CLUSTAL format seed alignment for MF_01923

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLME_HALMA            --MPTDERLSDDQLQRIANDLRDNWHTGREVD-FEEAIAFHESLPASKQFAQVLESADQ-
G0HQ33_HALHT          --MPTDERLSDDQLQRIANDLRDNWHTGREVD-FEEAIAFHESLPASKQFATVLESADQ-
C7P171_HALMD          --MPRDQRLAGEELQRLANGLRDEWHTGREVD-FEEAIAFHESLPPGKQFAPVLESADR-
L0JPW1_NATP1          --MIRDERIPSDELRRIDEEIRSNWPTGEDVD-FEEAIEYHESLPDHKRFADVLESADK-
I7D074_NATSJ          --MIRDERIPSDELRRIDEEIRSNWPTGADVD-FEDAIEYHESLPDHKRFADVLESAEK-
D3SSP0_NATMM          --MIRDERIPADELRRIDDEIRSNWPTGDAVD-FDEAIDYHESLPAHKQFADVLENADK-
D2RRB9_HALTV          --MIRDERIPADELRRIDEEIRSNWSTGEAVD-FEDAIAYHESLPDGKRFADVLESADK-
L0AMT1_NATGS          --MIRDERIPSDELRRIDDEIRSNWPTGADVD-FENAIEYHESLPAHKRFADVLESADK-
F8D6M9_HALXS          --MIRDERIPADQLRRIDEEIRSEWPTGDEVD-FEEAIAYHESLPDRKRFADVLESADK-
L0IBG1_HALRX          --MVRDEQLSSDGLATIDEAVRAEWPTGEAAT-VDDAIAFHEGLPPSKEFATVLESATE-
GLME_HALSA            --MIEDKRLTDTELEAITDRITGDWVSRAAVD-FADAVAFHESLPPHKRFAAVLENAEA-
B0R7I4_HALS3          --MIEDKRLTDTELEAITDRITGDWVSRAAVD-FADAVAFHESLPPHKRFAAVLENAEA-
L0AHS6_NATGS          --MVEDTRLSDVELQRQHEQVWDTYPGDDRST-FEKAVAVHEALPASKQFATVLESADR-
D9QUW6_ACEAZ          -MELKNEKWSLDKFKEIREEVLQQWPTGKDVD-FEEAIEYHNNLPEEQIMAEKLAEAKEE
L0KBW7_HALHC          -MELKNKKWDLDKFMEFRKEVLQQWPTGKEVD-LQEAIAYQKKLGEEKIMAEKLQEAKEN
E3DQY7_HALPG          -MKIENKKWSLEKFNQIREEVLKQWPTGQDVD-LEEAIEYQKNIEPKKRVTAKLKEAKES
F4LS62_TEPAE          -MEVQNKKWDMKKFSEMRQEVLNQWPTGKEVD-FEEAVRYHQNLPKNQIMTNKLREAATK
B8CYC4_HALOH          -MTIKDKRLDEELFLKEREEVLKAWPTGKEVD-FDEAVAYHKSIPEERIMVNTLMKADQV
GLME_DESHY            -MDLTNRMMEPEEFARQRQEVLNQWATGRDVD-FEEAVAYHKNLPRSKNFSYKLAEGKAR
B8FVK4_DESHD          -MDLTNRMMEPEEFARQRQEVLNQWATGRDVD-FEEAVAYHKNLPRSKNFSYKLAEGKAR
I4ADL4_DESDJ          -MDLANRTIDPEEFFRQRQEVLNQWTTGKDVD-FEEAVAYHKSLPQSKVFGHKLAEGKAK
G7W9U0_DESOD          -MDLTVRQMDADEFQRQRQEVLGQWQTGKDVV-FEEAVAYQKSLPKSKVFAEKLAEGKEK
J7IW58_DESMD          -MDLTVRQMDTEEFQRQRQEVLGQWPTGKDVS-FEEAVAYQKSLPKSKIFAEKLAEGKAK
I4DBP4_DESAJ          -MELTVRQMDAEEFQRQRQEVLGQWETGKGVN-FEEAVAYHKSLPKSKIFAEKLAEGKAK
F6DJY8_DESRL          -MSLANKKLDWNQFLEIRREVLKAWPTGQEVD-LAEAIQYQSRIPAQRRFAEKMEEAKKE
A4J7Z3_DESRM          -MQLTNKRLEWDQFLEIRREILNSWPTGQEVD-LEEAIAYQSKIPDNRRFAKKLETAKQE
F6B848_DESCC          -MQLANKKLDWDQFLQIRQEVINSWPTGQEAD-LADGVAYQAQLPAKLRFAEKLEQAKQE
Q3AFA5_CARHZ          ----MKGKIDLEKFLQSRKEVLATWPTGAEVS-LEDGINYHKALPPEKNFAVKLKKVKEE
GLME_CLOCO            -MELKNKKWTDEEFHKQREEVLQQWPTGKEVD-LQEAVDYLKKIPAEKNFAEKLVLAKKK
Q890S2_CLOTE          -MELKNKKWTEEEFHKQREEVLKQWPTGKDVD-LQEAVDYLKKIPAEKNFADKLVLAKKK
GLME_CLOTT            -MELKNKKWTDEEFFKQREEVLKQWPTGKEVD-LQEAVDYLKKVPTEKNFADKLVRAKEA
D8GIL2_CLOLD          -MELKNKKWSEEQFFKVREEVLSQWPTGKEVD-LKEAVDYLKKLPEHKSFPKKLIKAKEQ
E3H6D0_ILYPC          -MKLKFNRWTEEEFMKVREEVLKQWPTGAEVD-LDEAVAYHKALPDHKNFAKKLIDAKEK
GLME_TREDE            -MRWKNKKIPEGEFMEMREEILQTWPTGKDVD-LKESIDYLKKIPPEKNFAIKLEQADKE
A6TTM5_ALKMQ          -MELKNKKLSEESFFQERKEVLTHWVTGKDVD-LQEAVDYLKQIPKHKNFALKMRKAKAD
F4KLG3_PORAD          -MELRNKRIDNDTFYKERKEVLASWPTGKDVN-FEEAVEFQKSIPEEKIFGRKLAQADAE
A0A1P8JN68_PREIN      -MELKNKKLTDDEFFKERADVLTHWETGKEVD-FQEAVDYQKSIAPEKRFSYKLQKAVEN
F5YRD2_TREPZ          -MELENKRITDDEFYKIRQEVLQQWPTGKDVN-LEESFAYHKSLPEHKIFSKKLLKAKQS
GLME_SHIDS            -MELRNKKLTHDEFMTERQQVLKTWETGKNVENFEDGVKYQQAIPEHKRFSLALLKADKE
D3QMS0_ECOCB          -MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLALLKADKE
GLME_ECO57            -MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLALLKADKE
B1LLH1_ECOSM          -MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLALLKADKE
B7N9X6_ECOLU          -MELRNKKLTHNEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLALLKADKE
A0A0H3ME76_ECO7I      -MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLALLKADKE
D3GY76_ECO44          -MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPEHKRFSLVLLKADKE
A0A0H3H8H8_KLEOK      -MELRNKKLTHDEFMTERHQVLQTWHTGKDVEHFEDGVKYQQTIPEKKRFSHALLKADQE
E3G176_ENTLS          -MELRNKKLTHDEFMTERQQVLQTWHTGKDVENFEDGVKYQQTIPEKKRFSHALLKADQE
A8AJ72_CITK8          -MELRNKKLTHDEFMTERHQVLQTWHTGKDVENFEDGVKYQQTIPEKKRFSHALLKADQE
A9MJK9_SALAR          -MELRNKKLTHDEFMTERHQVLQTWHTGKEVEKFEEGVKYQHTIPEQKRFSQALLKADRE
B7LKN1_ESCF3          -MELKNKKLSLDEFMNERLQVLQTWPTGKEVENFAEAVNYQQSIPEHKRFSLALLKADQQ
F4N2Q4_YEREN          -MELRNKKISLDDFMSERFHVLKTWHTGKDVENFEDGVKYQQTIPESKNFARALFEADCN
A0A0H3NWG3_YERE1      -MELRNKKISLDDFMSERFHVLKTWHTGKDVENFEDGVKYQQTIPESKNFARALFEADCN
GLME_YERE8            -MELRNKKISLDDFMSERFHVLKTWHTGKDVENFEDGVKYQQTIPESKNFARALFEADCN
F8F1V4_TRECH          ---MIDRKMSREQFETQRKEVLQSWPTGAEVD-FDAAIALQRSIPKEKNFAHAMIQAERE
B5YEV1_DICT6          -MVLKNKKWDHNYFLKMREEVLNSWETGKEVN-FEEAVSYLKSLPKEKYADYVLKKADEE
B8E0H4_DICTD          -MVLKNKKWDHKYFLKMREEVLNSWETGREVN-FEEAVSYLSSLPREKYADYVLRKADES
K4LJT5_THEPS          -MSLQDRKWEIERFFQERTEVLAAWPSGRGVD-LEEALAYHRGLPKEKVAYYKLLKGQAE
GLME_FUSNN            -MPITFKKIDKEDFLEIRKNFLENYKNLDDFD-LNTAIRFHKSLPDHKNFQKKIEQSVQD
A5CZJ8_PELTS          MIRVRQKQIDWDKFLEMRKEVLSVWPTLKEID-LEDAVAYQKSLPESKIFYKQLQKLDTE
                                   :      .   :        .  ..     :         :      

GLME_HALMA            --PLLQPRAGVPCLEEQIDLLRYLQDEGGADLLPTTIDSYTRDNEYEKAEEGLAASRGSD
G0HQ33_HALHT          --PLLQPRAGVPCLEEQIDLLRYLQDEGGADLLPTTIDSYTRDNEYEKAEEGLAASRGSD
C7P171_HALMD          --PLLQPRAGVPCLEAQIDLLRYLEQQGGADLLPTTIDSYTRDNEYEKAEEGLAASRNSD
