NY80_LACPA      FNVGDQYVSR--KPKFGYWRDTHLRIIGNTIYALKIRFTMDWNATVSKK--DEIAYSVEQ
Q03D64_PEDPA          FNVGDQYLGR--KKKFGYWRDTHLKIIGSGVYGLQSRFILDWNATDRKKQ-IVEEFKAGS
A0A4R5NTZ5_LACBU      FNIGDQYLGR--KKKFGNWRDTHIRIIGSGVFGLQARFILDWNATSPRDQ-IDED-QVEP
F8DR80_LACRS          FNVGDQYLGR--VPKFGPWRDTHLRIVGGGVYGLQRRFIGDWNASMKKD---EDKIVHYH
F8DQG8_LACRS          FNIGDQYLGE--DPKFGYWRDTHLRVVGQATMMMTVRFAMDWNTTCRKTHKKKIDLEKEF
A0A0N7CKV9_LACFE      FNIGDQYLGE--SPKFGYWRDSHLRVEGTAVLMMQARFIMDWNTTCRRTKKERMDLAGDY
F0TFK7_LACAM          FNIGDQYVNQ--SKKFGHWRDTHLRVEGQSPILMEVRFAMDWNTSTRRTSLPKFELD-EL
G2SPV9_LACRR          FNVGDQYLGL--SKKFGYWRDTHLRIVGNACAVMQSRFFMDWNATIARTR-EKDRLEYSN
D5T540_LEUKI          FNVGDQYLGE--FKKFGHWRDTHIRIHGDAVLSMQSRFLMDWNATAEANE----LLTQTI
B1MZZ2_LEUCK          FNVGDQYLGQ--FKKFGHWRDTHLRIHGDAVLSLQSRFLMDWNATAEPNE----LLVKTT
Q03YM9_LEUMM          FNVGDQYIGE--SKKFGYWRDTHTRIIGDAVLSLQSRFLMDWNATAEGRE----LLTQTT
G8PCK9_PEDCP          FNVGDQYIGK--NSRFGYWRDTHLRILGSSVLQLQSRFFMDWFASAKTS-----SVAIGL
Q38XB9_LACSS          FNQHSVDTHL--P-----VRDTRLRISGDGVLSFQSRFFMDWNAATQRQK-----VYYSQ
K8QPY8_LACRH          FNLGKEHRGL--PT----LRDTQLRIQGKAVAVIQARFLMDWNGTSKKQQ-----VKDVD
Q2FM09_METHJ          FNIGDDYLSR--VPEWAPWRDTAVQVTGHAVLAMQIRFFLDWNYAAKEDK-----VEYAA
I7KE57_METBM          FNIGDDYLGK--GP-LGPWRDTAFRITGRAVQLLQLRFFLDWHYVTGEYPG----PGPRS
A2STU9_METLZ          FNIGDEYLGK--GP-MGYWRDTHLRLHGKAVIALQTRFIMDWNYAAKDAQIS--VEDRDT
F4C7E2_SPHS2          INVADRYVNDERQEQQIFWRDTHVRIKGQGSLYLQYIFLCDWNFCSPNKLHPEPRFFSEL
F0REG6_CELLC          INVSDNYVNSTQTTDAVFWRDTHLKLEGPAVTYLQYIFLSDWNSCSNQNLILEKEMYVPF
F0SEL0_PSESL          INISDRYINS--SSDQLYWKDAHLMIKGYSTLSLQQIFLADWNFCSKENLMVNKDYFPPI
A3UAU3_CROAH          VNISDEYCNG---QNDVYWRDTHLKIEGDAVKSLQSQFLLNWSFVTDQEIDIEEKYFPSV
G7WDL9_DESOD          LNIGDEYLSR--DSKLGFWRDTHLKLQGEAVHAIQAVFLNDWYYVTRQQIK-GEHYFPKT
I4D6Z5_DESAJ          LNIGDEYLSR--NPKLGFWRDTHIKLLGESVHTLQTIFLNDWYSVSEQEIK-GEIYFPKV
I4D626_DESAJ          LNVGDEYLSR--NQRIGFWRDTFLKLEGDSVNFLQAVFLNDWNGTTRQNVF-LPEYYPQS
L0F6D5_DESDL          INIGDEYLSL--SPKYGFWRDTHLRLEGESVQTIQETFLNDWYFTTNNIVR-DKRYFPEY
F8FPP2_PAEMK          LNIGDEYLGR--NSSLGFWRDTHLRLEGDSVYSLQMTFIRDWLFVSGERLT-ETAYFPEH
G7W0D8_PAETH          INVGDDYLGK--YPKVGFWRDTHLQIEGDSVYFLQNAFLSDWKLASGERMM-DENLFPPH
Q18CT1_CLOD6          INIGDEYLGK--NDKFGYWRDTHIRIKGISVYMLQMTFLIDWYYTTKEVLV-TKNYFPSV
A8MKY4_ALKOO          LNIGDEYLGK--NKKMGFWRDTHLMLQGEAVYVLQGIFLADWYFVSNENID-NLRYFPSQ
C8W5E6_DESAS          LNIGDEYLSK--GE-LGFWRDTHLEIKGEAVAFLQRIFLLDWHFATGNSIV-SPQYFPVQ
CLS_GEOSW             LNIGDEYLGK--DKYFGFWRDTHLWIRGEAVRTLQLIFLQDWYYMTGK--TLLTPEYLSP
A0A150LT19_9BACI      LNIGDEYLGK--DKYFGFWRDTHLWIRGEAVRTLQLIFLQDWYYMTGK--TLLTPEYLSP
CLS_GEOKA             LNIGDEYLGK--NKYFGFWRDTHLLIRGEAVRTLQLIFLQDWYYMTGE--RLLTPDYLSP
B7GLL6_ANOFW          LNIGDEYLGK--NEYFGFWRDTHLFVYGEAVRTLQLIFLQDWYYMTGQ--QLLTMNYLSA
CLS_ALKPO             LNIGDEYLGK--DAYFGYWRDTHLYVRGEAVRTLQLIFLQDWHYQTGE--TILNQTYLSP
CLS_BACHD             LNIGDEYLGK--DPYFGFWRDTHLYVRGEAVRTLQLIFLRDWAHETGE--TILKPSYLSP
D5DAK4_BACMD          LNIGDEYLGK--SRHFGFWRDTHLMVKGEAVRSLQLIFLQDWYYMTGQ--TMLTQTYLSP
CLS2_BACAN            LNIGDEYLGK--DKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGE--AVLAPEYLQA
A0A6L5LQC1_BACTU      LNIGDEYLGK--DKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGE--AVLAPEYLQA
CLS2_BACCR            LNIGDEYLGK--NKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGE--AVLAPEYLQA
D3EML0_GEOS4          LNVGDEYLSR--SKAFGFWRDTHMLVRGEAVRTLQVVFLQDWQYMTGE--QPNEPIYYSP
E0RIJ1_PAEP6          LNVGDEYLSR--NKAYGFWRDTHMIVKGEAVRTLQLIFLQDWLHMTGE--SVLDSEYLSP
C4L577_EXISA          LNVGDEYLGE--HSKFGFWRDTHLYVRGEGVSELQLIFLQDWYYMTGE--RLFTPFYLEP
K0AE21_EXIAB          INVGDEYMGK--DKAFGFWRDTHLIVRGEAVSELQLIFLQDWYYMTGE--RLFTPYYMKP
CLS1_BACSU            LNVGKEYISR--DPYIGFWRDTHLRLEGEIVQTLHAIFMLDWEYVSNE--VLIDQEEYNT
I0JTA9_HALH3          LNIGDEYLGR--HPKIGFWRDTHLKVKGESIRSLQTIFMIDWSYLKNE--TLGLDTYTPV
CLS1_BACAN            LNVGDEYLGR--SKKFPVWRDSHLKVEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNR
A0R9Q9_BACAH          LNVGDEYLGR--SKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNR
CLS1_BACCR            LNVGDEYLGR--SKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNR
B7IX03_BACC2          LNVGDEYLGR--SKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNR
A9VEQ6_BACMK          LNVGDEYLGR--SKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNR
B1YEW0_EXIS2          LNVGDEYDGK--SKKFGFWRDTHLRLEGRAVKELQATFLDDWLYAHLE-GSDTWETFAGE
A0A0B8RBT6_LISMN      LNIGEEYRSN--TPDFRVWRDTHIKITGQAVIELQESFLNDWVYMENQ--AGAADQFISE
A0A0E0URT5_LISMM      LNIGEEYRSN--TPDFRVWRDTHIKITGQAVIELQESFLNDWVYMENR--AGAADKFISE
A0AEJ4_LISW6          LNIGEEYRSN--TPDFRVWRDTHIKITGQAVIELQESFLNDWIYMENQ--AGAADKFISD
E6XF61_CELAD          INISDKYLKG--DETLGKWHDMHLQIIGPAAKHLDYVFVMDWYLVS-QKDCTPVKIDRTI
G2PJ59_MURRD          INISDKYLKG--DPALGKWHDTHLKIEGEAVDYLNRIFVGDWYLAS-ENKVDIAAFKVYK
G0L287_ZOBGA          VNVSDKYING--DPVLGTWHDMHLRLRGPIVNSLQAVFAMDWSFASGKDDMLTLSYFSNI
E1WLD8_BACF6          MNLAERYMRG---FSWGIWRDTHILLEGKAVHGLQTAFLLDWYFVDRTLITASRYFPKIE
Q64YC9_BACFR          MNLAERYMRG---FSWGIWRDTHILLEGKAVHGLQTAFLLDWYFVDRTLITASRYFPKIE
E6STH3_BACT6          MNLAERYMCG---FPWGIWRDTHWLLEGKAVHGLQTAFLLDWYFVDRTLITSARYFPKLE
F2KVH0_PREDF          MNIAMRYVKG---FGKLAWRDTHVKITGAAVYGLQRAFLVDWFFVSQSLIADHGYYPVNK
A6LEV6_PARD8          MNIADRYDKG---TSWGTWRDTHFKFVGKGVHGLQSVFLIDWYVVSKKLLNDRIYYPAAQ
F4KNV2_PORAD          MNVAQYYTQG---NELGQWRDTHFRIEGSAVAGLQRVFLVDWAVAVRKRFDLEPYFAKID
G0EI26_BRAIP          MNMGQEYIDG--GKRFNSWKDVHMRIVGDSCNLIQNVFVCDWYNAGGRDLEIFNIEENKH
C7N8V3_LEPBD          MNVGQEYIDG--GKRFESWRDTNIRITGEIIGQYLAIFVTDWLNSGGKDDFIEDIKKEAV
D1AL33_SEBTE          MNLGQEYIDG--GKQFESWRDTNIRITGEMCVHYLAVFISDWLNSSGKFDFI-------I
C0QIT7_DESAH          MNMGEEYIDG--GRRFPHWRDTHLRIQGEAVAVLQEVFNVSWFNTTREELTMESDTAFDT
A5N6C2_CLOK5          INIGDEYLGH---SKYGYWRDTHIMVEGDFVFGLQAVFIDDFATIKSANKDYFFYDGNFE
C1FU71_CLOBJ          INIGDEYLGK---GKLGYWRDTHLMIKGDFVMGLQAVFMDDFATIKAVNDEMFTYGDNFK
D9SSA2_CLOC7          INIADEYLGK---GKLGFWRDTHLMIKGSFVLGLQSVFLDDYLTIQRANKYYVFYDFDFE
Q8R663_FUSNN          MNIGDEYLGK---GKIGYWRDTSVKIYGDIVSSFEKEFYFSLSIVKNEFLKDEKFSNEIS
F4LIP6_TREBD          VNVGDEYANRNRSNRKPFWRDTHIRFTGTSVVQLQTVFCIDWFSMPAWKTRLHGPEDTAK
                       *                 :*    . *         *  .                   

