CLUSTAL format seed alignment for MF_01917

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLSB_ECOLI            ---------------------------MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQE
CLSB_ECO57            ---------------------------MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQE
CLSB_ECOL6            ---------------------------MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQE
Q1RED8_ECOUT          ---------------------------MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQE
A0A0E1T9D5_ECOLX      ---------------------------MKCSWREGNKIELLENGEQYYPAVFKAIGEAQE
CLSB_SHIFL            ---------------------------MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQE
A0A0H3BQ10_SALNS      ---------------------------MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQ
CLSB_SALTY            ---------------------------MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQ
CLSB_SALTI            ---------------------------MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQ
A0A0H2WQ67_SALPA      ---------------------------MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQ
A4W8D1_ENT38          ---------------------------MKSSWREGNRITLLENGDEYYPAVYAALDKAQH
A0A0H3FT99_KLEAK      ---------------------------MKCRWQEGNRITLLENGDQYYPALFAAIGRAQR
B5XYV8_KLEP3          ---------------------------MKCRWQEGNRITLLENGDQYYPALFAAIGRASR
A0A0H3KY94_PANAA      ---------------------------MNFDWQNGNKLRLLENGDTFFPRVFGAIQRAER
C6C907_DICP7          ---------------------------MKTEWRDGNQIALLVNGDNFYPSAFEAIRQAHS
C6CLB0_DICC1          ---------------------------MKAEWRDGNQIELLVNGDEYYPSVFDAIRQARS
F6AI10_PSEF1          ---------------------------MKYEWRDGNQIDLLINGEDFFPAVFESIRNARQ
Q4ZRB3_PSEU2          ------------------------MSNTTGQWRDGNSVELLINGEDFYARVFECIRAARK
Q9I1W0_PSEAE          ---------------------------MNFPWRDGNRVELLINGEEYFPRLFQCIAEARR
A5W3C1_PSEP1          ---------------------------MNRPWVDGNGVQLLINGEQYYPRVFEAMAQARE
Q1I929_PSEE4          ---------------------------MKQAWSEGNHVELLINGEQYYPRVFEAMARARQ
Q4K7F6_PSEF5          ---------------------------MSGAWRDGNRVELLINGEQFYPRVLAAIADARH
A4VLG4_PSEU5          ---------------------------MSYHWRDGNRLQLLENGEEFFPRVFEVIAQAKK
Q7VYJ5_BORPE          ---------------------------MSTPWRDGNRFAILENGASYFPRVYTAIGKARE
A1WC60_ACISJ          ------------------MRPRPS-----SRWIPGNHFRLLENGEEFFPRVFEAIAQAQR
C5D1W9_VARPS          ------------------MKNSPTRGLARARWVPGNRVSLLENGEEFFPRVFEAVRRAQR
Q12HK0_POLSJ          ----------------------------MSPWISGNQFRLLENGEEYFPRVFACIAAAER
I0HL35_RUBGI          ------------------MKRRPR-------WQDGNAVELLENGEAFFPAVFDAIRNARH
E6WW36_PSEUU          ---------------------------MKLRWHKGNSVRLLENGEGFYPRVFEAIEAARS
Q46SC5_CUPPJ          ---------------------------MDHGWTTGNRFRLLENGEEYFPRLIAALNAAHT
C5BUD5_TERTT          -------------------MKPKKHRESTIEFESGNKVVLLNNGDEFVPDLVEEITRASK
K0MBP5_BORPB          ----------------------MKGQIVRLHWTDGNAIRLLQNGGDFFPALCEAIDAARL
Q2L1K1_BORA1          ------------------------VRVGRLSWTDGNTIRLLQTGAEFFPALCAAIDQAKQ
F6G5B5_RALS8          -------------MRVARDAGPLRSEWRRGKPLPGNRIDLLQGGAAFFPALIGAIDAARR
Q5P2K2_AROAE          ----------------------------MTEFLPGNAITLLENGGDFFPALQEAIDGARK
Q479I4_DECAR          ---------------------------MAAEFLPGNRLTLLNSGADYFPALLAAISQAQI
Q1GYP3_METFK          -----------------------------MRWESGNRITLLRNGTEFFPALAASIEAAQH
C6XAE2_METGS          ---------------------------MRPRYSRGNDIRLLRNGTEYFPALLQALDSARY
D7DJW2_METV0          ----------------------------MTYFIDGNQIQLLRSGTEYFPALLAAIENSTR
D5CQ53_SIDLE          --------------------------MNRTHLISGAELMLLQNGAEFFPQLCTEIDAARH
Q39D22_BURL3          ----MTAEARKRFAQLRQMFLQERGSASRLAFTSGNTVRLCEGGGAFFRALIERIDAARE
A0A0H2XSI7_BURCA      ----MNAETRKRFAQLRQMFLQERGSASRLAFTAGNTVRLCETGGEFFHALIERIDAARE
A0A0H3KHH8_BURM1      ----MNAETRKRFAQLRQMFLQERGSASRLAFTTGNTVRLCEGGGEFFRALIDRIDAARE
C4ASY6_BURML          ----MSGETRHRLAQLRQMFLQERGSASRLAFTSGNEVRLCDGGAAFFPALIERIDAARE
B2JCV7_PARP8          ----MTGGGRRRFDRLTQHLPGRR-YWSRYRFCSGNTVRLFTAGEPYFAALTQRIDAAQR
A1VKQ0_POLNA          MLCWQKAGGRFQWPDAFRALSITPVDSLMPSFNKPETLQLLQGGQALFPALVQAFDAADR
C1D8A3_LARHH          ----------------------------MRHFVAGNRVTLLTTGAEFFPALLADIQTARQ