L0JPW1_NATP1          --PLLQPRAGVPRLDDQIELLRYLHEEGQADLLPTTIDSYTRDNEYEKAQQGLDKALETG
I7D074_NATSJ          --PLLQPRAGVPRLDDQIELLQYLHEEGQADLLPTTIDSYTRDNEYEKAQQGLEKALETG
D3SSP0_NATMM          --PLLQPRAGVPRLDDQIELLEYLHESGQADLLPTTIDSYTRDNEYGKAQEGLEKARETG
D2RRB9_HALTV          --PLLQPRAGVPRLDDQIELLEYLHREGQADLLPTTIDSYTRDNEYGKAQEGLEKARETG
L0AMT1_NATGS          --PLLQPRAGVPRIDDQIELLEYLHREGQADLLPTTIDSYTRDNEYEKAQEGLEKARETG
F8D6M9_HALXS          --PLLQPRAGVPRLEDQIDLLEYLHGEGKADLLPTTIDSYTRDNEYEKAQEGLEKARETD
L0IBG1_HALRX          --PLLQPRAGVARLDEQIELLTYLEETGEADLLPTTIDSYTRDNEYGKARTGLEKTRESD
GLME_HALSA            --VLCQPRAGVPRLDEHVELLQHLDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETD
B0R7I4_HALS3          --VLCQPRAGVPRLDEHVELLQHLDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETD
L0AHS6_NATGS          --VLTQPRAGVPCLDDQIDLLETLVTDGDVDLLPVTIDSYTRDNQYEKAREGLERSRETD
D9QUW6_ACEAZ          DVTLIQPRAGVALIDEHIELLKFLREEGQADLLPSTIDSYTRQNNYEEAEAGIEESREEG
L0KBW7_HALHC          EETLIQPRAGVALIEEHIELLKFLRDKGKTDLLPTTIDSYTRQNNYKEAEAGIKESSDEG
E3DQY7_HALPG          GITLIQPRAGVALIDKHIELLRFLQDEGKADILPTTIDSYTRQNNYEDAEAGIKESREEK
F4LS62_TEPAE          NNTLIQPRAGVALLDEHIELLKFLRQKGKADVLPTTIDSYTRQNRYEEAEKGIKESEKAG
B8CYC4_HALOH          GKTLIQPRAGVALPEEHIGLLQYLREEGEADLLPTTIDSYTRQNQYREAENGIKESREMG
GLME_DESHY            GITFAQPRAGVALLNEHLELLRFLEEEGEADFLPTTIDSYTRQNRYAEAQTGIDESRLVG
B8FVK4_DESHD          GITFAQPRAGVALLNEHLELLRFLEEEGEADFLPTTIDSYTRQNRYGEAQTGIDESRLVG
I4ADL4_DESDJ          GITFAQPRAGVALLNEHLELLRFLEEEGEADFLPTTIDSYTRQNRYAEAQTGIDESRMVG
G7W9U0_DESOD          GMTFAQPRAGVALLNEHIELLRFLQDEGGADFLPSTIDSYTRQNRYTEAQAGIEESVMIG
J7IW58_DESMD          GLTFAQPRAGVALLSEHIELLRFLQDEGGADFLPSTIDSYTRQNRYTEAQAGIEESAMIG
I4DBP4_DESAJ          GVTFAQPRAGVALLNEHIELLRFLQDEGGADFLPSTIDSYTRQNRYTEAQSGIDESRTLG
F6DJY8_DESRL          RITLAQPRAGVALVHEHSELLQYLADQGEADLLPTTIDSYTRQNRYNEAQVGIEESRSVG
A4J7Z3_DESRM          GITLAQPRAGVALVNEHIELLRYLETEGEADLLPTTIDSYTRQNRYNEAQAGIDESRSVG
F6B848_DESCC          GITLAQPRAGVALVHEHIELLRYLVDEGGADLLPTTIDSYTRQNRYNEAQAGIEESRTVG
Q3AFA5_CARHZ          GITAIQPRAGVALLNEHIALLKYLEKEGEADFLPTTIDSYTRQNRYQEAQRGIEESLAEG
GLME_CLOCO            GITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAG
Q890S2_CLOTE          GITMAQPRAGVALLDEHIELLQYLQNEGGADFLPSTIDAYTRQNRYDECEIGIKESEKAG
GLME_CLOTT            GITLAQPRAGVALLDEHINLLRYLQDEGGADLLPSTIDAYTRQNRYEECEIGIKESEKAG
D8GIL2_CLOLD          GITLAQPRAGVALIDDHIKLLKHLQDEGGADLLPTTIDSYTRQNRYDECEVGIKESKSQG
E3H6D0_ILYPC          GITLAQPRAGVALIDEHIELLNFLDEKGGADLLPSTIDSYTRQNKYEECERGIIESRRAG
GLME_TREDE            GITTAQPRAGVPLLDEHINLLQFLQDEGGADFLPSTIDAYTRQNRYEEGEAGIEASKKAG
A6TTM5_ALKMQ          GITLAQPRAGVALVDEHIKLLQYLQNEGGADLLPNTIDSYTRQNRYQEGQAAIDESMREN
F4KLG3_PORAD          GRTLIQPRAGVALYTEHIKLLQFLEEEGGADLLPSTVDSYTRLNRYHEAENGIIKSKESG
A0A1P8JN68_PREIN      GDTLIQPRAGVALYEEHIKLLRFLEDEGGADLLPSTVDSYTRLNRYKECEVGIQKSFETN
F5YRD2_TREPZ          GTTLIQPRAGVALIGEHIKLLTYLQDQGEADLLPTTIDSYTRQNRFQKAEEGIEESIKQG
GLME_SHIDS            GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
D3QMS0_ECOCB          GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
GLME_ECO57            GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
B1LLH1_ECOSM          GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
B7N9X6_ECOLU          GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
A0A0H3ME76_ECO7I      GKTLSQPRAGVALMDEHIKLLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
D3GY76_ECO44          GKTLSQPRAGVALMDEHIELLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAG
A0A0H3H8H8_KLEOK      GKTLSQPRAGVALMDEHIALLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIQKSIEAG
E3G176_ENTLS          GKTLSQPRAGVALMDEHIALLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIQKSIEAG
A8AJ72_CITK8          GKTLSQPRAGVALMDEHIALLKTLQEE--CDLLPSTIDAYTRLNRYEEAAIGIQKSIEAG
A9MJK9_SALAR          GRTLSQPRAGVALMDEHIALLKTLQEE--CDLLPSTIDAYTRLNRYEEAAVGIQKSIEAG
B7LKN1_ESCF3          GKTLSQPRAGVALIDEHIELLKTLEQE--CDLLPTTIDAYTRLNRYEEAAVGIQKSLEAG
F4N2Q4_YEREN          GITLSQPRAGVALIEEHIELLKTLQKD--CDLLPTTIDAYTRLNRYEEAAVGIQKSIEAG
A0A0H3NWG3_YERE1      GITLSQPRAGVALIEEHIELLKTLQKD--CDLLPTTIDAYTRLNRYEEAAVGIQKSIEAG
GLME_YERE8            GITLSQPRAGVALIEEHIELLKTLQKD--CDLLPTTIDAYTRLNRYEEAAVGIQKSIEAG
F8F1V4_TRECH          GRTLLQPRAGVALVDEHIRLLKYLETEGEADLLPTTIDAYTRQNRYTEAAKGIEKSQAAG
B5YEV1_DICT6          KRTLLQPRAGVPILREHILLLQYLQKEGGADILPTTIDSYTRQNRYREAQIGIEESLREG
B8E0H4_DICTD          KKTLLQPRAGVPILKEHILLLQYLQKEGGADILPTTIDSYTRQNRYREAQLGIEESLREG
K4LJT5_THEPS          GRIYLQPRAGVALIDEHIALLRSLEKEGEADFLPTTVDSYTRQNRYSEAARGIKESKAAD
GLME_FUSNN            NKIMTQAHSKETLLEDLIKNLNTFYRVGQADFLSIIIDSHTRENHYDNAKVILEDSIKSN
A5CZJ8_PELTS          KRMANFPRAGTPILEDEIELVRTLNSLG-VICTPLTTDSYTRNLQFEKAQQGLEESIRTG
                            .::  .        :  :         .   *::**   : .    :  :    

GLME_HALMA            ENELNGFPAVNHGVEDCRRLIRALDAPVEVRHGTPDARLLAMVTLAGGFQSFEGGPISYN
G0HQ33_HALHT          ENELNGFPAVNHGVEDCRRLIRALDAPVEVRHGTPDARLLAMVTLAGGFQSFEGGPISYN
C7P171_HALMD          EDALNGFPAVNHGVEDCRRLVRALDTPIEVRHGTPDARLLAMVTLAGGFQSFEGGPISYN
L0JPW1_NATP1          DDTLNGFPAVNHGVDGCRQLIDAVDAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
I7D074_NATSJ          DDTLNGFPAVNHGIDGCRELIDTIDAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
D3SSP0_NATMM          EDTLNGFPAVNHGVEDCRNLIEAIDAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