CLS_CLOPE             PHS----------------------TDLPKK--IIGAQIVSSGPD-HTEQQIKNGYFKII
CLS_CLOPS             PHS----------------------TNLPNN--IIGAQIVSSGPD-HTEQQIKNGYFKII
B2TQ76_CLOBB          -------------------------KNEEVG--DVGIQIVTSGPD-HEEEYIRNAYIKLI
E3GG29_9FIRM          YFP----------------------YMENCE--GSGIQIVSSGPD-DPNQVIKQGFIRMI
Q180Q2_CLOD6          TNS----------------------NHPSEN---IGIQIVSSGPDISELDEIKYGYLKMI
Q0SUY9_CLOPS          EQA----------------------PSKMANYSKCGMQIISSGPNPDNFYEIKLSYLEMI
D9R3X0_CLOSW          EDGRCL--------------DSMGVVDMSDERKHLGIQIIASGPD-ARSRQIRDNYIRLF
E4RNC0_HALHG          --------------------------NINDGS---PVQIVSSGPD-SKEQIIKSLFLKMI
CLSA_BACSU            NHFP--------------------DYGPK---GNVGMQIVTSGPD-SEWEQIKNGYIKMI
A0A1Y0XPV7_BACAM      NHFP--------------------ECEPK---GNVGMQIVTSGPD-SEWEQIKNGYIKMI
E6U0D1_BACCJ          DYFP--------------------KKQYN---GTAAIQIVSSGPD-SEWEQIKNGYIKMI
Q5WH00_BACSK          RYFP--------------------EVQPA---GDTPVQIVSSGPD-SEFEQIKNGYLKMI
CLS_OCEIH             DYYQ--------------------TVS-A---GNVGMQIVTSGPD-SEYEQIKNGYIKMI
CLS_LISMO             RYFP--------------------TFHGK---GHTSMQIVSSGPD-SEWQQIKNGYIKMI
CLS_LISMH             RYFP--------------------TFHGK---GHTSMQIVSSGPD-SEWQQIKNGYIKMI
CLS_LISIN             RYFP--------------------TFHGK---GHTSMQIVSSGPD-SEWQQIKNGYIKMI
CLS_LISW6             RYFP--------------------TFHGK---GHTSMQIVSSGPD-SEWQQIKNGYIKMI
Q2FWG8_STAA8          RYFPD-------------------VNSG----GTIGVQIASSGPD-EEWEQIKYGYLKMI
A0A0H2XGI3_STAA3      RYFPD-------------------VNSG----GTIGVQIASSGPD-EEWEQIKYGYLKMI
CLS_STAAN             RYFPD-------------------VNSG----GTIGVQIASSGPD-EEWEQIKYGYLKMI
CLS2_STAAR            RYFPD-------------------VNSG----GTIGVQIASSGPD-EEWEQIKYGYLKMI
CLS2_STAES            RYFPD-------------------VDSG----GTIGIQIASSGPD-EDWEQIKYGYLKMI
A0A269XG22_9STAP      RYFPD-------------------VDSG----GTIGIQIASSGPD-EEWEQIKYGYLKMI
B9DMH7_STACT          RYFPD-------------------IDTG----ESTGIQIASSGPD-EDWEQIKYGYLKMI
CLS1_STAES            KYFPK-------------------KIGDK---GNAAIQIASSGPA-FDLHQIEYGYTKMI
CLS1_STAEQ            KYFPK-------------------KIGDK---GNAAIQIASSGPA-FDLHQIEYGYTKMI
CLS1_STAAC            KYFPK-------------------KNGPL---GNSPIQIAASGPA-SDWHQIEYGYTKMI
A0A0H2XHS8_STAA3      KYFPK-------------------KNGPL---GNSPIQIAASGPA-SDWHQIEYGYTKMI
A0A0H3JKV8_STAAN      KYFPK-------------------KNGPL---GNSPIQIAASGPA-SDWHQIEYGYTKMI
CLS1_STAAR            KYFPK-------------------KNGPL---GNSPIQIAASGPA-SDWHQIEYGYTKMI
A0A0H3JVZ5_STAAW      KYFPK-------------------KNGPL---GNSPIQIAASGPA-SDWHQIEYGYTKMI
C4L225_EXISA          FVWPT-------------------EGISH---HAAPVQIVTSGPN-SSTEHLKNMLVKMI
K0ACB4_EXIAB          -PIPP-------------------LADSQ---ERVPAQIVTSGPT-SETEYLKNMLIQMI
D5DYP7_BACMQ          --LHR-------------------TETHS---GTVPVQIVASGPN-STTQHLKNMYISLI
F9VD31_LACGL          EYFPA-------------------ALEE----GRIITQFVTSGPD-EVKAQIKMTYMKMI
D2BQ69_LACLK          PYFPD-------------------SIVE----GHVATQLVTSGPD-EDKEQIKLTYMKMI
A0A2Z5Y2W0_9ENTE      SLFPK-------------------IHSN----GQKAVQIVTSGPD-SEHEQIKMTYLKMI
C8WXS3_ALIAD          RYFPR-------------------VHGRP---GATGMQVVASGPD-TDWEQIRNAYIKMI
E4SJR8_LACAR          TLFPD-------------------LDETNIHQGDIATQIVSDGPD-RYTPYMRNGMMRLM
A8YWN2_LACH4          ALFPD-------------------LDEKKIHRGDVATQIVSDGPD-RYIPYMRNGMMRLM
Q1G7R6_LACDA          KLFPD-------------------LDENDISKGDMAVQVVSDGPD-NDEPYMRNGLVRLM
Q74LT8_LACJO          KLFPK-------------------IEENQLTEDDVATQIVSDGPD-TSTPYLRNGMIRMM
A0A087QBG6_LACGS      KLFPK-------------------IEENKLTEDDVATQIVSDGPD-TSTPYLRNGMIRMM
G4L828_TETHN          SYFVL-------------------PTQDDN--VDVPMHVVADGPE-SIEQVIEGGFIKTI
Q834N6_ENTFA          KYFKL-------------------PEDHEV--EHLSLQVVSDGPD-SEEEILKSGFVRMI
A0A0C9NY80_LACPA      DSADS-------------------VTADSLTAGATPIQIVASGPD-RPTQQIKLGYTKLI
Q03D64_PEDPA          VYFPV-------------------AE----VKGNTSLQIVSNGPD-SDIEKIKMGYLKMI
A0A4R5NTZ5_LACBU      KYFPV-------------------TT----TKGNVNMQIVSSGPD-SDLQQIKMGYIKLI
F8DR80_LACRS          PYFQP-------------------IR----VHGDVALQTVSSGPE-APLEKIKMGYLRLI
F8DQG8_LACRS          KNFEL-------------------VAPDS-DPDEVPMQIVSSGPD-NENYSIRRGYESII
A0A0N7CKV9_LACFE      VNVRT-------------------TRLKNLDRSMVPMQIVSSGPD-NDNRAIRRGYQGII
F0TFK7_LACAM          KNFIV-------------------DRKDFESDNNVAMQIVASGPD-NQRYGIRRGYEGII
G2SPV9_LACRR          HYFPL-------------------EK----SKGQTSIQIVSSGPD-SETEAIRLGYLKMI
D5T540_LEUKI          DYFPE-------------------IS---ELPGRSMVQIVSSGPD-NDLKQIKQGFMRMF
B1MZZ2_LEUCK          QYFPV-------------------IS---TLPGRSMVQIVSSGPD-NDMKQIKQGFMRMF
Q03YM9_LEUMM          KYFPE-------------------NF---SLPGKSMVQIVSSGPD-DDMKQIKQGYMRMF
G8PCK9_PEDCP          EYFPQ-------------------N----ELDQSVPMQIVSSGPE-SDIQKIKQGYIKMI
Q38XB9_LACSS          HYFPT-------------------SV----EHGQTSMQLVSGGPD-RDLPEIKLGFLKLI
K8QPY8_LACRH          VLFRE-------------------PV----VTGNTTMQIVAGGPG-QQVEAIKLGYLGLI