I0HN53_RUBGI          -----------MPVPLDDPSAWAWSGVPRPHFVGGNDVRLLQGGDELFPRMVAAIEAARH
                                                           . :   *          .  :  

CLSB_ECOLI            RIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
CLSB_ECO57            RIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
CLSB_ECOL6            RIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
Q1RED8_ECOUT          RIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
A0A0E1T9D5_ECOLX      RIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
CLSB_SHIFL            RIILETFIWFEDNVGKQLHAALLAAAQRGVKAEVLLDGYGSPD-LSDEFVNELTAAGVVF
A0A0H3BQ10_SALNS      KIILETFILFEDEVGKKLHAALLKAAQRGVKAEVLLDGYGSPD-LSDAFVGELTSAGVIF
CLSB_SALTY            KIILETFILFEDEVGKKLHTALLKAAQRGVKAEVLLDGYGSPD-LSDAFVGELTSAGVIF
CLSB_SALTI            KIILETFILFEDEVGKKLHAALLKAAQRGVKAEVLLDGYGSPD-LSDAFVGELTSAGVIF
A0A0H2WQ67_SALPA      KIILETFILFEDEVGKKLHAALLKAAQRGVKAEVLLDGYGSPD-LSDAFVGELTSAGVIF
A4W8D1_ENT38          RVILETFIWFEDGVGRQLHEAILRAAQRGVKVEVLLDGYGSPD-LSDAFVNELTSAGVVF
A0A0H3FT99_KLEAK      KVILESFIWFEDEVGWRLHAVLLKAARRGIQVEVLLDGYGSPD-LSDEFVGELTAAGVVF
B5XYV8_KLEP3          RVILESFIWFEDEVGWRLHAVLLKAARRGIQVEVLLDGYGSPD-LSDEFVGELTAAGVIF
A0A0H3KY94_PANAA      SVLLETFILFEDDVGNALHRELLAAAQRGVKVEMMVDGYGSSE-LSDDFVNSLTQAGVRF
C6C907_DICP7          RVVLETFILFEDEVGWGLHAALLAAAQRGVSIDVTADGYGSHD-LTTEFLRPLIKAGVRF
C6CLB0_DICC1          RVVLETFIWFEDKVGYALREVLIAAARRGVSVDATADGYGSHD-LSPDFLAPMIEAGVRF
F6AI10_PSEF1          QVLLETFIIFEDKIGMELQQALIAAARNGAEVEITVDGYGTAD-LSTEYVAALVAAGVRV
Q4ZRB3_PSEU2          EVLIETFIIFEDRIGESLQQALLEAAANGAKVVVTVDDYGTSD-LSSTFVKTMIDAGIQI
Q9I1W0_PSEAE          EILLETFIIFEDEVGRQLQEALSAAAERGVEVQVTVDGYGTAS-LSPDYLARLTASGVRV
A5W3C1_PSEP1          EILLETFIIFDDKVGKQLQQVLIEAARRGVRVEVAADGYGTAE-LPAEFISAMTDAGVSF
Q1I929_PSEE4          EILLETFIIYDDKVGQGLRQALIDAARRGVRVEVAVDGYGTAD-LPDTFIASMTEAGVRF
Q4K7F6_PSEF5          EVLLETFILFEDKVGCALQQALIDAARRIPRVEITVDGYGSAD-LSADFVAHMVDAGVQV
A4VLG4_PSEU5          EVLLETFILFQDKVGNELQKALIAAAENGASVDVTVDGYGSAD-LHGEFVTAMTRVGVRI
Q7VYJ5_BORPE          EILIETFILFDDAVGRELREALMAAARRGVRIDVTVDGYGSDS-LPPDFIAGLVELGVGF
A1WC60_ACISJ          EVMVETFILFDDHIGQGLHAALLQAARRGVSVNLLVDGFGSPD-LPDHFVDSLVQAGVRF
C5D1W9_VARPS          EVLIETFILYEDKVGTQLHACLCEAARRGVRVDLLVDGFGSPD-LSEAFIQEMAAAGVRL
Q12HK0_POLSJ          EVVLETFILFDDKVGQALHAALLQAATRGVQIDITVDGYGSPD-LSHEFISALTQAGVRV
I0HL35_RUBGI          EVLLETFILFEDKVGLALHAALLEAAQRGVQVDVMVDGFGSPD-LSPEFTGSLRAAGVRL
E6WW36_PSEUU          EILLETFILFEDEVGRELQQRLVAAARRGVRVSMLVDGYGTPP-FSDGFLAPMAEAGIEV
Q46SC5_CUPPJ          SVLLETFILAEDDVGCRLAEALAAAARRGVQVALTVDGFGSAD-LSADYMVRLTQAGVAV
C5BUD5_TERTT          EVLIETYEFAEDDVGKSVFEACKKAVANGAEVKLTIDAYGSSDFCSENFIFEFVKAGIKI
K0MBP5_BORPB          SVHLETYIFLLDRTGRQVLECLESAARRGVKVRVVLDGFGSAG-TAEAIRLRITQAGGQC
Q2L1K1_BORA1          SVHLETYIFVLDRTGERVLDCLERAARRGVRVRLVLDGFGSAS-EIPDIARRIQEAGGLC
F6G5B5_RALS8          RIALETYLYIDDDTGRRVTEALARAARRGVDVRVTVDGFGTGT-LPAGIAAMLDAAGAAW
Q5P2K2_AROAE          EIFLETYIFENDATGSLIATALRRAAMRGVAVRLLVDGFGGRQ-FVRTLMPELIPDGVGV
Q479I4_DECAR          EIYLESYIFANDEIGHEVAGALCLAAERGVQVNLTVDGYGAHN-FAADFLPRLTAAGVRA
Q1GYP3_METFK          EIHLQTYIYELDATGAMIGEKLKAAAARGVAVHLLLDGFGSRK-LPPEYVLEMEAFGVKV
C6XAE2_METGS          EIFLETYIYEMDDIGQQVTASLMHAAARGVQVHLLLDGYGSRS-FPENTREQLEQAGVQV
D7DJW2_METV0          EIYLQSYIYKDDVTGVKIGDALKNAARRGVSVNILLDGFGSKD-LSKSYVEELEQTGVQV
D5CQ53_SIDLE          SIYLESYIFASDETGNMVAEALQRAAERGVVVRVLLDGFGSAE-LSGEFVDALRMVGVEV
Q39D22_BURL3          QVMLETYIFCDDAAGRPVSDALIRAAQRGVRVRVITDGIGTAR-LPL--FDTWVAAGVEH
A0A0H2XSI7_BURCA      QVMLETYIFCDDAAGRPVSDALIRAAQRGVRVRVITDGIGTAR-LPL--FDTWGEAGVEH
A0A0H3KHH8_BURM1      QVMLETYIFCDDAAGRPVSDALIRAALRGVRVRVITDGVGTAR-LPL--FDAWTEAGIEH
C4ASY6_BURML          RVALETYIFCDDAVGRAVSDALVRAAARGVHVRVITDGIGTER-LPL--FGTWPDAGVEH
B2JCV7_PARP8          EVALETYIFCDDPAGRPVSDALIRAASRGVHVRVITDGVGTQR-LPM--FNDWQAAGIEH
A1VKQ0_POLNA          WIQLETYIFDVHGAGADVADALVRAARRGVTVQVLVDAVGTGL-LPAEWREKFSAAGVRW
C1D8A3_LARHH          EILLETYIFRIDVSTEPIVLALIAAAERGVSVRILVDGFGSRD-FPADWIERLRAAGVDF
I0HN53_RUBGI          EVWLATYIFHSDDAARAVAAALSAAAGRGVEVNVVVDGFGSLQ-TMATLREWLRPSGVRL