D2RRB9_HALTV          EDTLNGFPAVNHGVDGCRELIDSIDAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
L0AMT1_NATGS          ENTLNGFPAVNHGVDGCRELIESIEAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
F8D6M9_HALXS          EDTLNGFPAVNHGVEGCRELIEAIDAPIEVRHGTPDARLLAAITFAGGFQSFEGGPISYN
L0IBG1_HALRX          ADALNGFPAVNHGVDGCRTLVESVDGPIEVRHGTPDARLLAAVTLAGGFQSFEGGPISYN
GLME_HALSA            SSELNGFPAVNHGVEGCREVVRRVDAPVQVRHGTPDARLLAAVTLAGGFQSFEGGPITYN
B0R7I4_HALS3          SSELNGFPAVNHGVEGCREVVRRVDAPVQVRHGTPDARLLAAVTLAGGFQSFEGGPITYN
L0AHS6_NATGS          ADELNGFPAVTHGVEGCRTLVEAADAPVQIRHGTPDARLLAAVTFASGVQSFEGGPITYN
D9QUW6_ACEAZ          RSMLNGFPAVNHGVKACREVVEALDAPLQVRHGTPDARLLAEITLAGGFTDYEGGGLSYN
L0KBW7_HALHC          RSMLNGFPAVNHGVINCRKVVEALDAPLQVRHGTPDARLLAEITLAGGFTDYEGGGISYN
E3DQY7_HALPG          RSMLNGFPAVNHGVQGCREVVEALASPLQVRHGTPDARLLAEITLAGGFTDFEGGGISYN
F4LS62_TEPAE          RSLLNGFPAVNYGVKKCRKVIESVDCPVQVRHGTPDARLLAEITLAGGFTDFEGGGISYN
B8CYC4_HALOH          RSMLNGFPAVNHGVKVCRQVNEAVNVPVQVRHGTPDARLLAEITLAGGFTDFEGGGISYN
GLME_DESHY            RSMLNGFPAVNHGVSACRRLIEHPKVPVQVRHGTPDARLLAEITLAGGFTAYEGGGISYN
B8FVK4_DESHD          RSMLNGFPAVNHGVSACRRLIEHLKVPVQVRHGTPDARLLAEITLAGGFTAYEGGGISYN
I4ADL4_DESDJ          RSMLNGFPAVNHGVAACRRLIEHLKVPVQVRHGTPDARLLAEITLAGGFTAYEGGGISYN
G7W9U0_DESOD          RSMLNGFPAVNHGVAACRQVIESVQVPVQVRHGTPDARLLAEITIAGGFTDFEGGGISYN
J7IW58_DESMD          RSMLNGFPAVNHGVAACRQIVESVQVPVQVRHGTPDARLLAEITIAGGFTDYEGGGISYN
I4DBP4_DESAJ          RSMLNGFPAVNHGVAACRQVVESVQVPVQVRHGTPDARLLAEVTIAGGFTDYEGGGISYN
F6DJY8_DESRL          RSMLNGFPAVNHGVTACRQVVESVKLPLQVRHGTPDARLLAEITLAGGFTAYEGGGISYN
A4J7Z3_DESRM          RSMLNGFPAVNHGVVACRQVVESVISPVQVRHGTPDARLLTEISLAGGFTAYEGGGISYN
F6B848_DESCC          RSMLNGFPAVNHGLAACRQVVEAMSVPVQVRHGTPDARLLAEITLAGGFTAYEGGGISYN
Q3AFA5_CARHZ          RSMLNGFPAVNYGVYPCRKIIEEVNVPVQVRHGTPDARLLAEITLAGGFSSFEGGGITYN
GLME_CLOCO            RSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYN
Q890S2_CLOTE          RSLLNGFPGVNHGVQGCRKVLEAVELPLQIRHGTPDARLLAEIMTAGGYTSNEGGGISYN
GLME_CLOTT            RSLLNGFPGVNHGVKGCRKVLESVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYN
D8GIL2_CLOLD          RSLLNGFPGVNHGVKGCRQVVEALDLPVQARHGTPDSRLLAEIIHAGGFTSNEGGCISYN
E3H6D0_ILYPC          RSLLNGFPGVNHGIEGCRKVVESVNLPLQLRHGTPDARLLSEIMIASGFTSNEGGGVSYN
GLME_TREDE            RSLMNGFPAVNWGVGPCRQVLEAVNLPLQARHGTPDARLLSEIIHAGGYTSNEGGGISYN
A6TTM5_ALKMQ          RSMLNGFPVVNHGVHNCRKVLDAVELPLQARHGTPDARLLTEIIHAGGWTSNEGGGISYN
F4KLG3_PORAD          RSMLNGFPIVNYGTKICRTVTSALKNPVQVRHGTPDARLLTEISIAGGFTSYEGGGISYN
A0A1P8JN68_PREIN      RSMLNGFPIVNYGVDICRKVTSAVKSPVQVRHGTPDARLLTEISIAGGFTSYEGGGISYN
F5YRD2_TREPZ          KSMLNGFPAVNHGVSGCRQIIDALDTPVQVRHGTPDARLLTEIAYAGGFTSYEGGGISYN
GLME_SHIDS            TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAKISMASGFTSYEGGGISYN
D3QMS0_ECOCB          TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
GLME_ECO57            TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
B1LLH1_ECOSM          TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
B7N9X6_ECOLU          TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
A0A0H3ME76_ECO7I      TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
D3GY76_ECO44          TSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMASGFTSYEGGGISYN
A0A0H3H8H8_KLEOK      TSKLNGLPVVNHGVAACRRMTEALEKPVQVRHGTPDARLLAEISMASGFTSYEGGGISYN
E3G176_ENTLS          TSKLNGLPVVNHGVAACRRMTEALEKPIQVRHGTPDARLLAEISMASGFTSYEGGGISYN
A8AJ72_CITK8          TSKLNGLPVVNHGVAACRRMTEALEKPIQVRHGTPDARLLAEIAMASGFTSYEGGGISYN
A9MJK9_SALAR          TSRLNGLPVVNHGVAACRRMTEALEKPIQVRHGTPDARLLAEIAMASGFTSYEGGGISYN
B7LKN1_ESCF3          TSKLNGLPVVNHGVAACRRLTETLEKPLQIRHGTPDARLLAEISFASGFTSYEGGGISYN
F4N2Q4_YEREN          TSKLNGLPVVNHGVKACRRITESLSKPLQIRHGTPDARLLAEIAMASGFTSYEGGGISYN
A0A0H3NWG3_YERE1      TSKLNGLPVVNHGVKACRRITESLSKPLQIRHGTPDARLLAEIAMASGFTSYEGGGISYN
GLME_YERE8            TSKLNGLPVVNHGVKACRRITESLSKPLQIRHGTPDARLLAEIAMASGFTSYEGGGISYN
F8F1V4_TRECH          TSLLNGFPAVNHGVAECRRVTEAVSKPVQVRHGTPDARLLAEITLAAEFTAFEGGGISYN
B5YEV1_DICT6          KSLLNGFPAVNYGVKACREIIESVDVPVEIRHGTPDARLLAEITLAAGFTSFEGGGITYN
B8E0H4_DICTD          RSLLNGFPAVNYGVRACREIIESVDVPVEVRHGTPDARLLAEITLAAGFTSFEGGGITYN
K4LJT5_THEPS          RSLLNGLPAVNYGVKNCRRIIEATGVPVQVRHGTPDARLLAEITLAAGFTDFEGGGISYN
GLME_FUSNN            KSLLNGFPLINYGTKLARKIINDVEVPLQIKHGSPDARLLVEVALLSGFSAFDGGGISHN
A5CZJ8_PELTS          KPKLNGYPIINHGLKNNRKLVESVDGCLDPRCSRKANSQVAEMAFASGMNAMPCSFFAWF
                         :** * :. *    * :       :: : .      :  :   .       . .:  

GLME_HALMA            IPYTKRHDLATTIEHWQFVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAVMLVEGE
G0HQ33_HALHT          IPYTKRHDLATTIEHWQFVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAVMLVEGE
C7P171_HALMD          IPYTKGHSLEETITHWQFVDRLCGAYAERGVVVNREPFGPLTGTLVPPAIAIAVMLVEGL
L0JPW1_NATP1          IPYTKRHGLEETIEKWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAVMLVEGK
I7D074_NATSJ          IPYTKRHGLEETIEKWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAIMLVEGK
D3SSP0_NATMM          IPYTKRHGLEETIEKWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGQ
D2RRB9_HALTV          IPYTKRHGLEETIEKWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGQ
L0AMT1_NATGS          IPYTKRHGLEETIEKWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGQ
F8D6M9_HALXS          IPYTKRHGLEETIERWQFVDRLAGAYTERGVRINREPFGPLTGTLVPPSIAIAIMLIEGK
L0IBG1_HALRX          IPYTKRGDLATTIEHWQYVDRLAGVYTERGVRINREPFGPLTGTLVPPSIAIAIMIVEGL