Q2FM09_METHJ          RYFPD-------------------EGAM-EDAWLP-VQIVSGGPD-TYWNPIKESYLKLI
I7KE57_METBM          HYFPD-------------------PG---DRGTTP-VQIVSGGPD-TRWNPIKEGYIKLI
A2STU9_METLZ          PYYPE-------------------EGFR-DVAGHSYIQIASSGPD-SAEKAIYSGYLSLI
F4C7E2_SPHS2          SS----------EEGR------------------SLVQIVSSGPD-SVSPSILYTLLKAI
F0REG6_CELLC          NSF--------AYTDT------------------KLVQIAASGPD-SNSPTILYSILQAI
F0SEL0_PSESL          EI---------DREHS------------------IPVQITSSGPD-SELPSILFAIVQAV
A3UAU3_CROAH          NF-----------KAN------------------LPIQIVASGPD-SRWPYIMEAIFMAI
G7WDL9_DESOD          KI-----------SQM------------------LPIQILASGPD-SKWNSILYSFFSSI
I4D6Z5_DESAJ          DI-----------PDI------------------LPIQIGVGGPD-TTRSSILQGFFVAL
I4D626_DESAJ          KQ-----------LAV------------------QMTQIAATGPD-SNWGSMLEIFFVAL
L0F6D5_DESDL          EL-----------FGD------------------LLTQIIGGGPD-SKHESVKALFYTIV
F8FPP2_PAEMK          EI-----------RGR------------------KPVQVISSGPD-AHWDAVLEMFFGSV
G7W0D8_PAETH          TC-----------EGD------------------EEVQILSSGPD-RVWDTIQEMCFGAL
Q18CT1_CLOD6          GN-----------VGE------------------SMIQVVASGPD-SDWEDIHYAYFSAI
A8MKY4_ALKOO          GY-----------CGE------------------KIVQIASSGPD-SHWASIHQAYFSAI
C8W5E6_DESAS          KF-----------QAN------------------QPIQIASGGPD-SERASIQQVYFATI
CLS_GEOSW             E------LVHYDGQ--------------------GGVQLIAGGPD-QKWEVIKHLYFAMI
A0A150LT19_9BACI      Q------LVHYDGQ--------------------GGVQLIAGGPD-QKWEVIKHLYFAMI
CLS_GEOKA             P------LIVEEGQ--------------------GGVQLIAGGPD-QKWEVIKQLYFAMI
B7GLL6_ANOFW          P------TVEDEAL--------------------GGVQLVAGGPD-TKWEVIKHLFFAMI
CLS_ALKPO             S------LSMTKGD--------------------GGVQMIASGPD-TRWEVNKKLFFSMI
CLS_BACHD             A------LTNMKDD--------------------GGVQMIASGPD-TRWEINKKLFFSMI
D5DAK4_BACMD          D------LIDIDMEKC------------------GGVQMIAGGPD-REWEIIKHLFFSMI
CLS2_BACAN            K------AVEGEHW--------------------GGVQLVAGGPD-NKWETIKHLYFAMI
A0A6L5LQC1_BACTU      K------AVEGDHW--------------------GGVQLVAGGPD-NKWETIKHLYFAMI
CLS2_BACCR            K------AVEGDHW--------------------GGVQLVAGGPD-NKWETIKHLYFAMI
D3EML0_GEOS4          D------LLENRSG---------------------AVQIIASGPD-NERRALKNIFFSMI
E0RIJ1_PAEP6          N------IEPIPDG---------------------GVQIIASGPD-NERRVLKNLFFSMI
C4L577_EXISA          L------ETVRSAS--------------------GGVQIVASGPD-EPYETMKSIYFSLI
K0AE21_EXIAB          L------EVMEEAT--------------------GGVQIIASGPD-EPHETMKSLYFGLI
CLS1_BACSU            P------VPVEGGG---------------------IYQIVATGPD-MKESM-SDLYYEMI
I0JTA9_HALH3          Q------NKEEYSG---------------------GVQILGSGPD-ANQGMIAELYFDMI
CLS1_BACAN            ----QYFPGKEISNAE------------------GAVQIVASGPS-SDDKSIRNTLLAVM
A0R9Q9_BACAH          ----QYFPGKEISSAE------------------GAVQIVASGPS-SDDKSIRNTLLAVM
CLS1_BACCR            ----QYFPGKEISNAE------------------GAVQIVASGPS-SDDKSIRNTLLAVM
B7IX03_BACC2          ----QYFPGKEISHAE------------------GAVQIVASGPS-SDDKSIRNTLLAVM
A9VEQ6_BACMK          ----HYFPGKEIPDAE------------------GAVQIVASGPS-SDDKSIRNTLLAVM
B1YEW0_EXIS2          GAIDQYFPKHDV-ETD------------------GAVQLVTSGPT-SKDPAIRNALIAAI
A0A0B8RBT6_LISMN      AGLQQYFSPVDV--GD------------------EWAQVIYGGPY-DKEKWVRDSMLDLI
A0A0E0URT5_LISMM      SGLKQYFSPVDM--GD------------------EWAQVIYGGPY-DKEKWVRDSMLDLI
A0AEJ4_LISW6          SGLKQYFSPVDM--GE------------------EWAQVIYGGPY-DKEKWVRDSMLDLI
E6XF61_CELAD          EG-----------DAN------------------SLVQIVAGGPD-DDFASLEQTYFSII
G2PJ59_MURRD          AP-----------QKG------------------TSLQIVPSGPD-DDFDVMEQAYFSII
G0L287_ZOBGA          PK-----------IGK------------------SIVQTVSSGPD-SDFPSVHQLYFSLI
E1WLD8_BACF6          AYGN------------------------------SLVQIVTSEPI-GPWKEIMQGLTVAI
Q64YC9_BACFR          AYGN------------------------------SLVQIVTSEPI-GPWKEIMQGLTVAI
E6STH3_BACT6          VCGS------------------------------SLVQIVTSEPV-GPWKEIMQGLVMAI
F2KVH0_PREDF          VEEND-----------------------------SLVQIVTSNPT-SLWPEIEQGYVRVL
A6LEV6_PARD8          IYSD------------------------------NIMQIATSGPV-GQWRTLLQATIFMI
F4KNV2_PORAD          RGASYE--------HP------------------IAMQFLTNGPQ-AHWQTIEQAFIKAC
G0EI26_BRAIP          KHFKKIKYVNKELNEEKVSIIRKDLFPQSFTDKFLPVQIITSGAD-SKWDSIQKVYSKMI
C7N8V3_LEPBD          HELEVQKPIDKQEKLK------------------YLMQVSSSGPD-TEWTTLKYLYSKMI
D1AL33_SEBTE          PEIEDSSSGD------------------------YLMQLCASGPD-TIWSSLQMLYTKMI
C0QIT7_DESAH          MEGEP-----------------------------VHVQITTSGPD-SAWESIQQLYFLLI
A5N6C2_CLOK5          EFFPELSNDT---------------------TGNKLMQLVKSGPD-SQFPAIEQAILKMI
C1FU71_CLOBJ          VYFPKMHE-----------------------YDGKVMQLVKSGPD-SQFQSIMQTIFKMI
D9SSA2_CLOC7          KYFPIPTS-----------------------KGNVPMQLIQSGPE-SEYPSILHSIIKMI
Q8R663_FUSNN          LKYEEDEG--------------------------IYMQLISSGPN-YEFPAIRDNYIKLI
F4LIP6_TREBD          YFPPNVFSDFTQQVSVKEH---PDIFDTIFSTGKIPTQIVTAGPDDIQKTEIEDALIRMI
                                                           :     .                