                       : : ::    .     :      *. .        *  *                *   

CLSB_ECOLI            RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE----AKQ
CLSB_ECO57            RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE----AKQ
CLSB_ECOL6            RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE----AKQ
Q1RED8_ECOUT          RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE----AKQ
A0A0E1T9D5_ECOLX      RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE----AKQ
CLSB_SHIFL            RYYDPRPRLFG---MRTNVFRRMHRKIVVIDARIAFIGGLNYSSEHMSSYGPE----AKQ
A0A0H3BQ10_SALNS      RYYDPRPRLLG---LRTNIFRRMHRKIVVIDDRIAFVGGINYSAEHMSDYGPQ----AKQ
CLSB_SALTY            RYYDPRPRLLG---LRTNIFRRMHRKIVVIDDRIAFVGGINYSAEHMSDYGPQ----AKQ
CLSB_SALTI            RYYDPRPRLLG---LRTNIFRRMHRKIVVIDDRIAFVGGINYSAEHMSDYGPQ----AKQ
A0A0H2WQ67_SALPA      RYYDPRPRLLG---LRTNIFRRMHRKIVVIDDRIAFVGGINYSAEHMSDYGPQ----AKQ
A4W8D1_ENT38          RYYDPRPPLLG---MRTNVFRRMHRKIVVVDDTVAFVGGINYSDEHMSDYGPE----AKQ
A0A0H3FT99_KLEAK      RYYDPRPRLMG---MRTNLFRRMHRKIVVIDDTTAFVGGINYSAEHMSDYGPE----AKQ
B5XYV8_KLEP3          RYYDPRPKLMG---MRTNLFRRMHRKIVVIDDTTAFVGGINYSAEHMSDYGPE----AKQ
A0A0H3KY94_PANAA      IYYDPRPLVMG---MRTNVFRRLHRKTVVVDGVIAFVGGINFSAEHYTDYGPE----AKQ
C6C907_DICP7          HFYDPRPRLLG---MRTNLFRRLHRKILVVDGDTAWIGGINYSADHLLSYGNT----AKQ
C6CLB0_DICC1          HFYDPRRRLFGL--MRTNLFRRLHRKIVVVDGHTAWIGGINYSADHLSDYGPE----AKQ
F6AI10_PSEF1          HMFDPGKRLLG---MRTNLFRRLHRKIVVVDNEVAYIGGINYGEDHIADYGPM----AKQ
Q4ZRB3_PSEU2          QLFDPRPRFMG---MRTNLFRRLHRKVVVIDGELGFIGGINYSVDHMTDTGLT----AKQ
Q9I1W0_PSEAE          HLFDPRPRLLG---MRTNLFRRLHRKLVVIDRRQAFVGGINYGEDHLVRRGNM----AKQ
A5W3C1_PSEP1          HAFDPQPRLLG---MRTNLFRRLHRKIVVVDGERAFIGGINYSADHLGDFGAM----AKQ
Q1I929_PSEE4          HAFDPQPRLAG---MRTNLFRRLHRKILVIDGQRAFIGGLNYSADHLADFGPQ----AKQ
Q4K7F6_PSEF5          HVFDPHPRVFG---LRAHLFRRLHRKMLVIDGERAFIGGLNFSADHLRDFGPM----AKQ
A4VLG4_PSEU5          HMFDPGKRLLG---RRLNVFRRMHRKIVVVDGEVAFIGGINFSADHLGDFGPA----AKQ
Q7VYJ5_BORPE          HVFDPRPRLLG---MRTNLFRRLHRKIVAIDGTLAYVGGLNFSADHLDDYGPQ----SKQ
A1WC60_ACISJ          RVFDPGRRLFG---QRLNLLRRMHRKIVVVDGTLGFIGGINYSADHVADFGPQ----AKQ
C5D1W9_VARPS          RVFDPGHSILG---QRLNLLRRMHRKIVVVDDACAFVGGINFSADQLLDFGAT----AKQ
Q12HK0_POLSJ          HVFDPGPRLWG---WRTNLFRRMHRKIVVIDGQRAFVGGLNYSADHLADFGPA----AKQ
I0HL35_RUBGI          RSFDPSWRLFG---KRFNVLRRMHRKIVVVDGETAFVGGINYSADHLADYGPE----AKQ
E6WW36_PSEUU          RSFDPGAQPMG---IRLKLFRRMHRKLLVIDGATAFVGGINYSADHLLRSGPE----AKQ
Q46SC5_CUPPJ          RMFSPGRRLLG---KRANLFRRLHRKLVAIDASVAFVGGINLCVDHLVQASPI----AKQ
C5BUD5_TERTT          YLYEPKHRLPF----NAQAYGRLHRKLAVIDNKIAYVGGVNLTEKYTLQFGEA----GMR
K0MBP5_BORPB          RIFRPEPRWLGHLAFSRSRLRRLHRKVAVVDAELAFVGGINIVDDYDDLDPGDDIPAPRF
Q2L1K1_BORA1          RIYRPEPRF--RLAFSRSRLRRLHRKVAVVDDDSAFVGGINIVDDYDDLDPTDDLSGPRF
F6G5B5_RALS8          RVYRPVRGF----RLQRSNLRRLHRKVAVIDDEVAFVGGINIIDDLNHAPFRDGALGARY
Q5P2K2_AROAE          MIYRRELRMLALRR---HRLRRMHRKLAVIDGAVAFVGGINIVDDLQGGLFER----PRF
Q479I4_DECAR          LFYRPEIGRFHLKR---HRLRRLHRKLAVIDARIAFVGGINILSDDSGPPELR----PHY
Q1GYP3_METFK          MFYRPKISPWSFKR---NRLRRLHRKVSVFDGQHAYVGGINIIDDMNVPSNLD---APRV
C6XAE2_METGS          LFYRPRISPWTFKR---NRLRRLHRKLVTVDAQVAFVGGINIIDDMDVPGNM----GPRI
D7DJW2_METV0          MFYRPKISPWSLKK---RRLRRLHQKIAVIDGHIGFVGGINIIDDYDVPNNAPNNVPPRV
D5CQ53_SIDLE          QLFRPEVSPFTLRRSRMRRLRRMHRKLAVMDGAVAFVGGINIICDIPARLGFD---APRL
Q39D22_BURL3          CIYNRF-------LFGRFGFSRTHRKLAVIDHAVAFCGGINIIDD-YAQNGTT-LPFPRW
A0A0H2XSI7_BURCA      CIYNRF-------LFGRFGFSRTHRKLAVIDQTTAFCGGINIVDD-YTQGSAT-LPFPRW
A0A0H3KHH8_BURM1      CIYNRY-------LFGRFGFSRTHRKLAVIDRSAAFCGGINIVDD-YEQNGAP-LQYPRW
C4ASY6_BURML          RIYNPY-------LFGRFGFSRTHRKLAVIDDACAFCGGINIVDD-FEQNGER-LPHPRW
B2JCV7_PARP8          RIYNPH-------IFGRFGFSRTHRKLAVVDGEFAYCGGINVVDD-YDQNGAR-LPYARW
A1VKQ0_POLNA          CAYSPVGSG--LGFLVPERWRRLHRKLCVVDEQIVFCGGINVLDDFYDPNHGE-LQAPRF
C1D8A3_LARHH          RFFRLARHWIIPRR---NRLRRLHRKLAVIDGRQAYAGGINLHDDCDNALPGY---APRY
I0HN53_RUBGI          EVFRPLDRWWAWLQ--PGQMRRLHTKLCVVDSESAYVGGINVIDDRHDLHHGW-SDAPRL
                        :                  * * *  ..*    : **:*   .               