GLME_HALSA            LPYTSAYDLETTIEYWQYVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAIVTIEGL
B0R7I4_HALS3          LPYTSAYDLETTIEYWQYVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAIVTIEGL
L0AHS6_NATGS          LPYTSKYSLEETIEYWQYVDRLAGAYTERGIRINREPFGPLTGTLVPPSIAIAVCIVEGL
D9QUW6_ACEAZ          IPYAKNVSIEQTLLDWQYVDRLIGYYEENGIKINREPFGPLTGTLVPPSVSHSVAIIEGL
L0KBW7_HALHC          IPYAKDVSIEQTLYDWQYVDRLVGYYQEQGVRINREPFGPLTGTLVPPSISHSIAIIEGL
E3DQY7_HALPG          IPYAKEVSIERTIYDWQYVDRLVGLYEENGISINREPFGPLTGTLVPPSVSHTVALVEGL
F4LS62_TEPAE          VPYAKKISIEQSIYYWQYVDRLVGIYEENGISLNREPFGPLTGTLVPPCISHSIGIIEGL
B8CYC4_HALOH          IPYAKSVAIEDTIRYWQYVDRLVGYYQEHGVNINREPFGPLTGTLVPPSISHSVAIIEAL
GLME_DESHY            IPYAKDVSIEKSIKYWQYVDRLVGMYEEKGVSINREPFGPLTGTLVPPSVSHGVAVIEGI
B8FVK4_DESHD          IPYAKDVSIEKSIKYWQYVDRLVGMYEEKGVSINREPFGPLTGTLVPPSVSHGVAVIEGI
I4ADL4_DESDJ          IPYAKEVSIENTIKYWQYVDRLVGMYEEKGVSINREPFGPLTGTLVPPSVSHGVAVIEGI
G7W9U0_DESOD          IPYSKDVSIESTIKYWQYVDRLIGLYEEQGVKINREPFGPLTGTLVPPSISHAVAVIEGV
J7IW58_DESMD          IPYSKDVSIESTIKYWQYVDRLIGLYEEQGVKINREPFGPLTGTLVPPSISHAVAVIEGI
I4DBP4_DESAJ          IPYSKDVSIESTIKYWQYVDRLIGLYEEQGVKINREPFGPLTGTLVPPAISHAVAVIEGI
F6DJY8_DESRL          IPYAKEVPLERSIRDWQYVDRLVGYYEEQGVSINREPFGPLTGTLVPPCISHSIAIVEAL
A4J7Z3_DESRM          IPYAKDVPLERSIRDWQYADRLVGYYEERGISINREPFGPLTGTLVPPCISHSIAILEAL
F6B848_DESCC          IPYAKDVPLERSIRDWQYVDRLVGYYEEQGISINREPFGPLTGTLVPPSISHSVAIVEAL
Q3AFA5_CARHZ          IPYAKEVPLRKSIEDWQYVDRLIGYYAEHGVLINRESFGPLTGTLVPPSVTIAINILELL
GLME_CLOCO            VPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEAL
Q890S2_CLOTE          IPYAKNVPIDKCLLDWQYCDRLVGFYEEQGVHLNREPFGPLTGTLVPPSMSNAVGITEAL
GLME_CLOTT            IPYAKSVPIDKCLKDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEAL
D8GIL2_CLOLD          VPYAKNVSIAKSLVDWQYCDRLVGFYEENGVSINREPFGPLTGTLVPPSTSNAVAIIEGL
E3H6D0_ILYPC          IPYAKSVSLERTLLDWQYVDRLIGWYEEQGVSINREPFGPLTGTLVPPSMSNVVQILECL
GLME_TREDE            VPYAKAVSIEHSIMCWQYADRLVGFYEENGVHLNREPFGPLTGTLVPPSVAIAVGVIEAL
A6TTM5_ALKMQ          IPYAKSISLEKTIRHWQYCDRVTGLYEEMGVEINREPFGPLTGTLVPPSMSNAVAIIEGL
F4KLG3_PORAD          IPYSKNFSLEKTIMYWQYTDRLVGMYEEAGVSINREPFGPLTGTLIPPCISNAVAVIETL
A0A1P8JN68_PREIN      IPYSKAHPVDQVIHHWQYADRLVGLYEEAGVSINREPFGPLTGTLIPPCISNTVAVIEAV
F5YRD2_TREPZ          IPYAKNADLEKTILDWQYADRLTGIYEEAGIPINREPFGPLTGTLVPPCISHGVAIIESL
GLME_SHIDS            IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
D3QMS0_ECOCB          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
GLME_ECO57            IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
B1LLH1_ECOSM          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
B7N9X6_ECOLU          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
A0A0H3ME76_ECO7I      IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
D3GY76_ECO44          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGL
A0A0H3H8H8_KLEOK      IPYAKRVTLEKSIRDWQYCDRLMGLYEEHGIRINREPFGPLTGTLIPPFMSHAVAIIEGL
E3G176_ENTLS          IPYAKRVTLEKSIRDWQYCDRLMGLYEEHGIRINREPFGPLTGTLIPPFMSHAVAIIEGL
A8AJ72_CITK8          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFMSHAVAIIEGL
A9MJK9_SALAR          IPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFMSHAVAIIEGL
B7LKN1_ESCF3          IPYAKRVTLEKSIRDWQYCDRLVGLYEEHGIRMNREPFGPLTGTLIPPFMSHSVAIIEGL
F4N2Q4_YEREN          IPYAKRVTLEKSIRDWQYCDRLIGVYEEHGIRINREPFGPLTGTLIPPFVSHAVAIIEGL
A0A0H3NWG3_YERE1      IPYAKRVTLEKSIRDWQYCDRLIGVYEEHGIRINREPFGPLTGTLIPPFVSHAVAIIEGL
GLME_YERE8            IPYAKRVTLEKSIRDWQYCDRLIGVYEEHGIRINREPFGPLTGTLIPPFVSHAVAIIEGL
F8F1V4_TRECH          IPYAKNVPLRSSIQYWKYVDRLVGLYEEAGVRINREPFGPLTGTLVPPCVSHAVAILEGL
B5YEV1_DICT6          IPYAKDVSLENSILYWQYVDYLVGLYAENGVIINRESFGPLTGTLVPPSISISIGIIEAL
B8E0H4_DICTD          IPYAKDVSLENSILYWQYVDYLVGLYAENGVIINRESFGPLTGTLVPPSISISIGIIEAL
K4LJT5_THEPS          IPYAKDVPLERSLLHWQYVDRLCGFYAEHGIIINREMFGPLTGTLVPPFISHVVGIIEAL
GLME_FUSNN            IPFSKSISLKDSLENWKYVDRLVGIYEENGIKINREIFSPLTATLVPPAISNSIQILETL
A5CZJ8_PELTS          GGYDKKATIEECIETAQYMGRLMGYYAENGVIINADCHGWLPNGVIPMSVNIATQIIEAL
                        : .   :   :   :: . : * * * *: :* : .. *.  ::*          *  

GLME_HALMA            LAATQGVRSLTLGYGQVGNLVQDVAALRALRKLGNEYLRDE----VTVTTVFHEWMGGFP
G0HQ33_HALHT          LAATQGVRSLTLGYGQVGNLVQDVAALRALRKLGNEYLRDE----VTVTTVFHEWMGGFP
C7P171_HALMD          LAATQGVRSLTLGYGQVGNVVQDVAALRALGALGEEYLPDD----VTVTTVFHEWMGGFP
L0JPW1_NATP1          LAATQGVRSITLGYGQVGNVVQDVAALNALKKLGNEYLPDE----VVVTTVFHEWMGGFP
I7D074_NATSJ          LAATQGVRSITLGYGQVGNVVQDVAALNALKKLGNEYLPDE----VVVTTVFHEWMGGFP
D3SSP0_NATMM          LAATQGVRSITLGYGQVGNVVQDVAALNALQKLGDEYLPDE----VVVTTVFHEWMGGFP
D2RRB9_HALTV          LAATQGVRSITLGYGQVGNVVQDVAALNALKKLGNEYLPDE----VVVTTVFHEWMGGFP
L0AMT1_NATGS          LAATQGVRSITLGYGQVGNVVQDVAALNALQKLGDEYLPDE----VVVTTVFHEWMGGFP
F8D6M9_HALXS          LAATQGVRSITLGYGQVGNVVQDVAALNALQKLGDEFLPDE----VVVTTVFHEWMGGFP
L0IBG1_HALRX          LAATQGVRSLTLGYGQVGNVVQDVAALRALRALGEEYLPNE----VCVTTVFHEWMGGFP
GLME_HALSA            LAATQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLPDS----VTVTTVLHQWMGGFP
B0R7I4_HALS3          LAATQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLPDS----VTVTTVLHQWMGGFP
L0AHS6_NATGS          LSATQGVRSITLGYGQVGNLVQDVAAIEAMKTLGVEYLPDE----VTVTTVFHQWMGGFP
D9QUW6_ACEAZ          LAAEQGVKNITLGYGQCGNLVQDVAALQSLEELAEEYLADYE--DVMLTTVFHQWMGGFP