CLS_CLOPE             NSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPGNPDHKFMGWIANSYFESLLN
CLS_CLOPS             NSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPGNPDHKFMEWIANSYFESLLN
B2TQ76_CLOBB          NNAKNNLYLETPYLVPDLPILEALKISALSGVDVRIIIPGNPDHFFMQWAASSYIGELLN
E3GG29_9FIRM          TNAEKYILIQSPYFVTDESIMEALKIALLSGIDVRIMIPNKPDHIFIYWATLSYVGELIK
Q180Q2_CLOD6          QKARKYIYIQSPYLILDSTFIDTLKIACLSGVDVRVMIPSKPDHPFVYWASYSYAGELLK
Q0SUY9_CLOPS          QKAKKYIYIQSPYLILDDSLTDSLKLASISGVDVRIMIPGKGDHPFVYWANLKYAGDLLN
D9R3X0_CLOSW          SKARDHIYIQTPYFVPDDAVLTTLQVAARSGVDVRLMIPCKPDHPFVYWASYSYVGDLIS
E4RNC0_HALHG          YGAEDNIYIQTPYFIPDQPVLEALKNAARSGIDVKIMIPDRADHPFVYGANHSFVGSLLE
CLSA_BACSU            SNAKRSILIQTPYFIPDASLLDALRIACLSGIDVNIMIPNKPDHAFVYWATLSYIGDLLK
A0A1Y0XPV7_BACAM      STAKRSILIQTPYFIPDSSLLDALRIACLSGIDVKIMIPNKPDHAFVYWATLSYIGDLLK
E6U0D1_BACCJ          MSAKDSIFIQTPYFIPDQSLLDALRIAALSGKDVRVMIPNKPDHPFVYWATLSHVGEILK
Q5WH00_BACSK          MDARKSILIQTPYFIPDQTLLDALRVAAQTGIEVKLMIPNKPDHMFVYWATTSHIGEMLR
CLS_OCEIH             MEANDYICIQTPYFIPDESLRDALKIAVLSGVHVKIMIPNKPDHPFVYWATLSYCGDLIQ
CLS_LISMO             NAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDVRVMIPNKPDHAFVYRATTNYAGELME
CLS_LISMH             NAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDVRVMIPNKPDHAFVYRATTNYAGELME
CLS_LISIN             NAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDVRVMIPNKPDHAFVYRATTNYAGELME
CLS_LISW6             NAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDVRVMIPNKPDHAFVYRATTNYAGELME
Q2FWG8_STAA8          SSAKKSIYIQSPYFIPDQAFLDSIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLD
A0A0H2XGI3_STAA3      SSAKKSIYIQSPYFIPDQAFLDSIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLD
CLS_STAAN             SSAKKSIYIQSPYFIPDQAFLDSIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLD
CLS2_STAAR            SSAKKSIYIQSPYFIPDQAFLDSIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLD
CLS2_STAES            SSAKESIYIQSPYFIPDQAFLDSIKIAALGGVDVNIMVPNKRDHPFVYWATLKNVASLLE
A0A269XG22_9STAP      SSAKKSIYIQSPYFIPDQAFLDSIKIAALGGVEVNIMTPNMPDHPFVYWATLKNVASLLE
B9DMH7_STACT          TSAKRYIKIQTPYFIPDQAFLDAVSIAALGGVDVTIMIPNKPDHPFVYWATQKNVASLLA
CLS1_STAES            MSAKKSIYLQSPYFIPDQSYINALKMAANSGVEVNLMIPCKPDHPFVYWATFSNAADLLD
CLS1_STAEQ            MSAKKSIYLQSPYFIPDQSYINALKMAANSGVEVNLMIPCKPDHPFVYWATFSNAADLLD
CLS1_STAAC            MSAKKSVYLQSPYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLS
A0A0H2XHS8_STAA3      MSAKKSVYLQSPYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLS
A0A0H3JKV8_STAAN      MSAKKSVYLQSPYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLS
CLS1_STAAR            MSAKKSVYLQSPYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLS
A0A0H3JVZ5_STAAW      MSAKKSVYLQSPYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATYSNASDLLS
C4L225_EXISA          TQSKECIYIQTPYFIPDASFLDACRIALMAGTKIKLMIPNKPDHMFVYWATYANAAELVR
K0ACB4_EXIAB          HTAEKSIYIQSPYFIPDASFMDACRIALASGVSLKIMIPNQPDHPFVYWATYAAVGELIQ
D5DYP7_BACMQ          MSAKESVYLQTPYFIPDASFMDACKIALLSGVEIHIMIPNKPDHPFVYWATWSHVGELLT
F9VD31_LACGL          NSAEREIIIQTPYYVPDDALHESLKLALLSGVEVRLMIPNKPDHPLVYWATYYYAADLLK
D2BQ69_LACLK          SGAEREIIIQTPYYIPSDALHESIKLALLSGVQVKLLIPNKPDHPLVYWATYFHAADLVK
A0A2Z5Y2W0_9ENTE      SSAKKEILIQTPYYIPNASIHEALKLALLSGVKVRIQIPNKPDHLLVYWATYSFAAELLE
C8WXS3_ALIAD          YAAKESIYIQTPYFVPDDSLLTALKIASLSGVDVKVMLPGKPDHLWVFWASRFYLGDLLQ
E4SJR8_LACAR          LLARKRLWIQTPYLIPDDAVFAAWQTIAASGVDVRIMIPCKPDHPFIYRATQWYANELTR
A8YWN2_LACH4          QLARKRLWIQTPYLIPDDAVFATWQTIAMSGVDVRIMIPCKPDHPFIYRATQWYANELTR
Q1G7R6_LACDA          MLARKRVWIQTPYLIPDEAMIAAWQILASSGVDLRIMIPCMPDHPFIYRATQWYANQLVK
Q74LT8_LACJO          MMARKTLWIQTPYLVPDDPMIATWVIAAHSGVDVRIMIPSMPDHPFIYRATQWYANYLLH
A0A087QBG6_LACGS      MMARKTLWIQTPYLVPDDPMIATWVIAARSGVDVRIMIPSMPDHPFIYRATQWYANYLLH
G4L828_TETHN          VAAKERVWIQTPYLVPDDSMTSALQVALRSGVDVRIMIPCMPDHPFIYRATQYYANLFQK
Q834N6_ENTFA          FSAEKSVWIQTPYLIPDDSMINALLVAVRSGVDVRIMIPCMPDHPFIYRATQYYANYLHK
A0A0C9NY80_LACPA      TSATKSVWIQSPYLVPDDTVIDALVSAAMSGIDVRIMIPDMPDHPFIFRATQYYANYLTR
Q03D64_PEDPA          HKARESVWIQSPYLIPDDSVLDALRLAATSGVDVRVMIPCMPDHAFVYRATQYYAWQCAK
A0A4R5NTZ5_LACBU      TMAKDYCWIQSPYLIPDDSMMDALRIAAMSGVDVRIMVPSMPDHPFVYRATQYYARQLAE
F8DR80_LACRS          NAAQDHIWIQTPYLIPDDSILDALKVAAHSGIDVRIMIPSMPDHAFVYRATQYYARELAN
F8DQG8_LACRS          SSARKYVYIQSPYLIPEDSVLEALVIAARSGIDVRIMIPCMPDHPFVYRATEYYAKYLVN
A0A0N7CKV9_LACFE      SSARHYVYIQTPYLIPDDAILESLVVAAKSGIDVRIMIPPMPDHPFVYRATEYFAHYLVS
F0TFK7_LACAM          ASAKEYVYIQTPYLIPEDSILESLIIAANSGVDVKIMIPCMPDHPFVYRATEYYAKYLVA
G2SPV9_LACRR          SSANEYICIQTPYLIPDDAVMDALRLAVYSGIKVRIMIPSMPDHPFVYRATEYYARELIN
D5T540_LEUKI          ASAGSEITIQTPYFIPDAAVLETLEIAVMSGVRVRLMIPNKPDHPLVYRATQYYAKELIE
B1MZZ2_LEUCK          ASARTEITIQTPYFIPDAAILETLEIAVMSGVRVRLMIPDRPDHPFVYRATQYYAKELID
Q03YM9_LEUMM          SSARESISIQTPYFIPDGPVLETLEVAILSGVKVKLMIPNQPDHPLVYRATEYYAQELID
G8PCK9_PEDCP          MGAREHIRIETPYFIPDDALMETLLIALKSGLKIDLVIPNKPDHPFVYRATEYYARQLME
Q38XB9_LACSS          AAAKKRLWIQTPFFIPDDSVLAALILAINSGVTVKIMIPEKAKHSLVQHANLYYARQIVK
K8QPY8_LACRH          NQAKRSIWIESPYFVPDDSLLDALTIAANAGVDVRIMVPKKTNQSLMAKASQFYLNQVVA
Q2FM09_METHJ          TLASESVYIQTPYFIPDESIMDALRMAALSGIDVRIMMPAKPDHMFVYWAGYSYIEQLLD
I7KE57_METBM          NSARESVYIQTPYFVPDDSVTDALRIAALSGVDVRVMIPCKPDHPFVYWASLSFIGDLLD
A2STU9_METLZ          GHAKESIYIHTPYFIPDDPMLTELILAARSGVDVRIVIPCKPDHPFVYWANHAYLGDLLA
F4C7E2_SPHS2          ATAKEEILITTPYFIPGESLMDALIIASLSGVNVKLLVPYISDSKIVNAAAHSYYDDLLK