CLSB_ECOLI            DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
CLSB_ECO57            DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
CLSB_ECOL6            DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
Q1RED8_ECOUT          DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
A0A0E1T9D5_ECOLX      DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
CLSB_SHIFL            DYAVRLEGPIVEDILQFELENLPGQSAAR----RWWRRH-HKAEENR-------------
A0A0H3BQ10_SALNS      DYAVRVEGPVVADILQFEVENLPGQSPAR----RWWKRH-HQAEENR-------------
CLSB_SALTY            DYAVRVEGPVVADILQFEVENLPGQSPAR----RWWKRH-HQAEENR-------------
CLSB_SALTI            DYAVRVEGPVVADILQFEVENLPGQSPAR----RWWKRH-HQAEENR-------------
A0A0H2WQ67_SALPA      DYAVRVEGPVVADILQFEVENLPGQSPAR----RWWKRH-HQAEENR-------------
A4W8D1_ENT38          DYAIRVEGPVVLDILQFELENLPGESVTR----RWWKRR-HRPEENR-------------
A0A0H3FT99_KLEAK      DYAVQVEGPVVLDILQFELENLPTSEAAR----RWWRRRRHQPEINQ-------------
B5XYV8_KLEP3          DYAVQVEGPVVLDILQFELENLPNSETAR----RWWRRRRHQPEINQ-------------
A0A0H3KY94_PANAA      DYTVEVKGPVVADIIRYLQEAIGSQATTR----RWWGQRSHRPAKNA-------------
C6C907_DICP7          DYAVKVRGPVVDDIYRYVLAALASDEEPR----RWWHPRFHRPALP--------------
C6CLB0_DICC1          DYAVKVRGPVVDDIYRFVLAALAHDEEPR----IWWRRRFRRPARNL-------------
F6AI10_PSEF1          DYAVRVRGPIVADLHTAAVRLLDARDDR-----PATPHRGSQPGQHR-------------
Q4ZRB3_PSEU2          DYAVLVRGPIVGDIHHSALNMLSKVVRD-----KLPPI----ALKLD-------------
Q9I1W0_PSEAE          DYAVRVEGPVVRDIRQACLALLEPDADY-----PPLRP-------SG-------------
A5W3C1_PSEP1          DYAVEVTGPVVAQVHAASKRLMSPVLQP-----PSAVR-----PVTE-------------
Q1I929_PSEE4          DYAVEVVGPVVAQMHACSCRLLAAVLDA-----ASRVP-----PPPI-------------
Q4K7F6_PSEF5          DYAVDVRGPVVADIRDAALGTLAQVTPV-----GPSS------PATP-------------
A4VLG4_PSEU5          DYALQVEGPVVRDIHHFALSQIAPNKPPQHRWWRRRVRQQTPGYGGI-------------
Q7VYJ5_BORPE          DYAIEIAGPLAADIRDFARAALAAVPRRR-------WRRARPAAPPQ-------------
A1WC60_ACISJ          DYAVEVHGPIVAHMHRFTRTAVLPPSV-----QRTHRHEPLPQLPA--------------
C5D1W9_VARPS          DYAVELNGPIVQLIHRFAARAVAADKKKAKQGARSHRPAPPERQQEGSGHATGHAR----
Q12HK0_POLSJ          DYAVEIEGPIVTFIHAFVHRALAAGQRNAQDSLAGRLRERLSSRAHSLARSWGLAPPSQA
I0HL35_RUBGI          DYSVRLRGPVVETIRQFAIGAIRGGTRGEPPVQRPRLPPPRA------------------
E6WW36_PSEUU          DYAVEVRGPVVGDIHRFVLDQGVGDAQGD------------ATAASD-------------
Q46SC5_CUPPJ          DYAVEVQGPAAEAIHRFMLEAIGAGAKWPQ-AMRWRRPAARGNAAFD-------------
C5BUD5_TERTT          DFMLRIEGPATDQVRTHCLENIPDDESYK-------DEATLKPATAR-------------
K0MBP5_BORPB          DFAVAVQGPLVPHILYAQDLLWVRLNWARLRRHPGDWHRMRLFKPVHADASPA-------
Q2L1K1_BORA1          DFAVRVEGPLVQQIRAMQDLLWLRLNLSSLRRHPEALRQLRLRRP--RYAPTG-------
F6G5B5_RALS8          DFAVHVRGPLVSQIALAADRLWWQMGLRTGMREVGVSGVAAEFPVMTDTPKPGRRGASGA
Q5P2K2_AROAE          DYAVRVEGPLLGPMLESMHRLWRLVSWARLGRRLHDPLLVLAKTAPAG------------
Q479I4_DECAR          DYAVRIEGPTLDQIHHAVRRMWEIVSWASFKRRFRLSPVTRACSEIAG------------
Q1GYP3_METFK          DYAVRVDGPLVLSIHASVRNLWRRLAWMHLREVSAYP-NLPAPPFITN------------
C6XAE2_METGS          DYAVRVQGPLLPEIQLRVERLWRRIAWMHLQVRYASTVDADTRPGITG------------
D7DJW2_METV0          DYAVRIEGKLLPVILANVQKLWRRIAWIHMRRANLVIAKTVKLMNLTDSQ----------
D5CQ53_SIDLE          DYAVRVKGELAGEIQAVMQRLWEMVSWAAFRKRVREEGWRRYRVRSHP------------
Q39D22_BURL3          DFAVEMAGPAVSDVRAAFELQWHRIMFGHKP-YAQYAAGLHGGEAFPDMFRRWMRSHRWI
A0A0H2XSI7_BURCA      DFAVEMAGPAVSDVRAAFELQWHRIQFGHKP-YAQYAAGLHGGEAFPDMFRRWMRSHRWI
A0A0H3KHH8_BURM1      DFALELAGPAVADVRAAFELQWHRIQFGHKP-YAQYAAGLHGGEPFPEMFRRWIRSHRWI
C4ASY6_BURML          DFAVELAGPAVADVRAAFEVQWHRIAAGHKR-YAQYLPHDVDGPAFAARFRRWMRSHRWV
B2JCV7_PARP8          DFAVELQGPVVADVLEAIDVQWERIRIGHRPALAPPAVGGSTPQAATARFVRARSSAGTA
A1VKQ0_POLNA          DFAVAVTGPLAAEAAEAMALLWWRVQAGYSA--RQRHLNEAWEKFKAAGYGGRTDASLLA
C1D8A3_LARHH          DYAVRVEGPLVDAVSLTMRKLWRQLAALHGDGWPVLAGPRSNPRPVGV------------
I0HN53_RUBGI          DYAVELRGPIARQVRDTARAMWARAHLGHFWGEELRALARSAAPVEQTVLLLRQLRTRPQ
                      *: : : *                                                    