L0KBW7_HALHC          LAAEQGVKNLTLGYGQCGNLVQDVAAIKSLEELAQEYLKDYD--NIMLTTVFHQWMGGFP
E3DQY7_HALPG          LAAEQGVKNLTLGYGQCGNLVQDVAALESLRELAAEYFADFK--DIMLTTVFHQWMGGFP
F4LS62_TEPAE          LAAEQGVRNITLGYGQCGNLIQDVAAVETLKELSAEYLKDY---DVMLTTAFHQWMGGFP
B8CYC4_HALOH          LAARQGVKYLSLGYGQNGNLIQDVAAIQSLRELARDYLDKFGYDDVMVTTVFHQWMGGFP
GLME_DESHY            LAVAQGVRSLTLGYGQCGNLLQDVAAIRTLPLLAAEYLSKLGYTDFDITTVFHQWMGGFP
B8FVK4_DESHD          LAVAQGVRSLTLGYGQCGNLLQDVAAIRTLPLLAAEYLNKLGYTDFDITTVFHQWMGGFP
I4ADL4_DESDJ          LAVAQGVRSLTLGYGQCGNLLQDVAAIRTLPLLAAEYLNKLGYSDFDITTVFHQWMGGFP
G7W9U0_DESOD          LAVAQGVRSLTLGYGQCGNLIQDVAALHTLPVLAEEYLAKLGLPKVMITTVFHQWMGGFP
J7IW58_DESMD          LAVAQGVRSLTLGYGQCGNLIQDVAALHTLPVLAEEYLAKLNLPKVMITTVFHQWMGGFP
I4DBP4_DESAJ          LAVAQGVRSLTLGYGQCGNLIQDVAALHTLPVITEEYLKKLGYPETMITTVFHQWMGGFP
F6DJY8_DESRL          LAAEQGVKSLTLGYGQCGNLLQDVAAVRSLEELAGEYLSRFGYNNAVITTVFHQWMGGFP
A4J7Z3_DESRM          LAAEQGVKSLTLGYGQCGNLTQDVAAIRSLEELADEYLSRFGYQDTVVTTVFHQWMGGFP
F6B848_DESCC          LAAEQGVRSITVGYGQCGNLIQDVAAIRSLEELAEEYLNRFGYQDVVLTTVFHQWMGGFP
Q3AFA5_CARHZ          LAVEQGVKSFTLGLGQCGNLNQDVAALHGMVELAEEYLKRFGFQDVDLTTVFHQWMGGFP
GLME_CLOCO            LAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFP
Q890S2_CLOTE          LAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFP
GLME_CLOTT            LAAEQGVKNITVGYGECGNMLQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFP
D8GIL2_CLOLD          LAAEQGVKNITVGYGECGNVIQDVAAMKALEQQIDEYLKKYGYNDVYITTVFHQWMGGFP
E3H6D0_ILYPC          LAAEQGVKNITLGYGQCGNLVQDVAAIKSLREQAEEYCAELGYENMMITTVFHQWMGGFP
GLME_TREDE            LAAEQGVKSITVGYGMCGNMTQDVAAVISLREITKDYMKKFGYKDMCITTVFHQWMGGFP
A6TTM5_ALKMQ          LAAEQGVKNLTLGYGQCGNLTQDVAAIRALEEQATEYFKEYGY-EIDLTTVLHQWMGGFP
F4KLG3_PORAD          LAAEQGVKDITVGYGQCGNIIQDVAAIRSLRELTNSYLKQYGYDDVRITTVFHQWMGGFP
A0A1P8JN68_PREIN      LAATQGVRDLTVGYGQCGNLIQDVAAIRSLDIMTRKYLDKFGYKDARVTTVFHQWMGGFP
F5YRD2_TREPZ          LAAEQGVKNITVGYGQCGNLLQDVAALQVLQSLTDEYLRAYGYGDVVVTTVLHQWMGGFP
GLME_SHIDS            LALEQSVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
D3QMS0_ECOCB          LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
GLME_ECO57            LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
B1LLH1_ECOSM          LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
B7N9X6_ECOLU          LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
A0A0H3ME76_ECO7I      LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
D3GY76_ECO44          LALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFP
A0A0H3H8H8_KLEOK      LALEQGVKSITVGYGQVGSLTQDIAAIKSLRELSHEYFGNYGFDDYELSTVFHQWMGGFP
E3G176_ENTLS          LALEQGVKSITVGYGQVGSLTQDIAAIQSLRELSHEYFQNYGFDDYELSTVFHQWMGGFP
A8AJ72_CITK8          LALEQGVKSITVGYGQVGSLTQDIAAIQSLRELSHEYFQNYGFDDYELSTVFHQWMGGFP
A9MJK9_SALAR          LALEQGVKSITVGYGQVGCLTQDIAAIQSLRELSHEYFQNYGFDDYELSTVFHQWMGGFP
B7LKN1_ESCF3          LALEQGVKSITVGYGQVGSLIQDIAAIKSLRELSHEYFHNYGYEDYELSTVFHQWMGGFP
F4N2Q4_YEREN          LALEQGVKSVTVGYGQVGNIVQDIAAIQSLRELAHEYFRANGYENYELSTVFHQWMGGFP
A0A0H3NWG3_YERE1      LALEQGVKSVTVGYGQVGNIVQDIAAIQSLRELAHEYFRANGYENYELSTVFHQWMGGFP
GLME_YERE8            LALEQGVKSVTVGYGQVGNIVQDIAAIQSLRELAHEYFRANGYENYELSTVFHQWMGGFP
F8F1V4_TRECH          LALEQGVVSLTLGYGQCGNLVQDVAAIISLRNLAQAYFSEAGFENVELTTVFHQWMGGFP
B5YEV1_DICT6          FAAEQGVKSFSVGYGQCGNVIQDAAAINVLDRLTKEYLASFGYYDVHITTVLHHFMGGFP
B8E0H4_DICTD          LAAEQGVKSFSVGYGQCGNIIQDTASINVLYRLTKEYLASFGYYDVHVTTVLHHFMGGFP
K4LJT5_THEPS          LAAGQGVKSIAIGYGQGGNLIQDAAALRTLARLGRSYLDRFGYSDVLLTTVFHQWMGGFP
GLME_FUSNN            LAVEQGVKNISIGVAQYGNITQDIASLLALKEHIQFYLDTFSFKDINISTVFNQWIGGFP
A5CZJ8_PELTS          IVIGQGAKCVMPQVNLQGCLAQDLADIRTVPKLYKKYIEKLGYKDIIISGVVGSQVPLYP
                      :   *..  .       * : ** * :  :      :          :: ..   :  :*

GLME_HALMA            --PDEARANGVISLGGATAAVAQPDKVITKSAQEFQGVPTKEANAAGLRTTRQLIDMMIE
G0HQ33_HALHT          --PDEARANGVISLGGATAAVAQPDKVITKSAQEFQGVPTKEANAAGLRTTRQLIDMMIE
C7P171_HALMD          --PDEARASGVIGLGGVTAAVARPDKVITKSPQEFQGVPTKEANAAGLRTTRQLIDMTIE
L0JPW1_NATP1          --PDEARANGVISLGGMTAAIAQPDKVITKSPQEFQGVPTKEANSAGLRTTRQVIDMAIE
I7D074_NATSJ          --PDEARANGVISLGGMTAAIARPDKVITKSPQEFQGVPTKEANSAGLRTTRQVIDMAIE
D3SSP0_NATMM          --PDEARANGVISLGGMTAAIAQPDKVITKSPQEFQGVPTKEANASGLRTTRQVIDMAIE
D2RRB9_HALTV          --PDEARANGVIGLGGMTAAIAQPDKVITKSPQEFQGVPTKEANSAGLRTTRQVIDMAIE
L0AMT1_NATGS          --PDEARANGVISLGGMTAAIAQPDKVITKSPQEFQGVPTKEANASGLRTTRQVIDMAIE
F8D6M9_HALXS          --PDEARANGVIGLGGMTAAIAQPDKVITKSPQEFQGVPTKEANAAGLRTTRQVIDMAIE
L0IBG1_HALRX          --PDEARANGVIGLGALTAAIARPDKVITKSPQEFQGVPTKEANAAGLRTTRQLLDMAME
GLME_HALSA            --RDEARAHGVIGLAGATAALVEPTKVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDE
B0R7I4_HALS3          --RDEARAHGVIGLAGATAALVEPTKVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDE
L0AHS6_NATGS          --ADEPRANGVIALGTAAAGIAEPDKIITKSPQEALGVPTADANAAGLRTTDQVLRMLSA
D9QUW6_ACEAZ          --QDEAQAFGVISWGAATAALGKATKVITKTPHEAMGVPTKEANAEGLRSTKQVINMLRD
L0KBW7_HALHC          --QDEAQSFGVISWGAATAALSKATKVIVKTPHEALGIPTKEANAEGLRATKQLINMLKN
E3DQY7_HALPG          --QDEAQAFAVISWGASTAALGNATKVITKTTHEALGIPTKEANAEGLKASKQVINMLRD
F4LS62_TEPAE          --QDEAQAFGVISWGAATAALSKATKVIVKTPHEAFGVPTKEANAEGLRATRQVINMLKD
B8CYC4_HALOH          --QDESKAYAVISWGAAAASLSRATKVIVKTPHEAMGIPTKEANAAGLKTTKQIVNMLQD
GLME_DESHY            --QDEAKAYGVISWGAAAAALGKATKVIVKSPHEALGIPTKEANAAGIRTTKQILNMLKD