F0REG6_CELLC          YLAEEEILITTPYFIPGESLLDALNIAAMSGLKVKLLVPYESDTLLVNAASRAYYREILN
F0SEL0_PSESL          NLARREILLTTPYYVPDQTLQDSLVIAALSGIDVKLLIPKKGDSLSVSVAAQSYFEELLE
A3UAU3_CROAH          NNAQKSIKITTPYFIPNDQILTALKTASRSGVDVQIIIPKEGDSFAAKYATYSYIEELLE
G7WDL9_DESOD          TMAKESIYIETPYFIPDQSLIIALKTAALSGLDVQLIVQGIPEHKFTYLAMNSYFEELLQ
I4D6Z5_DESAJ          TMAKKNIKIETPYFIPDESLMMALKTAALSGIDVQIIIQGVPEHKVTYWAMNSYLEELLK
I4D626_DESAJ          TSAEKTIFIETPYFIPDEGSMMALKTAALSGLDVRVILQGVPDHKITYWASLSYAEELLE
L0F6D5_DESDL          SAAQSEIFITTPYFIPDESMVMALKSAALKGASVKILLQGKPDHKLPYLASSSYYCDLVK
F8FPP2_PAEMK          TTAKRRIFITTPYFVPDASLLMGLKAAAVSGIDVRIIYPENSDSRIVNYASLSYLEELLQ
G7W0D8_PAETH          AVAKKRIWITTPYFIPDPGIYQALKLAAVSGVDVRIIIPYQSDSKLVHLASLSYVQELLE
Q18CT1_CLOD6          CQARKNVYIETPYFIPDESLLKAIKSAALSGVDVRIIFPKIADHKIVNIASYSYFEEILR
A8MKY4_ALKOO          NTARDRVYITTPYLVPDEGILLALKTAALRGVDVRLLLPIKPDHRTVFLASKSHFEELLE
C8W5E6_DESAS          SSAQEKIFITTPYFVPDESIITALKTAALSGIDVRLVFPAIPDKRLVHWASMSYIKEVLE
CLS_GEOSW             TSAQRSIWIASPYFVPDEDILTALKIAALSGLDVRILAPKRPDKKIVFYASRSYFPELLE
A0A150LT19_9BACI      TSAQRSIWIASPYFVPDEDILTALKVAALSGIDVRILAPRRPDKKIVFYASRSYFPELLE
CLS_GEOKA             TSAKRSIWVASPYFVPDEDILTALKVAALSGIDVRLLAPKRPDKKIVFYASRSYFPELLE
B7GLL6_ANOFW          TSAQRSIWIASPYFIPDEDILTALKVAALSGIDVRLLVPKRPDKKIVFYASRSYFPELLE
CLS_ALKPO             TSAKKSIWIASPYFIPDDDILSALKIAALSGIDVRILVPNRPDKRIVFHASRSYFPELLE
CLS_BACHD             TSAKKSIWITSPYFIPDEDILSALKIAALSGIDVRILVPNRPDKRIVFHASRSYFPELLE
D5DAK4_BACMD          TSAKESIWIASPYFIPDEDIFTSLKVAALSGIDVRLLVPQKPDKKIVFHASRSYFPELLE
CLS2_BACAN            ASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLD
A0A6L5LQC1_BACTU      ASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLD
CLS2_BACCR            ASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLD
D3EML0_GEOS4          VSARKSVWLATPYFIPDEDILTALRVAALSGLDVRILFPSKPDKWLPFLASHSYFPALLD
E0RIJ1_PAEP6          TSARKSVWIATPYFIPDEDILTALRMAALSGLDVRILFPAKPDKWLPFLASHSYFQSLLE
C4L577_EXISA          NAAKKSVYISSPYLIPDEDIMSALKTASLSGIDVRIVLPSYPDHKIVFYASRSYYEELLL
K0AE21_EXIAB          TEARHSVYIASPYLIPDEDLVTALKTAAMSGIDVRILLPSFPDHKIVFYASRSYFDDLLL
CLS1_BACSU            SSAQKSIWIATPYFVPNESIRTALKAAATKGVEVRVMVPEKNDSFLTQYASRSYFPELLL
I0JTA9_HALH3          ATAKHSVWIATPYFVPDKDIRTALSMAAKKGVEVKLMVPEISDGYLPKYATRSYFAQFLN
CLS1_BACAN            GSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIISDQASQSYFTPLLK
A0R9Q9_BACAH          GSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIISDQASQSYFTPLLK
CLS1_BACCR            GSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLK
B7IX03_BACC2          GSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLK
A9VEQ6_BACMK          GSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIISDQASQSYFTPLLK
B1YEW0_EXIS2          ISAQRSIWISTPYLIPDNETMTLLRLAARAGLDVRILTPGKGDSFTSYYGTRSYFGPLLK
A0A0B8RBT6_LISMN      DSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNAYVKTMIE
A0A0E0URT5_LISMM      DSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNAYVKTMIE
A0AEJ4_LISW6          DSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNAYVKTMIE
E6XF61_CELAD          NKAKKYIYITNPYIIPGQAILQALQTAALSGVDVRLLISEQVDSKIVGWSVRSYFEALLK
G2PJ59_MURRD          NSAEKYLYIVNPYIIPNHAILQALITAALSGVDVRILMSSSTDIKLVDWCVRAYYESYLK
G0L287_ZOBGA          NSAKKYIYIVNPYIIPGEALMEALQVAALGGVDVRILLSSNSDSFLVRWGVRSYFENFLE
E1WLD8_BACF6          SGAKKYFYMQTPYFLPTEQILGAMQTAALAGVDIRLMLPEHADNRVTHLGSCSYLADVLR
Q64YC9_BACFR          SGAKKYFYMQTPYFLPTEQILGAMQTAALAGVDIRLMLPEHADNRVTHLGSCSYLADVLR
E6STH3_BACT6          SGAKKYFYIQTPYFLPTEAVIIAMQTAALSGVDVRLMIPCRADNRLTHLGSCSYLADALG
F2KVH0_PREDF          ASAKHYVYMETPYFLPTDPILFAMRTAALSGVDVRLMIPYETDTKIVEWASRSYVMATVK
A6LEV6_PARD8          ANAKKYIFIQTPYFLPTEGLNQALQTAALGGVDVRLMLPKRSDTRSANMASHSFIDEMVK
F4KNV2_PORAD          SIAHEEILVQTPYFLPPEGLLMSLCSAALRGVYVFVMLPERGDSYLTQRASDSYLTQLLK
G0EI26_BRAIP          EEAKESIYIESPYFVPDDGFLRTLENAALSEVNVNLMITGNPDKLVAWWVAQTYFETLLN
C7N8V3_LEPBD          ATAKNEVLIQSPYFVPDSALVSQLKMAALSGVKIKIMVTGVPDKKMPYWIAETYFAELIE
D1AL33_SEBTE          TEAKEEILIESPYFVPDDSIFEQLKIAALSGIKVKIIMAGKPDKKIPFWVAETYFEEIID
C0QIT7_DESAH          SSAEHSIYIHTPYFIPDASIVMALQTAALGGIDVRIILTGLLDKRLPYWAALTFIGDLLT
A5N6C2_CLOK5          SMAKDHIYITTPYFVPTESILNALKISSLSGVDVRIIFPGRFDHILVYYASRTYLEDVLK
C1FU71_CLOBJ          TLAKDHIYITTPYFVPNDSIMNAIKVASLSGVDVRILFPGRYDHLVVYYASRTYLEELIK
D9SSA2_CLOC7          TLAKDHIYITTPYFVPNESLMDVLKIAALGGINIKIMFPHTPDHALVHTASETYLYELVN
Q8R663_FUSNN          QEARKSVFIQTPYFVPDDLLLDTLKSAVLSGIDVKIMIPNKADHPFIYWVNQYYVWELLR
F4LIP6_TREBD          MSAKKYVYIQTPYFTPDAQFFTALRIAAFSGVDVRIMVPGVWDKFYVKAASHEFMREMLA
                        :     : .*:                    : :      .                 

CLS_CLOPE             AGAKIYLY-EKGFLHAKTIVADSSICSVGTANMDIRSFSLNFESNIFIYN-EAISKSMEE
CLS_CLOPS             AGVKIYLY-EKGFLHAKTIVADSSICSVGTANMDIRSFSLNFESNIFIYN-EAISKSMEE
B2TQ76_CLOBB          AGIKIYYY-KNGFIHAKAMVADSTVVSIGTANMDIRSFKLNFEVNAFIFD-DRVAIDYEK
E3GG29_9FIRM          YGARVYIY-DNGFLHAKVLVVDDQIAAVGSCNFDIRSFSLNFETNAFIYD-PEIAVKLRD
Q180Q2_CLOD6          FGAKIYTYGQNAFLHAKTIVIDDSICSIGTANMDIRSFELNFEVNAFMYS-SKKALEQRI
Q0SUY9_CLOPS          FGVKIYHYDKNAFLHSKTLVIDDEVCSIGTANMDTRSFELNFEVIAMLYS-DEIAKIQRK
D9R3X0_CLOSW          AGARCYTY-ENGFLHSKGVMTDGKVSSYGTANMDIRSFELNFEVNAVIYD-EETTRRLEE
E4RNC0_HALHG          SGARCFRY-TKGFLHSKTISIDERILSIGTTNMDTRSFKLNFEINAFIYD-KKVAKEHEE
CLSA_BACSU            AGATVYIY-DNGFIHAKTIVVDDEIASVGTANIDVRSFRLNFEVNAFIYD-ITIAKKLVS
A0A1Y0XPV7_BACAM      AGASVYIY-DNGFIHAKTIVVDDETASVGTANIDVRSFRLNFEVNAFIYD-VTIAKKLIS
E6U0D1_BACCJ          TGAKVYIY-EKGFIHAKKIIVDKQISSVGTANIDIRSFKLNFEVNAFIYD-VKTSEALAF