CLSB_ECOLI            -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQARREVIIANAYFFPGYR
CLSB_ECO57            -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQARREVIIANAYFFPGYR
CLSB_ECOL6            -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQARREVIIANAYFFPGYR
Q1RED8_ECOUT          -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQARREVIIANAYFFPGYR
A0A0E1T9D5_ECOLX      -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQAQREVIIANAYFFPGYR
CLSB_SHIFL            -----------QPGEAQVLLVWRDNEE-HRDDIERHYLKMLTQAQREVIIANAYFFPGYR
A0A0H3BQ10_SALNS      -----------HPGEAQALFVWRDNEE-HRDDIERHYLKMLTQAKREVIIANAYFFPGYR
CLSB_SALTY            -----------HPGEAQALFVWRDNEE-HRDDIERHYLKMLTQAKREVIIANAYFFPGYR
CLSB_SALTI            -----------HPGEAQALFVWRDNEE-HRDDIERHYLKMLTQAKREVIIANAYFFPGYR
A0A0H2WQ67_SALPA      -----------HPGEAQALFVWRDNEE-HRDDIERHYLKMLTQAKREVIIANAYFFPGYR
A4W8D1_ENT38          -----------QPGEAQALFIWRDNDE-HRDDIERHYLKMLANAKREVIIANAYFFPGYR
A0A0H3FT99_KLEAK      -----------TPGEAQALFIWRDNHE-HRDDIERHYLKMLTSARREVIIANAYFFPGYR
B5XYV8_KLEP3          -----------TPGEAQALFIWRDNQD-HRDDIERHYLKMLTSARREVIIANAYFFPGYR
A0A0H3KY94_PANAA      -----------LPGDAQVLFVYRDNDE-HRDDIEQHYLDMLRSAKQDVIIANAYFFPGYR
C6C907_DICP7          -----------HPGNAQALFIWRDNRT-HRHDIEKHYLQMLRRAKHEVIIANAYFFPGYR
C6CLB0_DICC1          -----------HPGNAQALFVWRDNGL-HRRDIERQYLQMLRRAKREVIIANAYFFPGYR
F6AI10_PSEF1          -----------HAGNSRLLMTIRDNGD-DTNTIEQHYLDAIRNAQHRLIIANAYFFPGYR
Q4ZRB3_PSEU2          -----------RAGDASMLLAERDNDE-HSTDIEEQYLEAIRAAKQRITLANAYFYPSYR
Q9I1W0_PSEAE          -----------AGQPARVRLVIRDNDQ-SSDDIEREYLQAIRQARRRLLIANAYFFPGYR
A5W3C1_PSEP1          -----------PAGSSSAVLIERDNGM-RSTDIEAHYLQAFRKARQRIVVANAYFFPGYR
Q1I929_PSEE4          -----------AAGPASAMLVERDNRR-HRNDIEVCYLQVIREAKQRIVVANAYFFPGYR
Q4K7F6_PSEF5          -----------PCGPSSIRLAIRDNQR-HRDDIETQYLKAIRAARQRLVLANAYFFPGYR
A4VLG4_PSEU5          -----------SRGEARALFVVRDNDQ-HRNDIEEHYLQAIRDARSRLLIANAYFFPGYR
Q7VYJ5_BORPE          -----------AAGPARARLVVRDNDQ-HTNDIEQSYRVAIRAARRDIVIANAYFFPGYR
A1WC60_ACISJ          ------------AGSAHAMFVTRDNHR-HTNDIERHYRIALRAARERVVIANAYFFPGYR
C5D1W9_VARPS          ------------AGEAEVCLVTRDNWR-HTNDIERHYRVAIRSARQRVVIANAYFFPGYR
Q12HK0_POLSJ          AAA--------PAGEAAAIFVTRDNRE-HTNDIERHYRIAIRVARQRIVIANAYFFPGYR
I0HL35_RUBGI          ------------EGPVQAMLVTRDNLE-HRADIERQYRAALRAARHSVIIANAYFFPGWR
E6WW36_PSEUU          -----------AQGAAETAFIVRDNQR-HGTDIEQVYREAIRGAKRRIVIANAYFFPSHG
Q46SC5_CUPPJ          -----------ADLPGAALLVTRDNRA-HRSDIERHYLMAIRAARREIVIANAYFLPGYR
C5BUD5_TERTT          -------------GDAKLALTCRDNHVGRRRAIETCYLDAINEAKQSITLACAYFFPGLR
K0MBP5_BORPB          -------------GKLRAALLLRDNLR-FRQTFEQAYLYGIQHARRDILIANAYFFPGHQ
Q2L1K1_BORA1          -------------GGLRAALVLRDNLR-FRQTFERAYLHCIEQARHEVLIANAYFFPGRR
F6G5B5_RALS8          QHDHA-------PDNVLASLVLRDNVR-NRRAIEREYLRALGTARHEVIIANAYFLPGVR
Q5P2K2_AROAE          --------------TVRAAFVTRDNLR-RRRDIEDAYLEAIGSARTEVLIACAYFFPGRR
Q479I4_DECAR          --------------KQTAAFLIRDNIR-HRNDILNAYLDAIDNAQSEILIANAYFLPGVR
Q1GYP3_METFK          --------------GMRAAFVVRDNVL-HRRDIERAYLKAIGKARVDIIIASAYFVPGKK
C6XAE2_METGS          --------------NVRAAFVIRDNVL-HRRDIERMYLQAIGRARDDIIIANAYFLPGRR
D7DJW2_METV0          ------------QHNIKAALVLRDNVL-HRSDIEDAYLDAIGHAKSEIIIANAYFVPGRR
D5CQ53_SIDLE          --------------AAKVRLVLRDNVR-HRRDIERAYLNAIAGAQHEVIIANAYFLPGRL
Q39D22_BURL3          KAG-----ALRVVTEPSVAFVARDNVV-NRRAIEKAYLAAIGQARQRILLANPYFMPGRK
A0A0H2XSI7_BURCA      KAG-----ALRVVTEPSVAFVARDNVV-NRRAIEKAYLAAIGQARQRILLANPYFMPGRK
A0A0H3KHH8_BURM1      KAG-----ALRVVTEPSVAFVARDNVV-NRRTIEKAYLAAIGRARHQIRLANPYFMPGRK
C4ASY6_BURML          KAG-----ALRVVTEPSVAFVARDNIV-NRRAIEKAYLAAIGRARQSILLANPYFMPGRK
B2JCV7_PARP8          ASGRS--SDMRAIAEPCIAFVARDNFV-NRRAIERAYLTAIGQARSEVLLANPYFMPGRK
A1VKQ0_POLNA          QPGDSGLAALPGLSRPKAALVLRDNLR-NRHSIERAYRRAIGKARQEIIIANAYFLPGGK
C1D8A3_LARHH          ---------------MAARLVVRDNLR-HRLSIENEYLRQCHLARHEILIANAYFLPGIR
I0HN53_RUBGI          PVPGD-----DGGEPVRAAFVVRDNLR-QRRAIERSYVEAIRGARERVDIAVPYFYPGQT
                                         :  ***       :   *      *:  : :* .** *.  