B8FVK4_DESHD          --QDEAKAYGVISWGAAAAALGKATKVIVKSPHEALGIPTKEANAAGIRTTKQILNMLKD
I4ADL4_DESDJ          --QDEAKAYGVISWGAAAAALGKATKVIVKSPHEAFGIPTKEANAAGLRTTKQILNMLKD
G7W9U0_DESOD          --QDEAKAFGVISWGAATAALGKATKVIVKTPHEALGIPTKEANAAGIRTTKQILTMLKD
J7IW58_DESMD          --QDEAKAFGVISWGAVTAALGKATKVIVKTPHEALGIPTKEANAAGIRTTKQILTMLKD
I4DBP4_DESAJ          --QDEAKAFGVISWGAATAALGKATKVIVKTPHEALGIPTKEANAAGIRATKQVLSMLKD
F6DJY8_DESRL          --QDESKAFGVIGWGAATAVLAKATKVIVKTPHEALGIPTKEANAAGIRTTKQVLNMLKD
A4J7Z3_DESRM          --QDESKAFGVISWGAATAALAKATKVIVKTPHEAMGIPTKEANASGIKATKQILNMLKD
F6B848_DESCC          --QDESKAFGVISWGAATAALAKATKVIVKTPHEAMGVPTKEANAAGIRATKQVLNMLKD
Q3AFA5_CARHZ          --QDEARAFAVIAWGAVAAALAKANKVIVKTPHEALGVPTKEANAQGLKTTRQIVNMLKD
GLME_CLOCO            --QDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEG
Q890S2_CLOTE          --QDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANASGIKATKMALNMLEG
GLME_CLOTT            --QDESKAFGVIVTATTIASLAGATKVIVKTPHEAIGIPTKEANASGIKATKMALNMLEG
D8GIL2_CLOLD          --ADEAKAFGVISTGAATAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLSG
E3H6D0_ILYPC          --EDEAKAFGVISNASVTAALSGATKVIVKTPHEALGIPTKEANAEGIKATKMVLNLLEG
GLME_TREDE            --ADESRAYGLISLGSTTAALSGATKVIVKTPHEAFGIPTKEANAGGIKATKMVLNLLKG
A6TTM5_ALKMQ          --ADEAKSFGVISWGAATAALAGATKVIVKTPHEAMGIPTMEANAQGIRSTKQTLNLLKG
F4KLG3_PORAD          --QDEAKAFGVISWGSATAALAKATKVIVKTPHEAMGVPTKEANAAGLRATKQVISMLRD
A0A1P8JN68_PREIN      --QDEAQAFGVISWGSAAGALAKATKVIVKTPHEAMGIPTKEANAAGLRATKQVINMLKD
F5YRD2_TREPZ          --QDEAKAFAVISWGSTVAALAHATKVIVKTPHEAIGIPTMEANAQGLRCTKQIITMLGE
GLME_SHIDS            --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
D3QMS0_ECOCB          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
GLME_ECO57            --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
B1LLH1_ECOSM          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
B7N9X6_ECOLU          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
A0A0H3ME76_ECO7I      --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
D3GY76_ECO44          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNE
A0A0H3H8H8_KLEOK      --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLRASRQMLNMVSD
E3G176_ENTLS          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLKASRQMLNMVSD
A8AJ72_CITK8          --EDESKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLKASRQMLNMVSD
A9MJK9_SALAR          --EDESKAFAVISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLKASRQMLNMVSD
B7LKN1_ESCF3          --EDEAKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLKASRQMLNMVSE
F4N2Q4_YEREN          --EDESRAFAVISWGAAVAGMAGATKVITKSPHEAYGIPTAEANGQGLRASNQMLNMVRD
A0A0H3NWG3_YERE1      --EDESRAFAVISWGAAVAGMAGATKVITKSPHEAYGIPTAEANGQGLRASNQMLNMVRD
GLME_YERE8            --EDESRAFAVISWGAAVAGMAGATKVITKSPHEAYGIPTAEANGQGLRASNQMLNMVRD
F8F1V4_TRECH          --EDEAKAFGVISWGSVAGRLAGATKIIVKSPHEAMGIPTKEANAQGLRTSRQIVNMLSD
B5YEV1_DICT6          --EDEARAYAVISLGTIPAVLSKATKIIVKTPQEAVGIPSKEANAAALRNTRQVLQMLDC
B8E0H4_DICTD          --EDEARAYAVISLGTVPAVLSKATKVIVKTPQEAIGIPSKEANAAALRNTRQVLQMLDS
K4LJT5_THEPS          --QEEPRALGVIAWGAATAALAGANKVIVKTPHEAMGVPSLEANLAGLLCTRQVLRMLAE
GLME_FUSNN            --EEELKAYSLISYSTTIALFSKTNRIFVKNIDEYAKNSLGNTMINSLLLTKTILDIGNN
A5CZJ8_PELTS          YPQDVGSAFGYSTYTAMVAALGKVPIAFIKTIDEALGVPSTESHVQTYKACNWIFNVIRT
                         :   : .        . .      : *. .*    .   :           . :   

GLME_HALMA            QDIDLG-GIDEEQA-LIERETRALMDAIYEAGDG-DVAQGVINAFDSGALDVPFAPSDAA
G0HQ33_HALHT          QDIDLG-GIDEEQA-LIERETRALMDAIYDAGDG-DVARGVINAFDSGALDVPFAPSDAA
C7P171_HALMD          QDIDLA-GIDEEQR-LIEQTTRALMDAIDRHGDG-DVAQGVIRAFESGAMDVPFAPSDAA
L0JPW1_NATP1          QKIDID-GIEEEQD-LIERETRCLMDTIFEHGDG-DVVQGTLKAFDSGALDVPFAPSDSA
I7D074_NATSJ          QKIDID-GIAEEQD-LIERETRCLMDTIFEHGDG-DVVQGTLRAFDSGALDVPFAPSDSA
D3SSP0_NATMM          QEIDID-GIAEEQD-LIERETRCLMDTIFEHGDG-DVVQGTIKAFDSGALDVPFAPSDSA
D2RRB9_HALTV          QQIDID-GIAEEQD-LIERETRCLMDTIFEHGDG-DVVQGTIEAFDSGALDVPFAPSDSA
L0AMT1_NATGS          QNIDID-GIAEEQD-LIERETRCLMDTIYDHGDG-DVVRGTIEAFDSGVLDVPFAPSDSA
F8D6M9_HALXS          QDIDID-GIEEEQE-LIERETRCLMDTVLEHDDG-DVVQGTLKAFDTGALDVPFAPSDSA
L0IBG1_HALRX          QRLDID-GVESEQD-LIERETRSLLEAVFEHGEG-DVARGAVRAFETGALDVPFAPSESA
GLME_HALSA            QSITLD-GVDREQA-LIERSVRSLLDAVYEAGDG-DIARGTVRAFDAGTLDIPFPPSDAA
B0R7I4_HALS3          QSITLD-GVDREQA-LIERSVRSLLDAVYEAGDG-DIARGTVRAFDAGTLDIPFPPSDAA
L0AHS6_NATGS          QSVDLE-AVDRERE-LIERSVRSLLDAVYEVGDG-DVARGVVRAFDEGLLDVPFPPSEAA
D9QUW6_ACEAZ          QSLLSNDKLEEEKE-MIKQETKQILDRVFELGNG-DVAQGTVRAFEAGVLDVPFAPSKYN
L0KBW7_HALHC          QELVSNTKLAKEKE-MIKKETKQILERVFELGAG-DLAQGTVKAFQAGVLDIPFAPSKYN
E3DQY7_HALPG          QSLASNDKLEKEKE-MIKKETKQIMDHVLELGKG-DLAQGVVKAFKAGVIDIPFAPSRFN
F4LS62_TEPAE          QRMISSQELEKEKE-IIKRETRQILSKVYELGEG-DWAKGAVRAFEAGVLDVPFAPSQFN
B8CYC4_HALOH          QGLEQTHNMDEEKE-MIIRETEQILNRVLELGDG-DLVQGTVRAFSAGVMDIPFAPSKHN
GLME_DESHY            QSLPMTEELALEEK-MIREETRAILDRTLDLGEG-DMAVGAVRAFQAGVIDVPFAPSRYN
B8FVK4_DESHD          QSLPMTEELALEEK-MIGEETRALLDRTLDLGEG-DMAVGAVRAFQAGVIDVPFAPSRYN
I4ADL4_DESDJ          QSLPMTEDLALEEK-MIMEETRAILDRTLDLGEG-DIAVGTVRAFQAGVIDVPFAPSRYN
G7W9U0_DESOD          QTLPMTEELALEEE-MILAETRGILDRVLDLGEG-DAAVGTVRAFQAGVIDVPFAPSRYN
J7IW58_DESMD          QTLPMTPELALEEE-MILAETRAILDRVLDLGEG-DAAVGTVRAFQAGVIDVPFAPSRYN