Q5WH00_BACSK          AGATVYQY-ENGFIHNKVLIVDETVCSVGTANIDQRSFKLNFEVNAFIYD-SQIAGQLIA
CLS_OCEIH             AGAEIFIY-QNGFLHAKTIIVDGRIASVGTANIDVRSFRLNFEVNGFLYD-SEVVNRLQN
CLS_LISMO             TGAKIFIY-DNGFIHAKTLVVDGEIASVGTANMDFRSFRLNFEVNAFIYE-KQMVQKLED
CLS_LISMH             TGAKIFIY-DNGFIHAKTLVVDGEIASVGTANMDFRSFRLNFEVNAFIYE-KQMVQKLED
CLS_LISIN             TGAKIFIY-DNGFIHAKTLVVDGEIASVGTANMDFRSFRLNFEVNAFIYE-KKMVQKLED
CLS_LISW6             TGAKIFIY-DNGFIHAKTLVVDGEIASVGTANMDFRSFRLNFEVNAFIYE-KKMVQKLED
Q2FWG8_STAA8          AGVKVFHY-DNGFLHSKTLVIDDEIASVGTANMDHRSFTLNFEVNAFIYD-QQIAKKLKQ
A0A0H2XGI3_STAA3      AGVKVFHY-DNGFLHSKTLVIDDEIASVGTANMDHRSFTLNFEVNAFIYD-QQIAKKLKQ
CLS_STAAN             AGVKVFHY-DNGFLHSKTLVIDDEIASVGTANMDHRSFTLNFEVNAFIYD-QQIAKKLKQ
CLS2_STAAR            AGVKVFHY-DNGFLHSKTLVIDDEIASVGTANMDHRSFTLNFEVNAFIYD-QQIAKKLKQ
CLS2_STAES            AGVNVYHY-DNGFLHSKTLVIDDEVASVGTANMDNRSFTLNFEVNAFIYD-EGVARSLKQ
A0A269XG22_9STAP      AGVNVYQY-NNGFLHSKTLIIDDEVASVGTANMDHRSFTLNFEVNAFIYD-EGIARSLKQ
B9DMH7_STACT          SGVKIHHY-ENGFLHSKMMVIDDEVASVGTTNMDHRSFTLNFEVNAFIYD-QSTSIQLSE
CLS1_STAES            SGVNIYTY-QNGFIHSKILMIDDEISSIGSANMDFRSFELNFEVNAFIYD-EDIAKQLRQ
CLS1_STAEQ            SGVNIYTY-QNGFIHSKILMIDDEISSIGSANMDFRSFELNFEVNAFIYD-EDIAKQLRQ
CLS1_STAAC            SGVKIYTY-ENGFIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYD-ENLAKDLRV
A0A0H2XHS8_STAA3      SGVKIYTY-ENGFIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYD-ENLAKDLRV
A0A0H3JKV8_STAAN      SGVKIYTY-ENGFIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYD-ENLAKDLRV
CLS1_STAAR            SGVKIYTY-ENGFIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYD-ENLAKDLRV
A0A0H3JVZ5_STAAW      SGVKIYTY-ENGFIHSKMCLIDDEMVSVGTANMDFRSFELNFEVNAFVYD-EKLAKDLRV
C4L225_EXISA          YGAEVFTY-EEGFLHAKTLVIDGEVASIGTTNIDARSFRLNFEISALVFD-QDVATSVID
K0ACB4_EXIAB          HGAEVYTY-EIGFMHAKTIVVDGKIASVGTTNIDARSFRLNFEMNAILYD-AAIAEELEL
D5DYP7_BACMQ          YGANIYLY-EKGFLHAKTIVVDSEVSSVGTTNIDPRSFSLNFEVNAVVYD-QPIAKKLKN
F9VD31_LACGL          MGAKVYTY-EKGFVHSKTLIIDGEYASVGSANFDNRSLQLCFEGNMVLYD-YDISQKLRE
D2BQ69_LACLK          YGAKVYTY-ENGFVHSKTLIIDGEYASVGSANLDYRSLQLCFEANVVIYD-YDISQKLRN
A0A2Z5Y2W0_9ENTE      YGAIIETY-ENGFIHAKTMIIDGGIVSVGSANIDVRSFRLDFEVNTIIYD-QLFSEKVRQ
C8WXS3_ALIAD          AGVQCYLY-RDGFLHAKMVVTDRELASVGTANIDIRSFKLNFEVNALIFD-RDKSGHLAD
E4SJR8_LACAR          CGVKIYIY-EDGFLHAKTTIIDDKFSSVGSMNQDYRSYDLNFEDNAIFYD-KDFNEKMAQ
A8YWN2_LACH4          CGVKIYIY-EDGFLHAKTTIIDDSFSTVGSMNQDYRSYDLNFEDNAIFYD-KKFTKKMTE
Q1G7R6_LACDA          IGVKVYTY-NNGFMHAKTIIVDDKYATVGSVNQDYRSYDLNFEDNVFVYD-RAFNKEMSD
Q74LT8_LACJO          EGIKIYVY-DNGFIHAKTVMVDDRFAAAGSMNQDFRSYSLNFETDAVFYD-KNITRELNH
A0A087QBG6_LACGS      EGIKIYVY-NNGFIHAKTVMVDERFSAVGSMNQDFRSYSLNFETDAVFYD-KNITRELNQ
G4L828_TETHN          LGAKIYIY-EGGFIHAKTLLADDAIASFGTTNQDIRSYELNFEVSAFAYD-EKVNKELAT
Q834N6_ENTFA          RGIKIYIY-DSGFIHAKTMVIDDELAMVGTTNQDIRSYSLNFEVSTFIYN-PDIAWMLAQ
A0A0C9NY80_LACPA      AGVKIYHY-EHGFMHAKTVVVDNAIASVGSANFDIRSFKLNFEINAFIYD-RKVASSLGQ
Q03D64_PEDPA          WGIKVYYY-NNGFIHAKTMVVDGKISTVGSANMDFRSFKLNFEVNAFMYD-ENIAKQLQE
A0A4R5NTZ5_LACBU      EGVKIYYY-GDGFIHAKTMVIDDKISSVGSANLDYRSFKLNFEINAFIYD-QKFSADLRD
F8DR80_LACRS          HGVTIYYY-QKGFLHAKTMMIDGRMASVGSANLDFRSFKLNFEINAFIYN-QNTVDDLER
F8DQG8_LACRS          NGVKVYKY-DNGFIHSKTMVSGSNIASVGSANMDYRSFRLNFEVNAFAYN-EKLTAQLKQ
A0A0N7CKV9_LACFE      NGVKVYKY-DKGFLHAKTMVSGGHLASVGSANLDYRSFRLNFEVNAFTYN-EQLAGELKA
F0TFK7_LACAM          NGVKVYKY-NDGFIHAKTMVSGSNISSVGSANQDFRSYTLNFEVNSFNYN-PLLTKELKE
G2SPV9_LACRR          KGVELYRY-DNGFLHAKTMVIDGQISSVGSANLDFRSFKLNFEGNAFCYD-RDLAKHLTD
D5T540_LEUKI          LGAEVYRY-DGGFLHSKVVIIDHEIGTVGSANMDIRSFVLNFETNAFVYD-PEFATHLET
B1MZZ2_LEUCK          LGAEVYRY-DGGFLHSKVVIIDHEIATVGSANMDIRSFALNFETNAFMYD-PAFAGQLEA
Q03YM9_LEUMM          LGATVYRY-DGGFLHSKVVIIDNEVATVGSANMDIRSFSLNFEGNAFIYD-PDFAADLED
G8PCK9_PEDCP          AGANVYAY-QNGFMHVKAIVVDDVVVSLGSANWDIRSFKLNFEANAFIYH-QNTVLDIKE
Q38XB9_LACSS          AGGQIYLY-KASAFRARTMMVDGQLSAVGTANLDIRSFKLNFETTSFLYD-PALTNTLEL
K8QPY8_LACRH          NGGQAFLY-EEGFLHAKTIVVDGKYVSTGTANFDIRSFKLNFEVAAFLYD-HHLGKTFQK
Q2FM09_METHJ          AGVRAYTY-DTGFIHAKTIVVDEAAASVGSANWDVRSFRLNFETNAIMYD-HKIARELKE
I7KE57_METBM          AGVRAYTY-DDGFLHAKTIVVDGKAGSVGSANWDVRSFRLNFEANAFFYD-AAVGAELAR
A2STU9_METLZ          AGVRGYTY-NDGFIHSKAGVFDGIGTTIGTANWDIRSFKLNFETNAFVYD-LEFGKKMNE
F4C7E2_SPHS2          AGVRIFRY-KKGFIHAKTIVFDSKLAIIGTANMDQRSFDLNFEVMSLILD-PKVAEELRE
F0REG6_CELLC          AGVEVYRY-KKGFVHAKTIVTDKKIAIVGTANMDNRSFELNFEVNAIVYD-EEIATELTK
F0SEL0_PSESL          AGVKIYQY-EKGFIHAKTIVTDREMASVGTANLDSRSFDLNFEVAALIYD-SKIAYKLAI
A3UAU3_CROAH          SGIRVFCY-CKGMVHAKTIVIDEQLSSIGTSNMDYRSFNINFEINALLFN-DDFGKQMTE
G7WDL9_DESOD          AGVKIFQY-MKGTLHAKILIIDNHLALVGSANMDIRSFFLDFEISAFIYD-PIITEELIN
I4D6Z5_DESAJ          AGVQIYQY-MKGILHAKILLIDDNLASVGSANMDVRSFVLDFEISAFIYD-SNITMILKE
I4D626_DESAJ          AGVRIYQY-QKGVLHAKILILDGEIGVVGSTNFDIRSFSLNFEISAFIYD-KPLAHRLEQ
L0F6D5_DESDL          VGVEIYRY-QKGILHSKVITIDQEISIIGSANFDIRSFQLDFELSAVIYN-ANFTKKIVC
F8FPP2_PAEMK          AGVRFYAY-QEGFIHAKVMIIDDLLATVGTANMDMRSFYNNFELNAVLFD-KASIQRLEG
G7W0D8_PAETH          AGVKFYQY-RKGFIHAKVIIVDDLLGSVGTANMDMRSFFYNFELTAVLFA-RSALKHLSA
Q18CT1_CLOD6          AGGKVYLY-NKGFIHSKVVIIDDKIASAGTANMDLRSFMLNFEVNAFIYD-EEVIRVMTD
A8MKY4_ALKOO          AGVKIYQY-GKGFVHGKVFIVDHNFVSIGTANLDIRSFKLNFEVNAFIYD-KEVNRKTAK
C8W5E6_DESAS          AGVKVYLY-QKGFIHAKILLVDGVVASVGTANMDMRSFALNFEVNALIYD-REVVSRLEK
CLS_GEOSW             AGVKIYEY-SKGFLHSKIMIVDGELASIGTANMDMRSFHLNFEVNAFLYH-TDSTKKLVA