CLSB_ECOLI            FLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVAL
CLSB_ECO57            FLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVAL
CLSB_ECOL6            FLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVAL
Q1RED8_ECOUT          FLHALRKAARRGVRIKLIIQGEPDMPIVRVGAHLLYNYLVKGGVQVFEYRRRPLHGKVAL
A0A0E1T9D5_ECOLX      FLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVAL
CLSB_SHIFL            FLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVAL
A0A0H3BQ10_SALNS      LLHAMRKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVAL
CLSB_SALTY            LLHAMRKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVAL
CLSB_SALTI            LLHAMRKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVAL
A0A0H2WQ67_SALPA      LLHAMRKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVAL
A4W8D1_ENT38          LLHAMRNAARRGVRVKLIVQGEPDMPIVTVGARLLYDYLVKGGVQIYEYRSRPLHGKVAL
A0A0H3FT99_KLEAK      LLHAMRNAARRGVRVKLIVQGEPDIPIVKFGAHLLYHYLIKGGVQVYEYRRRPLHGKVAL
B5XYV8_KLEP3          LLHAMRNAARRGVRVKLIVQGEPDIPIVKFGAHLLYHYLVKGGVQIYEYRRRPLHGKVAL
A0A0H3KY94_PANAA      LLREMRNAAQRGVRVRLIVQGEPDMPIVKVGAELLYNYLVDAGVEVYEYCRRPLHGKVAV
C6C907_DICP7          LLRAMRNAVRRNVQVRLIIQGQPDIPIVLFGARLLYRYLVDAGVEVYEYRQRPLHGKVAL
C6CLB0_DICC1          LLRAMRKAARRDVRVRLIIQGQPDMPIVLVGARLLYPWLVNAGVEIYEYRRQPLHGKVAL
F6AI10_PSEF1          LLRELRNAARRGVKVTLILQGMPDMPLVRLCSRLTYNYLLRDGVTIYEYCQRPLHGKVAL
Q4ZRB3_PSEU2          FLRELRNASRRGVKVTLILQGQPDMPFVRVCSRLTYTYLLRDGVAIHEYKQRALHGKVAL
Q9I1W0_PSEAE          LLRELRDAARRGVRVDLVLQGMPDMPLVRLCSRLLYDYLLREGVRIHEYCQRPLHGKVAV
A5W3C1_PSEP1          LMRELRNAARRGVEVRLILQGQPDMRWVRALSRLLYNYLLRDGVKIHEYCQRPLHGKVAL
Q1I929_PSEE4          LLRELRNAARRGVEVTLILQGQPDMRWVRALSRLLYNYLLRDNVRIHEYCQRPLHGKVAL
Q4K7F6_PSEF5          LIHELRNAARRGVEVSLILQGQPDLPWARGFSRLLYNYLMRDGVAIHEYVRRPMHGKVAL
A4VLG4_PSEU5          VLREIRNAARRGVRVRLILQGEPDMPIAKFGARMLYNYLMRDGVEIHEYCRRPLHGKVAL
Q7VYJ5_BORPE          LLRDLRAAAARGVRVRLILQGEPDMPIAQLGARLLYDALAEAGVEILEYCERPLHGKVAS
A1WC60_ACISJ          LVRELRRAARRGVDVRLILQGEPDMPIVKTAAGLLYDHLLRAGVHIYEYCERPLHGKVAL
C5D1W9_VARPS          LIQDMRNAARRGVDVRLILQGEPDIPIVRIAARMLYHHLLMAGVSIFEYCERPMHAKVAL
Q12HK0_POLSJ          LLKEMRKAARRGVDVRLILQGAPDMPFVKTAASMLYHHLLEAGVQIYEYCERPLHGKVAV
I0HL35_RUBGI          FLKELRRAARRGVVVRLILQGTPDMPIVKTAAGLLYDHLLRDGVHIHEYCDRPMHGKVAV
E6WW36_PSEUU          FLTDLRGAARRGVDVRLILQGEPDMPSVMMAARTLYRQLIGDGVCIREYCTRPFHGKVAV
Q46SC5_CUPPJ          LLQAICAAAQRGVDVRLILQGRPDMVWVKRTVDMLYAHLRESGVRIFEYCERPNHSKVAV
C5BUD5_TERTT          LRHALRKAADRGVKVRLIFQKKPDLPLVLTAARSHYGHFLHHGIEIYEYKTRPLHAKVAA
K0MBP5_BORPB          FRKSLMQAAARGVRVRLLLQGKPEYRMQYFATRALYDRLLRGGIEIYEYMPGYLHAKVAV
Q2L1K1_BORA1          FRQTLAQAAARGVRVRLLLQGKPDHYLQYFATRALYDQLLRDGIEIYEYMPAYLHAKVAV
F6G5B5_RALS8          FMRALAACRRRGVRVRMLLQGRVEYAVQHYATRSLYHMLLRDGVEIHEYTASFLHAKVAV
Q5P2K2_AROAE          FRQALVDAAERGVRVSLLLQGVSDHPMLCHATRALYPFFLGRSIHLFEYHHSHLHAKVAV
Q479I4_DECAR          FGRALYAAARRGVRITVLLQGKTDHHLLRYATQTLYATALKAGIRIFEYEKSFMHAKVAV
Q1GYP3_METFK          FRQALIEAAKRGVRVRLLLQGRMEYWLM-FATHEVYGLFLRHGIEIYEYRASFMHSKVAV
C6XAE2_METGS          FRRALIAAAQRGVRVRLLLQGRLEYVFM-TATHAIYHQLLDSGIEIYEYRKSFMHSKVAV
D7DJW2_METV0          FRLALLAAVKRGVKVKLLLQGRMEYFLM-FSTHAFYSEFLRSGIEIYEYRKSFMHSKVAV
D5CQ53_SIDLE          FLRALVHAAERGVRVVLMLQGKVEYRLQHYATLALYGRLLAAGVEIYEYHASYLHAKVAV
Q39D22_BURL3          LRRALTGAARRGVDVRILI-GRKEFAALDTAVPFLYHALLRAGVRVAEYDKTMLHGKVAV
A0A0H2XSI7_BURCA      LRRALTGAARRGVDVQVLI-GRKEFTALDTAVPFLYHSLLRAGVRVAEYDKTILHGKVAV
A0A0H3KHH8_BURM1      LRRALTGAARRGVDVRILV-GRKEFAALDTAVPFLYRALLRAGVRVAEYDKTILHGKVAV
C4ASY6_BURML          LRRALAGAARRGVDVRILL-GRNEFASLDMAVPFLYHALLRSGVRVAEYDKTMLHGKVAV
B2JCV7_PARP8          LRRALMLAAQRGVDVRLVI-GRKEFAVLDYAVPFLYRQLLKSGVKIAEYEKTMLHGKVAV
A1VKQ0_POLNA          LRRALMRAARRGVRVTLLLQGKYEYFMQYHAARPVYGALLAAGVEIHEYSTSFLHAKVAV
C1D8A3_LARHH          LRRAMIQAVERGVRVRLLLQGRPDHPVMQWATRSLYGQFLRAGIEIHEYRAGHMHAKVAV
I0HN53_RUBGI          FRRALRRAAARGVRVRLLLQGKIDYRIAALAARALYDELRAHGVRIYEYTPAFLHAKVAV
                      .   :  .  *.* : ::.    :           *      .: : **     *.*** 

CLSB_ECOLI            MDDHWATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKR
CLSB_ECO57            MDDHWATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKR
CLSB_ECOL6            MDDHWATVGSSNLDPLSLSLNLEANVIIHDRNFNQTLRDNLNGIIAADCQQVDETMLPKR
Q1RED8_ECOUT          MDDHWATVGSSNLDPLSLSLNLEANVIIHDRNFNQTLRDNLNGIIAADCQQVDETMLPKR
A0A0E1T9D5_ECOLX      MDDHWATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKR
CLSB_SHIFL            MDDHWATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKR
A0A0H3BQ10_SALNS      MDDHWATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKR
CLSB_SALTY            MDDHWATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKR
CLSB_SALTI            MDDHWATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKR
A0A0H2WQ67_SALPA      MDDHWATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKR
A4W8D1_ENT38          MDDHWATVGSSNLDPLSLSLNLEANLIIHDREFNQTLRDNLSGIIARDCVRVDDSMVPKR
A0A0H3FT99_KLEAK      ADDHWATVGSSNLDPLSLSLNLEANLIIHDREFNQTLRDNLNGLIARDCQQIDKSMLPKR
B5XYV8_KLEP3          ADDHWATVGSSNLDPLSLSLNLEANLIIHDRVFNQTLRDNLNGLIARDCQRIDKTMLPKR
A0A0H3KY94_PANAA      KDQQWATVGSSNLDPLSLSLNLEANLIIHDRHFNETLRDNLEHLLAEDCQRVQEDKLPPR
C6C907_DICP7          QDDYWATVGSSNLDPLSLALNLEANLVIHDRDFNQQLRDNLRQLIQEESRRVEEQHVPRK
C6CLB0_DICC1          QDEYWTTVGSSNLDPLSLALNLEANLFINDRDFNQQLQDNLHQLIREDCVQVDPSQLPKR
F6AI10_PSEF1          ADHEWCTIGSSNLDPLSLSLNLEANVIVRDAALNRRLHEHLSELAESSCKSVPLKRVMRG
Q4ZRB3_PSEU2          IDQDWSTVGSSNLDPLSLALNLEANLFIRDRTLNEHLQNHLMELAAAHSKQMSLKGAARG
Q9I1W0_PSEAE          IDDDWSTIGSSNLDPLSLSLNLEANLVIRDVAFNGQLYQHLRELARRHCRRISRRHARRG
A5W3C1_PSEP1          VDDQWATVGSSNLDPLSLSFNLEANLFIRDRAFNQQLHQHLHALASEQCKPVTLERMIRG
Q1I929_PSEE4          VDDDWSTVGSSNLDPLSLSFNLEANLVIRDRAFNQNLHRHLSELTRQHCKAVTLERMVRG
Q4K7F6_PSEF5          ADHNWATVGSSNLDPLSLSLNLEANLIIRDIDFNKRLHRHLERLMTHHCRQVTQQRLLRG
A4VLG4_PSEU5          ADYEWSTVGSSNLDPLSLSLNLEANLIIRDHVFNRHLHERLDHLLQTDCRRIPLERIIRG
Q7VYJ5_BORPE          IDDEWATVGSSNLDPFSLALNLEANVEVRDSAFASGLRERLERLAIDHCRPAPQSDGAGR
A1WC60_ACISJ          VDREWSTVGSSNLDPLSLSLNLEANVVIRDASFNALLYQRLSRLMQRHCRQVEPAPRGAW
C5D1W9_VARPS          TDDCWSTVGSSNLDPLSLALNLEANVVVHDPAFNRALSERLEH-MNRNCKRIGAADLDKW
Q12HK0_POLSJ          ADDEWATVGSSNLDPLSLSLNLEANVVIRDRAFNQVLSARLDHLMQHGCKQIGPGDLQES
I0HL35_RUBGI          VDEDWATVGSSNLDPLSLSLNLEANVILRDRGFAAQLRERLQHLIRHSCEEVQPEPTPRW
E6WW36_PSEUU          VDDEWATVGSSNLDPLSLSLNLEANLVVRDRGFNGELSASLEQLWMDHCEEVTLEGLDQR
Q46SC5_CUPPJ          VDDDWATVGSSNLDPLSLSLNLEANLVIRDGAFVATLKDTLRDLMVRSCTEISAVERGQG
C5BUD5_TERTT          IDDNWCTIGSSNLDPWSLTLNLEANILVKDSTLTRELCGELETLIDES-EAINKADYGRW
K0MBP5_BORPB          IDN-MATVGSSNLDPFSLLLAREANVVVDDQPFAWDLQERLERAIALGGQFIRPLDYQRR
Q2L1K1_BORA1          MDG-IAAVGSSNLDPFSLLLAREANVLVDDAAFAGDLQARLESAIAEGGHGIRPLDYQRR
F6G5B5_RALS8          VDARWATVGSSNIDPFSLLLAREANVVAWDAGVAGQLRAALEDAIAHHARPVLADEHAAR
Q5P2K2_AROAE          VDRRWATVGSSNIDPFSLLLAREANVVIDDVGFATELNGSLQRAIASGARELRREDWRRL
Q479I4_DECAR          IDGLWATVGSSNIDPFSLLLAKEANLVVRDAAFAGELKASLGAAIENGARELRHEDLTRL
Q1GYP3_METFK          VDSRWATVGSSNLDPFSLMLAREANIMVQDKRFNAELKADLEKAIAEKSVQVRPEDWSRR
C6XAE2_METGS          VDSKWATVGSSNIDPFSLLLAREANVAVMDNGFALTLKHDLERAIQDGAVQVRPQEWQRG
D7DJW2_METV0          IDDAWATVGSSNIDPFSLLLAREANVVVKDTTFANELRADLQANIEDGALRIDPQHWTRG
D5CQ53_SIDLE          IDGEWATVGSFNIDPFSLLLAREANLAVQDKGFSGDLRGSLWRAIERDGRRV---ELARA
Q39D22_BURL3          IDDNWATVGSSNLDALSLMLNNEANVVLVRYDAVTNELRDAIAAAFADGREIDPARFAAR
A0A0H2XSI7_BURCA      IDDNWATVGSSNLDALSLMLNNEANVVLVRYDAVTNQLRDAIATAFAEGREIDAAHYAAR
A0A0H3KHH8_BURM1      IDDNWATVGSSNLDALSLMLNNEANVVLVRYDAVTNELRDAIEAAFADGREIDPAWYAAR
C4ASY6_BURML          IDDHWATVGSSNLDALSLMLNNEANVVLVRHREETAALRDAIAAAFADGREIDPALYAAR
B2JCV7_PARP8          VDSNWGTVGSSNLDALSLMLNNEANVVLVLHPEI-DQLRDAILAAFDESRRIDEKHYESR
A1VKQ0_POLNA          VDGHWATVGSSNLDPLSLLLAREANVVVEDRAFASELSARLREAVMHHGVRIDPAVYGQR
C1D8A3_LARHH          VDTRWATVGSSNIDPFSLGLAREANVVVDHYPFARELQSSILKRLREDSLRILPQMVVRA
I0HN53_RUBGI          VDDDWATVGSSNIDPLSLLLNLEANVVVRDPLFARALADRLDSAI--DASREVKTQPAGS
                       *    ::** *:*. ** :  ***:                                  

CLSB_ECOLI            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLAQVDPPAQPTMETQDRVETENTGVKP--
CLSB_ECO57            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLAQVDPPAQPTMETQDRVETENTGVKP--
CLSB_ECOL6            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLAQVGPPAQPTMETQDRVETENTGVKP--
Q1RED8_ECOUT          TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLAQVGPPAQPTMETQDRVETENTGVKP--
A0A0E1T9D5_ECOLX      TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLTQVDPPAQPTMETQDRVETENTGVKP--
CLSB_SHIFL            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPRLTQVDPPAQPTMETQDRVETENTGVNP--
A0A0H3BQ10_SALNS      TWWNLTKSVLAFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENTGVKP--
CLSB_SALTY            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENTGVKP--
CLSB_SALTI            TWWNLTKSVLAFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENSGVKP--
A0A0H2WQ67_SALPA      TWWNLTKSVLVFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENTGVKP--
A4W8D1_ENT38          TWWNLTKSVVVFHFLRHFPALVGWLPAHTPKLAQVPAPVQPAMETQDRVEAENTGAKP--
A0A0H3FT99_KLEAK      NWWRLGVSVLAFHFLRHFPAWVGWLPAHTPQLARVSPPVQPEIETQDRVETQTRDNPL--
B5XYV8_KLEP3          NWWRLGVSVMAFHFLRHFPAWVGWLPAHTPRLARVSPPVQPEIETQDRVDSQTRDNPL--