I4DBP4_DESAJ          QTLPMTPELALEEQ-MILKETRAILDRVLTLGEG-DIAVGTVRAFQAGVIDVPFAPSRYN
F6DJY8_DESRL          QPLVESKELMEEKD-LIKAETRAILEKILEFGEG-DVAQGIIRAFQAGTIDVPFAPSRFN
A4J7Z3_DESRM          QPLMQSQELTEEKE-LIKAETRAILEKLLEFGEG-DIAVGTVRGFQAGVIDVPFAPSRYN
F6B848_DESCC          QTMPETKELAAEVE-LIKAETRSILDRLLEFGEG-DVAVGAVRAFQAGIIDVPFAPSRYN
Q3AFA5_CARHZ          QRFMVNEEYLLEKE-MVKKEARAIVERTLELGEG-DLVAGIERAFAAGVIDVPFAPSRFN
GLME_CLOCO            QRMPMSKELETEMA-VIKAETKCILDKMFELGKG-DLAIGTVKAFETGVMDIPFGPSKYN
Q890S2_CLOTE          QRMPMSKELETEMA-IIKAETKCILDKMFELGKG-DLAVGTVKAFETGVMDIPFGPSKYN
GLME_CLOTT            QRMPMSKELETEMA-IIKAETKCILDKMFELGKG-DLAVGTVKAFETGVMDIPFGPSKYN
D8GIL2_CLOLD          QRLPMSKDLEDEIS-VIKAEVKCILDKVFELGKG-DLAVGTVKAFETGVIDVPFAPSKYN
E3H6D0_ILYPC          QNISDSEELNAEVD-LIKKEVKAIMDKVAELGNG-DLAVGTVKAIEQGVIDIPFAPSMYN
GLME_TREDE            QRYPDSRVLAQEIE-LIKAETKCIMDKVYEIGGG-DLVEGTIKAFEAGVIDIPFAPSQYN
A6TTM5_ALKMQ          QRLSISKDLGMEKE-LIKAETKCILDKVFELGNG-DLAVGAVKAFETGVMDIPFAPSNYN
F4KLG3_PORAD          QSLIDIPVVEQESD-VIVRETKCILDKVFELGKG-DLALGTVAAFEAGVLDIPFAPSRYN
A0A1P8JN68_PREIN      QNFREIPAVVDESE-IIMQEMECMLNKVEELGKG-DWAVGTCAAIEAGVIDIPFAPSKYN
F5YRD2_TREPZ          Q-TVDTNSLMDEKV-IIAGETRCIVDKVFQLGDG-DIAKGAVRAFQAGVLDVPFAPSRYN
GLME_SHIDS            QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVL----------
D3QMS0_ECOCB          QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
GLME_ECO57            QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
B1LLH1_ECOSM          QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
B7N9X6_ECOLU          QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
A0A0H3ME76_ECO7I      QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
D3GY76_ECO44          QKFPPCPAVELEIE-LIKSEVRAVLNKVFELGNG-DIARGTVLAFEAGVLDVPFAPAACN
A0A0H3H8H8_KLEOK      QKFPPCAAVEQEVE-LIKSEVRAVLKKVFELGNG-DIARGTVLAFEAGVLDVPFAPASCN
E3G176_ENTLS          QKFPPCAAVEQEVE-LIKSEVRAVLKKVFELGNG-DVARGTVLAFEAGVLDVPFAPASCN
A8AJ72_CITK8          QKFPPCAAVEQEVE-LIKCEVRAVLKKVFELGNG-DVARGTVLAFEAGVLDVPFAPASCN
A9MJK9_SALAR          QKFPSCPAVDQEVE-LIKSEVRAVLKKVFELGNG-DVARGTVLAFEAGVLDVPFAPAACN
B7LKN1_ESCF3          QKFPPCPAVDQEVE-LIKCEVRAVLKKVFELGNG-DIARGTVLAFEAGVLDIPFAPSVCN
F4N2Q4_YEREN          QKFPPCVEVDREVA-LIKREVHAVMDKVLELGQG-DIAIGTVRAFEAGVLDVPFAPATCN
A0A0H3NWG3_YERE1      QKFPPCVEVDREVA-LIKREVHAVMDKVLELGQG-DIAIGTVRAFEAGVLDVPFAPATCN
GLME_YERE8            QKFPPCVEVDREVA-LIKREVRAVMDKVLELGQG-DIAIGTVRAFEAGVLDVPFAPATCN
F8F1V4_TRECH          QGMLDSQAVQREVA-LILRETRAILEGAFALSSGRDPEEAAVRAFEAGIIDVPFAPSNQN
B5YEV1_DICT6          QDFIDKNKVQEEEY-IIEREVRSILNTVYSVGEG-DFVLGTVRAFASGLLDVPFAPSRFT
B8E0H4_DICTD          QDFIDKNKLQEEEY-IIEREVRSILNSVYSIGEG-DLVLGTVRAFSSGLLDVPFAPSRFT
K4LJT5_THEPS          QRVPETPELAEEES-VIEREVREVFDRVLELGEG-DLAVGTVRAFEAGVLDIPFAPSRAA
GLME_FUSNN            QKINNYEEIIFEKE-QIKKETAQIIAKIFSRCDG-DLRKAIIEAFEYGVLDVPFAPSKYN
A5CZJ8_PELTS          QDFEIDNEAIRQEEKITEAEVTAILDKVLDMGDG-DVAVGAVKAVEAGVLDSPFSISIYA
                      *          :           :.        * *   .   ..  * :          

GLME_HALMA            KGAVLPARDDDGRVRIFEFADLALPDDIKEIHAARLGERAETEGRDQSFRMVADDVDAIS
G0HQ33_HALHT          KGAVLPARDDDGRVRIFEFADLALPDDIKEIHAARLGERAETEGRDQSFRMVADDVDAIS
C7P171_HALMD          AGAVLPARDDDGRVRMFEFGDLAVPDEIREIHENKLGKRAEREGRAQSFQMVADDVDAIS
L0JPW1_NATP1          KGAVLPARDDDGRVRIFEWADLEMDEDIKEIHKARLSRRADTEGRDQSFRMVADDVDAIS
I7D074_NATSJ          AGAVLPARDDDGRVRIFEWADLEMDDDIKEIHKARLSQRATTEGRDQSFRMVADDVDAIS
D3SSP0_NATMM          RGAVLPARDDDGRVRIFEWADLAMDDDIKEIHKARLSRRADTEGRDQSFRMVADDVDAIS
D2RRB9_HALTV          KGAVLPARDDDGRVRIFEWADLEMDDDIKEIHKARLSRRADTEGRKQSFRMVADDVDAIS
L0AMT1_NATGS          KGAVLPARDDDGRVRIFEWADLEMDDDIKEIHRARLSRRADTEGRDQSFRMVADDVDAIS
F8D6M9_HALXS          KGAVLPARDDDGRVRIFEWGDLAMDDDIKEIHKARLSRRADTEGRDQSFRMVADDVDAIS
L0IBG1_HALRX          KGACLPARDDDGRVRLFDFGDLAFDDEIKEIHAARLERRAETEDRSTSFHMVADDVDAIS
GLME_HALSA            AGDVLPARDDDGRVRLLKFGAVALDDETKRIHRARLDRRADTEGRELSFRMVADDVSAVS
B0R7I4_HALS3          AGDVLPARDDDGRVRLLKFGAVALDDETKRIHRARLDRRADTEGRELSFRMVADDVSAVS
L0AHS6_NATGS          AGDILPARDDEGRVRLLKFGDLALDEDIKRRHRADLETRARTEDRRPSFRMVADDVSAVS
D9QUW6_ACEAZ          AGNLLPARDDDGAVRFLNHGNLPFSDEVVEFHQEKLEARGKSEGREPNFQMVIDDIYAIG
L0KBW7_HALHC          AGNLLPARDDNGAVRYLNHGNLPFSDEVVEFNKQKLEARGEEEAREPSFQMVIDDIYAIG
E3DQY7_HALPG          AGKILPARDNEGAVRYLDHGNLPFTEEIVKFHQKKLEDRGKDEGREASFQMVIDDIYAVG
F4LS62_TEPAE          AGKILPARDNSGAVRFLNFGSIPFDDKIKEFHRRKLAERAKAENREVSFQMVIDDIYAIG
B8CYC4_HALOH          AGQVLPARDNQGAVRYLNFGNLPFSHDVKEYHREKLSERGQVEDREVDFQMVIDDIYAIG
GLME_DESHY            GGRILPARDSQGAVRVLDFGNLPFSEEIKEFHRERIARRGRDEGREPSFQMVIDDIYAIG
B8FVK4_DESHD          GGRILPARDSQGAVRVLEFGNLPFSEEIKEFHRERIARRGRDEGREPSFQMVIDDIYAIG
I4ADL4_DESDJ          AGRILPARDSQGAVRILDFGNLPFHEDIKEFHRERIALRGRDEGRDPSFQMVIDDIYAIG
G7W9U0_DESOD          AGKILPARDTSGAVRLLDFGNIPFDKRIKEFHRERIAQRGRDENRDPSFQMVIDDIYAIG
J7IW58_DESMD          AGKILPARDTSGAVRLLDFGNVPFDERIKDFHRERIAQRGRDEERDPSFQMVIDDIYAIG
I4DBP4_DESAJ          AGKILPARDTTGAVRVLDFGNLPFDNEIKDFHRERIAQRGQDEGRDPSFQMVIDDIYAIG
F6DJY8_DESRL          AGRLLPARDHQGAVRLLDFGNLPFGEEIKEIHREKIVQRGKTEGRDPSFQMVVDDIYAIG
A4J7Z3_DESRM          AGKLLPARDYYGAVRLLDFGNLPFGEDIKEIHREKIAQRGKTEGREPSFQMVIDDIYAIG
F6B848_DESCC          AGKILPARDYRGAVRLLDFGNLPFSEEIKDVHREKIGQRGKLEGRDPSFQMVIDDIYAIG
Q3AFA5_CARHZ          LGKILPARDDTGAVRILEFGNLPFDSEIREFHRERLKRRGEKEGREPSFQMVIDDIYAIG