A0A150LT19_9BACI      AGVKIYEY-SKGFLHSKIMIVDGELASIGTANMDMRSFHLNFEVNAFLYH-TDSTKKLVA
CLS_GEOKA             AGVKIYEY-EKGFLHSKVIVVDGELASIGTANMDMRSFHLNFEVNAFLYY-TDSIHKLVR
B7GLL6_ANOFW          AGATIYEY-EKGFMHSKIIVVDGELASIGTANMDMRSFHLNFEVNAFLYQ-TPSVRTLVD
CLS_ALKPO             AGVKVYEY-NRGFMHSKIIIVDHEIASIGTSNMDMRSFHLNFEVNAYLYR-TSSVTKLVS
CLS_BACHD             AGVKVYEY-TRGFLHSKIIIVDNEIASIGTSNMDMRSFHLNFEVNAFLYR-TKSVTTLVS
D5DAK4_BACMD          AGVKIYEY-KKGFMHSKIVIVDREIASIGTANMDMRSFHLNFEVNAFLYR-TASTQKLVY
CLS2_BACAN            AGVKIYEY-EKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYD-TDSIRKLVQ
A0A6L5LQC1_BACTU      AGVKIYEY-EKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYD-TDSIRKLVQ
CLS2_BACCR            AGVKIYEY-EKGFLHSKIVIVDSDLASIGTANMDMRSFHLNFEVNAFLYD-TDSIRKLVQ
D3EML0_GEOS4          VGVRVYEY-EKGFMHSKLLIVDGEVATIGTANMDMRSFHLNFEVNALLVH-TDSVSKLVS
E0RIJ1_PAEP6          VGVKVYEY-EKGFLHSKLLIIDGEVATIGTANMDMRSFHLNFEVNALLIQ-THSVQQMVT
C4L577_EXISA          AGVKIYLY-EKGFMHSKVIVVDDGLATIGTANMDFRSFHLNFEVNALLYN-TNSVHQLKQ
K0AE21_EXIAB          AGVKIYEY-NKGFMHSKVIVVDDAIATIGTANMDLRSFHLNFEVNAFLYG-TNSVHELTR
CLS1_BACSU            EGIEVYSY-QKGFMHQKVMIIDGDLASVGTANMDMRSFQLNFEVNVFFTD-AEAIRTLEA
I0JTA9_HALH3          KGIEIYQY-QKGFMHQKIMIVDGRSASIGTANVDFRSLNLNFEVNAFLFR-TSSVQSLID
CLS1_BACAN            AGASIYSY-KDGFMHAKILLVDDKIATIGTANMDVRSFELNYEIISVLYE-SETVHDIKR
A0R9Q9_BACAH          AGASIYSY-KDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYE-SETVHDIKR
CLS1_BACCR            AGASIYSY-KDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYE-SKTVHDIKR
B7IX03_BACC2          AGASIYSY-KDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYE-SKTVHDIKR
A9VEQ6_BACMK          AGASIYSY-KDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIISVLYE-SETVHDIKR
B1YEW0_EXIS2          DGVKIYTY-NRHFIHAKLFLVDGKIAVVGTANMDIRSFVLNYELMAFMYD-SESAARLER
A0A0B8RBT6_LISMN      AGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDESEAMHHLKR
A0A0E0URT5_LISMM      AGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDESEAMHHLKR
A0AEJ4_LISW6          AGAQMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDESEAMHHLKR
E6XF61_CELAD          SGVKINLF-PDGFLHSKIIVSDDAITTIGTANLDDRSFEQNYEVNALIYD-EAFAKLLKT
G2PJ59_MURRD          AGIKIYLY-DDGFLHSKVMLCDDEIASIGTANLDNRSLQQNYEAQVFVYD-AALCKRMKS
G0L287_ZOBGA          AGVRIYQY-PDGFLHSKLMFTDDELTTIGTANLDVRSFEQNYEVNVLAYD-KELTKQLKR
E1WLD8_BACF6          AGVKVYFY-KKGFLHSKLMVSDDMLSTVGSTNLDFRSFEHNFEVNAFMYD-METALQMRE
Q64YC9_BACFR          AGVKVYFY-KKGFLHSKLMVSDDMLSTVGSTNLDFRSFEHNFEVNAFMYD-METALQMRE
E6STH3_BACT6          SGVKVYLY-KKGFLHSKLMVSDDELSTVGSTNVDFRSFEHNFEVNAFVYD-TETALRMRE
F2KVH0_PREDF          AGVKVYLY-KAGFNHSKLLVTDDAMATIGSTNVDFRSFENDFESNAFFYD-RDIALRVKA
A6LEV6_PARD8          AGVKVYLY-KPGFLHSKLVVSDDALTSIGSANMDFRSFEHNFEINAFVYQ-KEFALQMKR
F4KNV2_PORAD          AGVDVRRY-RGGFLHSKLLVVDRRIVGIGSANMDFRSLEINLEVMSFVYD-KQIAEELSE
G0EI26_BRAIP          AGVNIYLY-EKGFLHSKFCVMDGRIVSCGTCNMDIRSFYLHYEMNAVIYD-IDIAKKFED
C7N8V3_LEPBD          AGIEIFRY-KAGFLHSKDIIVDEKISTVGTCNFDMRSFEINYEVNAVFFN-EEISKDLKK
D1AL33_SEBTE          SGMEIYRY-QKGFLHCKNIIIDGKLATMGTCNFDFRSFELNYEINTVYYN-KEMAGKLRE
C0QIT7_DESAH          AGVRFFYY-TRGFMHAKTIVVDDKCCSVGTANMDIRSFQLNYEINALMYD-EILAGKIVA
A5N6C2_CLOK5          NGVKVYFYDKNCFIHSKTTSIDGKVCSIGTANMDIRSYELNYEINAMIYD-EETTEELEN
C1FU71_CLOBJ          YGVKIYFYDENSFIHAKTIMVDGEICTVGTANMDIRSFELNYEINAVIYD-EETTENLEN
D9SSA2_CLOC7          CGVEVYYYNPKGFLHSKSITVDGELCTVGTANMDIRSFFLNYEINALIYD-KNISTILEK
Q8R663_FUSNN          LGANIYRYE-NGFIHSKTILVDEEVVSVGTCNFDYRSFYLNFEINLNIYN-KEVANSFKA
F4LIP6_TREBD          LGIKFYQY--NGFIHSKTMVVDRKIATVGSTNIDTRSFELHFEVNAIFYD-AKLALTCEK
                       *     :      : :    .      *: * * **     *                 

CLS_CLOPE             QFFKDLKV-CTKVTLESFEKRSIISRIGESITRLVSPLM
CLS_CLOPS             QFFKDLKV-CTKVTLESFEKRSIISRIGESIIRLVSPLM
B2TQ76_CLOBB          QFMEDIEF-SEEITIESHANRSTSIKIKESLARLVSPIL
E3GG29_9FIRM          IFYRDIEK-SIYYDTMAYEKRSRVIKVKESISRLFAPLL
Q180Q2_CLOD6          IFENDILN-SKEITLDIYNSRSTYIKIKESISRLLSAVL
Q0SUY9_CLOPS          QFEKDMLI-SKELTREEYLKRGTSVKIKESFSKLFSALL
D9R3X0_CLOSW          LFLRDLER-CKEITREVYEERNLFIRIKEQGSRLLSPLL
E4RNC0_HALHG          IFNNDLKY-SDEITMEDYQNRSWTLKISESISRLLSPIL
CLSA_BACSU            TFKEDLLV-SRKFTYEEYLQRPLWIRIKESVSRLLSPIL
A0A1Y0XPV7_BACAM      SFKEDLLV-SRKYTYEEYQERSLRIRIKESISRLLSPIL
E6U0D1_BACCJ          YFENDIAD-STELTLELYHNRSRTIRFKESISRLLSPIL
Q5WH00_BACSK          DFENDVKH-STQITPEMYENRPISVRFKESISRLLSPIL
CLS_OCEIH             EFDADLEK-STQMTRKLYDQRSIGIRFKESISRLISPVL
CLS_LISMO             AFLEDILK-SYQLTPELYAKRSLWIKFKEAVSRLLSPIL
CLS_LISMH             AFLEDILK-SYQLTPELYAKRSLWIKFKEAVSRLLSPIL
CLS_LISIN             AFLEDILK-SYQLTPELYAKRSLWIKFKEAVSRLLSPIL
CLS_LISW6             AFLEDILK-SYQLTPELYAKRSLWIKFKEAVSRLLSPIL
Q2FWG8_STAA8          AFIDDLAV-SSELTKARYAKRSLWIKFKEGISQLLSPIL
A0A0H2XGI3_STAA3      AFIDDLAV-SSELTKARYAKRSLWIKFKEGISQLLSPIL
CLS_STAAN             AFIDDLAV-SSELTKARYAKRSLWIKFKEGISQLLSPIL
CLS2_STAAR            AFIDDLAV-SSELTKARYAKRSLWIKFKEGISQLLSPIL
CLS2_STAES            AFINDMKL-SNKLTSEEYAKRNLLVKFKEGISQLLSPIL
A0A269XG22_9STAP      AFIEDMKV-SDQLTKEKYASRSLWIKFKEGISQLLSPIL
B9DMH7_STACT          QFNKDLEK-SSQFTLEKYKNRSLWVKFKEGISYLISPIL
CLS1_STAES            AFEKDIEQ-SKLLTKEVYDKRPLSIKFKEGLAKLISPIL
CLS1_STAEQ            AFEKDIEQ-SKLLTKKVYDKRPLSIKFKEGLAKLISPIL
CLS1_STAAC            AYEHDITK-SKQLTKESYANRPLSVKFKESLAKLVSPIL
A0A0H2XHS8_STAA3      AYEHDITK-SKQLTKESYANRPLSVKFKESLAKLVSPIL
A0A0H3JKV8_STAAN      AYEHDITK-SKQLTKESYANRPLSVKFKESLAKLVSPIL
CLS1_STAAR            AYEHDITK-SKQLTEESYANRPLSVKFKESLAKLVSPIL
A0A0H3JVZ5_STAAW      AYEHDITK-SKQLTKESYANRPLSVKFKESLAKLVSPIL
C4L225_EXISA          AFERDEAR-AERLTLERYESRTRWIRFKESVSRLLSPIL
K0ACB4_EXIAB          LFLSDVAD-SALLTWEKYAARPRMIRFKESISRLLSPIL
D5DYP7_BACMQ          LFLEDVQC-SSKLTLERYKERSLLIKFKEAVSRLLSPIL
F9VD31_LACGL          DFKKDLEV-SKRLTMEIYEERSTSIRFKEGLARLISPML
D2BQ69_LACLK          DFMKDLKL-SRPLTLERYEERSKLVRFKEGLARLIAPML
A0A2Z5Y2W0_9ENTE      AFFEDVKV-SELLTIEKYQQRGKIIKLKEGLARLISPLL
C8WXS3_ALIAD          LFERDLEK-CDRLTLEQYRSRPRAERIMESCARLLSPIL
E4SJR8_LACAR          VFEEDMKK-SHLLTPEEIKKQGRLLRTLQSFSRMLSPIL
A8YWN2_LACH4          VFEADMKK-SHLLTREEIKKQGRILRTLQSFSRMLSPIL
Q1G7R6_LACDA          QFEKDMEQ-STLLTPEMIKKQSRWLRSLQNFSRLLSPIL
Q74LT8_LACJO          IFEKDLAK-CTELTLEITDNWSRYLRFKQAFSRLLSPIL
A0A087QBG6_LACGS      IFKKDLAN-CTELTLDITNNWSRYLRFKQAFSRLLSPIL
G4L828_TETHN          IFEEDMKH-STLLTQEMIKQQSYWLKFKQNFSRLLSPIL
Q834N6_ENTFA          VFEEDIEK-SVLLTDEIIKKQGYWLRFKQNFSRLLSPVL
A0A0C9NY80_LACPA      IFEADMAR-SYLLTPELIAKQSSWLRFKQDFSRLLSPIL
Q03D64_PEDPA          IYEEDIKH-SSLQTVAMFNKQSTWLKFKQTFSRLLSPIL
A0A4R5NTZ5_LACBU      IFLNDIDV-SELQTPEKFEQQSLWLKFKQTFSRLLSPIL
F8DR80_LACRS          IFVNDIRN-CRVITPAMFAEQPRWLKFKQTVSRLLSPIL
F8DQG8_LACRS          DFENDMKK-SMLLTPEYFANQSKWRKFKQYFSRLLSPIL
A0A0N7CKV9_LACFE      AFENDLKD-CTQLNEEYFDQQSAWRKFKQDFCRLLAPIL
F0TFK7_LACAM          IFEKDLEK-CTLLTNEYFAKQSSWLKFKQYFSRLLSPIF
G2SPV9_LACRR          IFDEDTKK-CTKLTEEYFLNQSAWRRFKQYFSRLLSPIL
D5T540_LEUKI          LFEKDIDS-STRLTIEDFEKQSFWLTFLQKFSRLFSPIL
B1MZZ2_LEUCK          LFEQDVSQ-STQLTTVDYEEQSIWMTILQKFSRLFSPIL
Q03YM9_LEUMM          LFEQDVLK-STKLTMEYFEKQSAWMKFKQKFSRLFSPIL
G8PCK9_PEDCP          TINRDIKN-SQKISPEYFNAQSVYTRFKQLASRLLSPLL
Q38XB9_LACSS          TFQRDLKA-SVPLTKQQLNAQTTNQRLSQDLARLLAPIL
K8QPY8_LACRH          LFLADMER-AMPYTQKVIKAKKRPARLAEELSRLLAPIL
Q2FM09_METHJ          YFLADLNV-CSELTAERFANMPKKIKLKLSISRLFSPLL
I7KE57_METBM          AFEEDLVV-STEITLESYRARPRRVRMKESVSRLFSPLG
A2STU9_METLZ          LFLAELETNCTEITLEEYNQRSVYVRIKEGISRLFSPIL
F4C7E2_SPHS2          IFNEDLLNAEEID-AERWEHRAKWLKLLEKSARMISPLL
F0REG6_CELLC          TFYNDLLDAEQID-KEKWINRPWYIRLGDKIAKLLSPML
F0SEL0_PSESL          EFENDLKHSTQID-LYDWNKRNKARKLIERIFRLLSPFM
A3UAU3_CROAH          MFERDLEDTEELI-LEQWRDRALSEKLKESFNRLWAPLL
G7WDL9_DESOD          YYDLDLKDCNKVI-LEEFQHRSSIEKFKESSARLLSSLL
I4D6Z5_DESAJ          NFEQDLKESRSIN-LETFQTRPYYERLKESLARLFSPLL
I4D626_DESAJ          DFYQDLKDSKEII-LEDYKKRPLANKLKESSSRLFSPLL
L0F6D5_DESDL          EQQADLMDSIKVT-EEDIAQRTRQYSFQIALARLLSPFL
F8FPP2_PAEMK          DFIQDLKACREIK-LEGFEKRSRWQKGKEVLARLVSPLF
G7W0D8_PAETH          DFEEDLSNSSHID-LKVFRRRPRLQKTAEILARMLSPLL
Q18CT1_CLOD6          DFFEDLSYCEELN-LEVFKNRNIIQKIKESVARLFSPIL
A8MKY4_ALKOO          DFFEDLRVSKRVY-LEEYVKRPVLHKIAESVARIFSPIL
C8W5E6_DESAS          DFIADISCSRLVT-YEQFLNKPLWSKFKESGARILSPML
CLS_GEOSW             DFLEDLKEASPID-YETFQQRPLSIRVVESVSRLLSPLL
A0A150LT19_9BACI      DFLEDLKYSSQIN-NEIFRRRPLSIRVMESVSRLLSPLL
CLS_GEOKA             DFLEDFRHASMID-YEQFQQRPFRVRIAESVSRLLSPLL
B7GLL6_ANOFW          DFINDFEHSSKMD-INQFKRRPLWMRMTESTARLLSPLL
CLS_ALKPO             DYVYDLEHSNQIN-FSLFKNRPFFHRLIESTSRLLSPLL
CLS_BACHD             DFVYDLEHTNQIR-FEQFRNRAWYYRVLESTCRLLSPLL
D5DAK4_BACMD          EYMQDLEETSELH-FKDFEKRPFIQRLFESTARLLSPLL
CLS2_BACAN            DFKDDLEESSEIH-VDRFHKRRLHRRIVESTYRLLSPLL
A0A6L5LQC1_BACTU      DFKDDLEESSEIH-VDRFHKRRLHRRIVESTYRLLSPLL
CLS2_BACCR            DFKDDLEESSEIH-GDHFHKRRLHRRIVESTYRLLSPLL
D3EML0_GEOS4          DFEHDLESAIVYD-RHHTRKKRIMTRLLESAARLMSPLL
E0RIJ1_PAEP6          DYERDLHSARLIV-REEFMKKRLFKRLMESLARLLSPLL
C4L577_EXISA          DLYDDFEGSHELV-LEEFAKRSFFIKLVESLARMFSPLL
K0AE21_EXIAB          DFYEDFSNSTQVE-RNVFMRRSFRQRLIESISRLFSPLL
CLS1_BACSU            HFEEDMQESEKLS-PVGFYKRGVADRTKESFARLFSGVL
I0JTA9_HALH3          NYKHDMENSHKVD-AEAFQNRGIWVRTKESFARLFSPAL
CLS1_BACAN            DFEDDFKHSTEIK-WNAFQKRSIKKRILESFMRLISPLL
A0R9Q9_BACAH          DFEDDFKHSTEIK-WNAFQKRSIKKRILESFMRLISPLL
CLS1_BACCR            DFEEDFKHSTEIK-WNSFQKRSIKKRILESFMRLISPLL
B7IX03_BACC2          DFEKDFKHSTEIK-WNSFQKRSIKKRILESFMRLISPLL
A9VEQ6_BACMK          DFEEDFKHSTEIK-WNSFQKRSIKKRILESFMRLISPLL
B1YEW0_EXIS2          DFIDDFDVSIQLS-SADYVKRPMRFRIFESFSRLISPLL
A0A0B8RBT6_LISMN      DFEKDFEDSRLFT-MKDMENKPLLTRIKEVLSSLLSPIL
A0A0E0URT5_LISMM      DFEKDFEDSRLFT-MKDMENKPLLTRIKEVLSSLLSPIL
A0AEJ4_LISW6          DFKKDFEDSRLFT-MKDMENKPLLTRVKEVLSSLLSPIL
E6XF61_CELAD          DFLNDAHISKSLS-YTEFINRPWSDKLKEGFGKLFSALL
G2PJ59_MURRD          DFLKDCEKSIVLTDYEKYKKRPWIKKLAQGFAKLLSPLL
G0L287_ZOBGA          DFLNDCKISQEIN-YKEFTRRPKSERFKEGLAKVFSPVL
E1WLD8_BACF6          IFLQDQ-RESTQIFLKSWEKRSSRQKAMESVVRLLAPLL
Q64YC9_BACFR          IFLQDQ-RESTQIFLKSWEKRSSRQKAMESVVRLLAPLL
E6STH3_BACT6          IFLQDQ-RDCVQVFLKNWVKRPWHQKAAESVVRLMAPLL
F2KVH0_PREDF          IFLDDQGKSVALEDVRNLTHRSFLQRLWESLVRLLSPLL
A6LEV6_PARD8          IFTHDM-HHCERLIPSRWLKRPLKQRMAESFMRLFSPLL
F4KNV2_PORAD          AFEEDL-KACRQLTLEEWSGRSFWIRTLEALARLFSPLL
G0EI26_BRAIP          IFKKDMLDSHKIT-IEEYSKQPMLVRLRNSACRIIAPVL
C7N8V3_LEPBD          QFIEDLGVCEKFD-EVRLKKVTFRKRLRNSIFKLISPIM
D1AL33_SEBTE          QFFEDLKYCTEIK-NEDLDRKGFLLRLRDSVFRVLSPIL
C0QIT7_DESAH          MFHQDLEFCREFT-RADYDKISRPSQLRNSLARLFAPLL
A5N6C2_CLOK5          LFFEDIRNSKRIT-QEYFDNLSPFIKFFEAFCRIFSSLL
C1FU71_CLOBJ          IFFQDLKRSKRIY-KEDFKNRSLRGRMLEGVARIFSALL
D9SSA2_CLOC7          DFLDDLRYCKRIT-SDYYENMSNLKKLKQAFARIFSSLL
Q8R663_FUSNN          QYYKDITISKKLT-FADFKKRSIFTKVKESVFRLLSPIM
F4LIP6_TREBD          IFLDDIKN-AAEASKGTFDNHFILKRAWRGFCKLFSPLM
                          :                            : :