A0A0H3KY94_PANAA      NWWQLSKSVVVFHFLRHFPAIAGWLPAHTPKLAQVDPPVQPEMETQDRVEANNEGAKS--
C6C907_DICP7          NGWRLLVNVAVFHFLRRFPALAGWLPAHTPQLTQIDIPEPPHMPPQ--------------
C6CLB0_DICC1          SYWQVFKGMVVFHFLKRFPSLVGWLPAHSPQLTQVGQADDNDRK----------------
F6AI10_PSEF1          YWWRAPLIFLCFHFLRHFPAIAGWFPAHSPRIKLLKPEIEAPQCGTLQ-------VDQEK
Q4ZRB3_PSEU2          QWWRAPMIVLSFFFLRRFPAIAGLFPVHGVRLKPLRAGDVVPEAKVIEQQQNNHPMDQEK
Q9I1W0_PSEAE          YWWRAPLIFLGFHFSRHFPAIAGWVPAHLPRLKSLEPR---PSRRWQER------QGQRG
A5W3C1_PSEP1          YWWRAPLIFVCFHVIRHFPRIAGWFPAHRQRLRSVQPEAEPHGNLHEGNS----------
Q1I929_PSEE4          YWWRAPLIFLGFHITRYFPRIAGWFPAHRQRLQSLQPESEAPANYHGGKT----------
Q4K7F6_PSEF5          HWWRGPVIFLYFNLLRYFPAIAGWLPAHRPELASIP--GPPAGRRCKQPQ----------
A4VLG4_PSEU5          FWWRAPLAFLIFHFLRHFPGLVNLFPEHKPRLELIDADASPLDTVPAPIQ-----REQR-
Q7VYJ5_BORPE          QLRRLFAGALVYHFLRRFPAWAGSLPAHKPRIQTLRPDGQGQPDEAT-------------
A1WC60_ACISJ          EALRLLRGYCVYHLMRWFPAWAGWLPRHEPAIAVMQAEPPADQTARAS------------
C5D1W9_VARPS          SSWRLVRSFVVFHLLRWYPSWIAWLPRHAPRVTALGR-----------------------
Q12HK0_POLSJ          SGWRIVRSFFLFHLLRRYPAWAGWLPAHAPRLTPALAPADPTAHISTAQADAVHRADPTT
I0HL35_RUBGI          RLWVRMRSYFVLRFAQRFPLWARVLPAHRPTLELVEAPPGAAPAPAERADEARGLHVG--
E6WW36_PSEUU          PRWPVPQ-VLLYHVLRKFPRWAGLLPAHTPRTVTLASGGQAPERAASTLASPGH------
Q46SC5_CUPPJ          AWWHGIATPLIFHFLRKFPAWAGWLPAHTPRLVSPEIPAAGVAPPADMAVHNVQRDGS--
C5BUD5_TERTT          VSLKSIGYRVSWWFFRLLLKFAVLIKVGNPLVRRLYRDGDAIDNTAKRLDGNKQTVEHER
K0MBP5_BORPB          GWLRRCIDVAAYTMLRIGVALTGRAGRY--------------------------------
Q2L1K1_BORA1          GWGRRLLDALAYTALRVGVALTGRSDKY--------------------------------
F6G5B5_RALS8          PWWWRLVDWCAYRLVRLGVVISGRASHY--------------------------------
Q5P2K2_AROAE          PTLRRVTSWISYQLVRLAIGVAGYGGKH--------------------------------
Q479I4_DECAR          PWHSRLLRWLAYGLVRAMVGIAGYGQHHWQNRGIKPEEE---------------------
Q1GYP3_METFK          HVFKCAFSWIVYVVVRLMIGLVGSKEKH--------------------------------
C6XAE2_METGS          HFIRRGFSWLVFGAVRFILGLIGYGNQH--------------------------------
D7DJW2_METV0          NIFKRFASWIAYGLVRAFLGVIGHSNEK--------------------------------
D5CQ53_SIDLE          NLGTRVLARMSYGLVRLIIGVLGISKSH--------------------------------
Q39D22_BURL3          PRIERMLNWLAYTAYRLVMKALTVGGYD--------------------------------
A0A0H2XSI7_BURCA      PRIERLLNWLAYTTYRLVMKALTVGGYD--------------------------------
A0A0H3KHH8_BURM1      PLGERLLSWLAYTTYRIVMKALTVGGYD--------------------------------
C4ASY6_BURML          PAAERFLNWFAYNAYRSAMKLLTVGGYD--------------------------------
B2JCV7_PARP8          PAGERLLNWVAYNTYRLAMKLLTVGGYD--------------------------------
A1VKQ0_POLNA          PLGRRIQGWMAYALMRLAL-LLTGQRY---------------------------------
C1D8A3_LARHH          RWWEKWIAWTCYGIARFAINLAGLGEYYSKE-----------------------------
I0HN53_RUBGI          GWRSWLHRGFVAWCASVYLRLAGIGGRY--------------------------------
                                                                                  

CLSB_ECOLI            ------------
CLSB_ECO57            ------------
CLSB_ECOL6            ------------
Q1RED8_ECOUT          ------------
A0A0E1T9D5_ECOLX      ------------
CLSB_SHIFL            ------------
A0A0H3BQ10_SALNS      ------------
CLSB_SALTY            ------------
CLSB_SALTI            ------------
A0A0H2WQ67_SALPA      ------------
A4W8D1_ENT38          ------------
A0A0H3FT99_KLEAK      ------------
B5XYV8_KLEP3          ------------
A0A0H3KY94_PANAA      ------------
C6C907_DICP7          ------------
C6CLB0_DICC1          ------------
F6AI10_PSEF1          VS----------
Q4ZRB3_PSEU2          TL----------
Q9I1W0_PSEAE          NP----------
A5W3C1_PSEP1          ------------
Q1I929_PSEE4          ------------
Q4K7F6_PSEF5          ------------
A4VLG4_PSEU5          ------------
Q7VYJ5_BORPE          ------------
A1WC60_ACISJ          ------------
C5D1W9_VARPS          ------------
Q12HK0_POLSJ          P-----------
I0HL35_RUBGI          ------------
E6WW36_PSEUU          ------------
Q46SC5_CUPPJ          ------------
C5BUD5_TERTT          IDTRNSERAKCT
K0MBP5_BORPB          ------------
Q2L1K1_BORA1          ------------
F6G5B5_RALS8          ------------
Q5P2K2_AROAE          ------------
Q479I4_DECAR          ------------
Q1GYP3_METFK          ------------
C6XAE2_METGS          ------------
D7DJW2_METV0          ------------
D5CQ53_SIDLE          ------------
Q39D22_BURL3          ------------
A0A0H2XSI7_BURCA      ------------
A0A0H3KHH8_BURM1      ------------
C4ASY6_BURML          ------------
B2JCV7_PARP8          ------------
A1VKQ0_POLNA          ------------
C1D8A3_LARHH          ------------
I0HN53_RUBGI          ------------