GLME_CLOCO            AGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVG
Q890S2_CLOTE          AGKMMPVRDNLGCVRYLEFGNIPFTEEIKNFNRQRLQERAKYEGRDVSFQMVIDDIFAVG
GLME_CLOTT            AGKMMPVRDNLGCVRYLEFGNVPFTEELKNYNRERLAERAKFEGREVSFQMVIDDIFAVG
D8GIL2_CLOLD          AGKMMPARDNTGAVRYLHFGNVPFSQELKDFNQRKLQERGKFENREVSFQMTIDDIFAVG
E3H6D0_ILYPC          AGKMLPARDNQGKIRYLEVGNVPFSQKIVDFNKSALEERAEFEEREVGFQLTVDDIFAVS
GLME_TREDE            AGKVMPARDNDGCIRYLMPGNLPFTKDILDFNRGKLEERAKADKREVDFQMSVDDVYAVS
A6TTM5_ALKMQ          AGKILPARDNNGAVRYLEFGNIPMNKEIKDFNNQLLAERAKLEGREVSFQMVVDDIYAVG
F4KLG3_PORAD          AGKVLPARDDNGAVRILDTGNLPFTEDLKAFHRERLEERSRFENRPVSFQMVIDDVYAIG
A0A1P8JN68_PREIN      AGKVLPARDNQGAIRLLNMGNMPLSDDLVIFHRQKLEERAKAENRPVSFQMVIDDVYAIG
F5YRD2_TREPZ          AGKVLPARDNDGAIRLFDPGALPLTPEILEFHKQKMASRAKYEKRDASFQMVIDDVYAIS
GLME_SHIDS            -----------------EAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAVS
D3QMS0_ECOCB          AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAVS
GLME_ECO57            AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAVS
B1LLH1_ECOSM          AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARFEGRQPTFQMVVDDINAVS
B7N9X6_ECOLU          AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARFEGRQPTFQMVVDDINAVS
A0A0H3ME76_ECO7I      AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARFEGRQPTFQMVVDDINAVS
D3GY76_ECO44          AGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARFEGRQPTFQMVVDDINAVS
A0A0H3H8H8_KLEOK      AGKILPVRDNAGAIRVLEAGAVPLPKDILALHHDYVAERAHFEGRKPSFQMVVDDINAVS
E3G176_ENTLS          AGKILPVRDNAGAIRVLEAGAVPLPKDILALHHDYVAERAQFEGRKPSFQMVVDDINAVS
A8AJ72_CITK8          AGKILPVRDNSGAIRILEAGAVPLPKDILALHHDYVAERAHFEGRKPSFQMVVDDINAVS
A9MJK9_SALAR          AGKILPVRDNTGAIRVLEAGAVPLPQDILALHHDYVAERAHVEGRKPSFQMVVDDINAVS
B7LKN1_ESCF3          AGKILPVRDNTGAIRLLEAGCVPLPQDILALHHDYVAERARAEGRGPSFQMVIDDINAVS
F4N2Q4_YEREN          SGKMMPIRDNHGAIRVFDPGSVPLPKDVLTLHHDFIAERAKEEGRIPSFQMIIDDINAVS
A0A0H3NWG3_YERE1      SSKMMPIRDNHGAIRVFDPGSVPLPKDVLTLHHDFIAERAKEEGRIPSFQMIIDDINAVS
GLME_YERE8            SGKMMPIRDNHGAIRVFDPGSVPLPKDVLTLHHDFIAERAKEEGRIPSFQMIIDDINAVS
F8F1V4_TRECH          QGKILPMRDNEGFVRIFKAGALPLPQDVLDFHRERLEDRAKAEGRIVSLRMVTDDIYAIG
B5YEV1_DICT6          LGRVMPVRDNEGAVRFFDFGNLPFDEEIKSFHRKKLEERAKYEKREISFQMVLDDIYAIS
B8E0H4_DICTD          LGRVMPIRDNEGAVRFFDFGNLPFDEEIKDFHRKKIEERAKYEKREISFQMVLDDIYAIS
K4LJT5_THEPS          RGGIMPVRDASGAIRLLDTGNIPLSAEIKDFHRKKIEERGRQEKREPGLRMVIDDIYAIS
GLME_FUSNN            LGKMMPARDSEGMIRYLDIGNLPFCPLIEEFHNKKIKERSMKENREINFQMTIDDIFAMS
A5CZJ8_PELTS          KDKVLGIRDLNGACRYLEFGNLPIPEDIKDFHRQKVAERAKAEGREMNYKVSLEDFWAIS
                                         . : .       :   :  *.  : *    ::  :*. *:.

GLME_HALMA            DGKLIGRPGGDNSPAGGASDAD
G0HQ33_HALHT          DGKLIGRPTGDNSPAGGASDAD
C7P171_HALMD          DGKLIGR--------RGETDAD
L0JPW1_NATP1          DGKLIGRPQSQP-----QGDV-
I7D074_NATSJ          DGKLIGRPQSQP-----QGDV-
D3SSP0_NATMM          DGKLIGRPQN-------AGDV-
D2RRB9_HALTV          DGKLIGRPQS-------TGDV-
L0AMT1_NATGS          DGKLIGRPQPP------QGDA-
F8D6M9_HALXS          DGKLIGRPQSRSQ-STSQGDI-
L0IBG1_HALRX          NGRLIGRPSESSR-SGGVSDAD
GLME_HALSA            DGRLIGRPGDD-----------
B0R7I4_HALS3          DGRLIGRPGDD-----------
L0AHS6_NATGS          DGRLIGRPGGD-----------
D9QUW6_ACEAZ          KGRLVGRPRS------------
L0KBW7_HALHC          KGMLVGRPRN------------
E3DQY7_HALPG          QGELVGRPKKNKKEENSCK---
F4LS62_TEPAE          QGMLVGRMDSKIA---------
B8CYC4_HALOH          KGMLVGRPR-------------
GLME_DESHY            KGMLVGRPRS------------
B8FVK4_DESHD          KGMLVGRPRS------------
I4ADL4_DESDJ          KGMLVGRPKI------------
G7W9U0_DESOD          KGMLVGRPRG------------
J7IW58_DESMD          KGMLVGRPRA------------
I4DBP4_DESAJ          KGMLVGRPR-------------
F6DJY8_DESRL          KGMLVGKPR-------------
A4J7Z3_DESRM          KGMLVGKVR-------------
F6B848_DESCC          KGMLVGKPR-------------
Q3AFA5_CARHZ          KGMLVGKPRTK-----------
GLME_CLOCO            KGRLIGRPE-------------
Q890S2_CLOTE          KGRLIGRPE-------------
GLME_CLOTT            KGRLIGRPENK-----------
D8GIL2_CLOLD          QGVLIGRPKEK-----------
E3H6D0_ILYPC          KGKLIGRPE-------------
GLME_TREDE            SGVLVGRPAKR-----------
A6TTM5_ALKMQ          KGTLVGRPEIK-----------
F4KLG3_PORAD          KGFLVGRP--------------
A0A1P8JN68_PREIN      KGHLVGRPKNN-----------
F5YRD2_TREPZ          KGRLVGRPN-------------
GLME_SHIDS            HSKLIGRP--------------
D3QMS0_ECOCB          HSKLIGRP--------------
GLME_ECO57            HSKLIGRP--------------
B1LLH1_ECOSM          HSKLIGRP--------------
B7N9X6_ECOLU          HSKLIGRP--------------
A0A0H3ME76_ECO7I      HSKLIGRP--------------
D3GY76_ECO44          HSKLIGRP--------------
A0A0H3H8H8_KLEOK      HSKLIGRP--------------
E3G176_ENTLS          HSKLIGRP--------------
A8AJ72_CITK8          HSQLIGRP--------------
A9MJK9_SALAR          HSKLIGRP--------------
B7LKN1_ESCF3          HSQLIGRP--------------
F4N2Q4_YEREN          HSKLIGRP--------------
A0A0H3NWG3_YERE1      HSKLIGRP--------------
GLME_YERE8            HSKLIGRP--------------
F8F1V4_TRECH          KGRLVGRPQ-------------
B5YEV1_DICT6          KGRLVGRPR-------------
B8E0H4_DICTD          KGRLVGRPK-------------
K4LJT5_THEPS          KGRLVGKPR-------------
GLME_FUSNN            QGKLINKKSRE-----------
A5CZJ8_PELTS          KGQLIGKSSLKK----------
                       . *:.: