CLUSTAL format seed alignment for MF_01925

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B9IXD3_BACCQ          -------------------------------------MSIQNISFLG-AGSIAEAIIGGL
B7JLZ1_BACC0          -------------------------------------MSIQNISFLG-AGSIAEAIIGGL
Q818V7_BACCR          -------------------------------------MSIQNISFLG-AGSIAEAIIGGL
Q5KXH0_GEOKA          ----------------MQDGKPFSFGWIHQGKEEWNDEQRTNDRAHR-RGSMAEALIAGM
P5CR2_BACSU           ---------------------------------------MKKIGFVG-AGSMAEAMINGI
P5CR1_BACSU           ------------------------MRTKKRTKEMLPIFDQKKVAFIG-AGSMAEGMISGI
P5CR1_BACPZ           ------------------------MRTKKRTKEMLPIFDQKKVAFIG-AGSMAEGMISGI
A0A0H3DZV9_BACA1      ---------------------------------------------------MAEGMISGI
I0JJ37_HALH3          -------------------------------------MIKQTIAFLG-AGSMAEAMISGM
P5CR_STAAC            ----------------------------------------MKLVFYG-AGNMAQAIFTGI
Q2FY68_STAA8          ---------------------------------------------------MAQAIFTGI
B7HJN3_BACC4          ---------------------------------------------------MAEAIFSGL
Q81IX6_BACCR          ------------------------------------MLTKHRILFIG-AGRMAEAIFSGL
A7GKA6_BACCN          ------------------------------------MPKKQRILFIG-AGRMAEAIFSGL
B5YHK4_THEYD          -----------------------------------------MIGFIG-GGNMAEALIRGL
P5CR_MYCTU            -----------------------------------MLFGMARIAIIG-GGSIGEALLSGL
P5CR_MYCTO            -----------------------------------MLFGMARIAIIG-GGSIGEALLSGL
P5CR_MYCLE            -----------------------------------MLSSMARIAIIG-GGSIGEALLSGL
A0QR08_MYCS2          ---------------------------------------MSRIAIIG-GGSMGEALLSGL
Q82E92_STRAW          --------------------------------------MTQKVAVLG-TGKIGEALLSGM
Q9X8G1_STRCO          ------------------------MTPDHAHTPEGTEPMTQKVAVLG-TGKIGEALLSGM
D7CHR5_STRBB          ----------------------MTEKVTEKAPEKVTERGTEKVAVLG-TGKIGEALLSGM
B1VT80_STRGG          --------------------------------------MTQTVAVLG-TGKIGEALLSGM
A1SDY8_NOCSJ          ---------------------------------------MSQTAILG-AGVMGETLLSGL
P5CR_CORGL            ---------------------------------------MTTIAVIG-GGQIGEALVSGL
Q6NJK7_CORDI          ------------------------------------MFAMTSIAVIG-GGKIGEALISGL
C5CCT6_MICLC          ----------------------------------------MKLTILG-LGTMTGAILAGA
Q729L8_DESVH          --------------------------------------MQTTLGCIG-CGNMGSAILRGL
Q312A7_DESAG          -------------------------------------MKNTVLGCIG-CGNMGGAIMRGL
A0A0A7PX55_PSEPU      -------------------------------------MSKTRIAFIG-AGNMAASLIGGL
Q1IGC4_PSEE4          -------------------------------------MSKTRIAFIG-AGNMAASLIGGL
P5CR_PSEAE            -------------------------------------MSTPRIAFIG-AGNMAASLIGGL
Q8P757_XANCP          MASATRHRPPDTSAVSFLLLDGAAMTQPSSSTAVAAHGDVPVVAFVG-GGNMARSLIAGL
Q5H301_XANOR          ---MSPHQS---------LVKGAAMTTPVASTPSSSSSDVARIAFVG-GGNMARSLIAGL
B4SMF7_STRM5          -------------------------------------MAVDSITFIG-GGNMARSLIAGL
Q9PA08_XYLFA          ----MQHRRWTRA-----TATMIASFSSIAMPHVSLLPSPSPIAFIG-GGNMARSMIAGM
Q83A21_COXBU          -------------------------------------MNTSNITFIG-GGNMARNIVVGL
A9KDE3_COXBN          -------------------------------------MNTSNITFIG-GGNMARNIVVGL
D3RQW6_ALLVD          -------------------------------------MSTANIRFIG-GGNMATSLIAGL
D8KCA8_NITWC          -------------------------------------MSEQTLAFIG-GGNMAASLIGGL
B7J406_ACIF2          -------------------------------------MIPQNIVFIG-AGNMARALIAGL
A9IM43_BORPD          ------------------------------------MDTQLSIAFIG-GGNMASALASGL
Q7VYN6_BORPE          ------------------------------------MKNDLSIAFIG-GGNMAAALASGL
Q12GA3_POLSJ          -------------------------------MSTPNPGSNEHIAFIG-GGNMASAVIGGL
A2SMB0_METPP          -------------------------------MNHLSS----PIAFIG-GGNMASALIGGL
Q63R27_BURPS          ----------------------------------------MKIAFIG-GGNMAAALIGGL
G8QFZ1_AZOOP          ----------------------------------------MKITFLG-GGNMANALIGGL
Q46XH0_CUPPJ          ------------------------------------MLDTLTFGFLG-GGNMATALISGL
A0A0H3AHF1_VIBC3      -------------------------------------MEQRSIAFIG-AGNMARAIIAGL
Q9KUQ5_VIBCH          -------------------------------------MEQRSIAFIG-AGNMARAIIAGL
Q87LJ5_VIBPA          -------------------------------------MEHKKIAFIG-AGNMVRAIVSGL
Q7MHJ4_VIBVY          -------------------------------------MEHKNIAFIG-AGNMVRAIVSGL
Q5E7S2_ALIF1          -------------------------------------MEHRNIAFIG-AGNMTRSIIAGL
A0A0E1NSU5_YERPA      -------------------------------------MQHRNITFIG-AGNMARAIIAGL
Q666N4_YERPS          -------------------------------------MQHRNITFIG-AGNMVRAIIAGL
Q15PG7_PSEA6          -------------------------------------MQHRHIAFIG-AGNMSRSIISGM
Q8EBZ1_SHEON          -------------------------------------MSQQKICFIG-AGNMTRSIISGL
P5CR_HAEIN            -------------------------------------MQHKLIAFIG-GGNMAQAIILGL
Q5QY55_IDILO          ------------------------------------MNDIRNIAFIG-AGNMTQSIVGGM
Q5NER0_FRATT          ----------------------------------------MKICFIG-GGNMAAAMIAGM
Q21EI2_SACD2          -------------------------------MSETNLVNDAKIAFIG-AGNMAAAIIAGL
A0A0D5YKR7_ACIBA      ----------------------------------MLNIVQPNICFIG-SSNLSLALIGGL
V5VGV7_ACIBA          ----------------------------------MATAVNCNICFIG-GGNMAQALIGGL
Q4FVC0_PSYA2          ----------------------------------MSVLDNKKISFIG-GGNMAQALISGM
A9LZV3_NEIM0          ---------------------------------------------------MAAAIAGGL
Q5F5L8_NEIG1          ----------------------------------------MNVYFLG-GGNMAAAVAGGL
Q9K1N1_NEIMB          ----------------------------------------MNVYFLG-GGNMAAAVAGGL
Q3IWW7_RHOS4          --------------------------------MDLADLGRRGLVLLG-CGKMGSAMLEGW
A3PP43_RHOS1          --------------------------------MDLADLGRRGLVLLG-CGKMGSAMLEGW
A8IL23_AZOC5          ------------------------------MSLEVLKQLDGPIVLVG-AGKMGGALLEGW
Q89DI5_BRADU          ------------MVMGPGLRRDDTEFVVTTVANSTLQNITGTILLAG-AGKMGGAMLTGW
F7X1E2_SINMM          ----------------------------------MSIAVSGPIVLVG-AGNMGGAMLAGW
Q1MDM9_RHIL3          -------------------------------MPTKAFSSTHPVVLIG-AGNMGGAMLSGW
Q7CXL8_AGRFC          ----------------------------------MVYKASGPLVLVG-AGNMGGAMLSGW
Q2RP69_RHORT          ----------------------------MGCLTTDTPLAGVSLLLLG-CGKMGGALLNGW
C0RLT4_BRUMB          --------------------------------------MQDKVVLVG-CGNMGFAMLRGW
Q7WAQ8_BORPA          ---------------------------------------MRQALFLG-YGRMGAALGEAW
Q9AAU9_CAUVC          ---------------------------------------MTPILLLG-AGRMGGALIQGW
A9WFV0_CHLAA          ------------------------------------MLSDLPIAVIG-AGAMGEAIIGGL
Q88GE6_PSEPK          ---------------------------------------MKTIYMVG-AGHMGGAILLGL
D4GXS3_HALVD          ---------------------------------------MVRTSVIG-CGNMGSALLTGL
L9UT99_HALVD          ---------------------------------------------------MGSALLTGL
I7BLK2_NATSJ          ---------------------------------------------------MGSALIKGL
M1Y5X6_NATM8          ---------------------------------------MTRVSVIG-CGNMGGAFLKGL
Q18J37_HALWD          ---------------------------------------MITVSVIG-CGHMGSALLEGL
P5CR_ECOLI            --------------------------------------MEKKIGFIG-CGNMGKAILGGL
Q3Z524_SHISS          --------------------------------------MEKKIGFIG-CGNMGKAILGGL
B2U3Y8_SHIB3          --------------------------------------MEKKIGFIG-CGNMGKAILGGL
Q32JD5_SHIDS          --------------------------------------MEKKIGFIG-CGNMGKAILGGL
Q1RFF8_ECOUT          --MLGNPLLCRAFAFRHSSVYASASDYQNNEFHGRSEAMEKKIGFIG-CGNMGKAILGGL
A0A0R9P6Y1_SALNE      --------------------------------------MEKKIGFIG-CGNMGKAILGGL
Q8ZRF0_SALTY          --------------------------------------MEKKIGFIG-CGNMGKAILGGL
A5I6R1_CLOBH          --------------------------------------MNKVIGFIG-AGNMGQAMVGGI
A0A0E1L194_CLOBO      --------------------------------------MNKVIGFIG-AGNMGQAMVGGI
A7GIC3_CLOBL          --------------------------------------MNKVIGFIG-AGNMGQAMVGGI
Q7BYC2_BACCR          --------------------------------------MNKQIGFIG-CGNMGIAMIGGM
B7HAA7_BACC4          ---------------------------------------------------MGIAMIGGM
Q6HGV3_BACHK          --------------------------------------MNKQIGFIG-CGNMGIAMIGGM
A0A6H3AEP9_BACAN      --------------------------------------MNKQIGFIG-CGNMGIAMIGGM
Q81C08_BACCR          --------------------------------------MDKQIGFIG-CGNMGMAMIGGM
B3ZIM7_BACCE          --------------------------------------MDKQIGFIG-CGNMGMAIIGGM
Q97E64_CLOAB          --------------------------------------MDSKVGFIG-CGNMAQAIIKGM
Q8Y9X2_LISMO          ---------------------------------------MNRIGFIG-AGNMGTAMIRGL
A8MFQ7_ALKOO          --------------------------------------MEKRIGFIG-AGNMSSTIIRGL
A6TR68_ALKMQ          --------------------------------------MKQRIGFIG-TGNMATAIVQGL
Q8RA68_CALS4          ----------------------------------------MKIGFIG-AGNMGMALIKGI
B0K1A6_THEPX          ----------------------------------------MKIGFIG-VGNMGLALIKGI
P5CR2_RAT             ----------------------------------------MSVGFIG-AGQLACALARGF
Q7UTG7_RHOBA          ---------------------------------MNLEMQLTGLTVIG-GGQMARALVGGM
P5CR_METAC            -------------------------------------MENQKIGFIG-AGKMGSALMQGT
C0QCA7_DESAH          ------------------------------------MLSDQKIGFIG-SGNMGEALISGL
Q2RK62_MOOTA          --------------------------------------MDVKIGFLG-AGAMAEALIRGI
Q74A50_GEOSL          ------------------------------------MLKGSTLGFIG-GGNMAEAIIKGL
Q2S2A0_SALRD          ------------------------------------MLSNDTVAVIG-AGNIGHSLIGGM
D0MIZ9_RHOM4          -------------------------------MSTALQLANQTIAIIG-AGNIGRALIGGL
Q1IRM0_KORVE          ---------------------------MTSKAKSTSKLSQQTVAILG-LGKIGSILLQAM
B4S5S7_PROA2          -------------------------------------MQQLSIGFVG-TGRIARALISGL
Q8KG91_CHLTE          -------------------------------------MARLSIGFIG-TGRIAQALISGL
Q8F631_LEPIN          --------------------------------------MKYTIGIAG-CGNMGGAIYFSL
T2I2W1_BIFLN          -------------------------------------MSNPTIGFIG-YGNMAQAIAEGL
Q8G5S6_BIFLO          -------------------------------------MSNPTIGFIG-YGNMAQAIAEGL
A9KPJ8_LACP7          ------------------------------------MLENITIGFIG-FGNMAQALANGL
P5CR_TREPA            ----------------------------------------MNVGFLG-FGAMGRALAEGL
A5VID9_LACRD          ----------------------------------------MKITIIG-VGNMGSAIMKGL
Q831S6_ENTFA          ----------------------------------------MKIGFIG-AGSMGGAMIKGL
A3CMT2_STRSV          ----------------------------------------MNIGFIG-LGNMGGSLARLI
Q8DQ59_STRR6          ----------------------------------------MKIGFIG-LGNMGASLAKSV
A4VTT6_STRSY          ----------------------------------------MKIGFIG-LGNMGAALAQAV
D2BSY5_DICZ5          ---------------------------------------MSHIHFIG-AGQMTEAILRAA
A0A0H3FY46_ZYMMA      ---------------------------------------MSHIHFIG-SGQMSEAMIRAI
P5CR_SYNY3            --------------------------------------MSIQLGIIG-GGVMAEAILARL
A0A0H3K800_SYNP6      --------------------------------------MISSLGIIG-GGVMGEALLARL
Q7NMR1_GLOVI          ----------------------------------------MNLGIVG-GGAMAEALIAGL
Q2JKS6_SYNJB          -------------------------------------MERPLLSVIG-GGAMGSALLRRW
K9RUH8_SYNP3          ------------------------------------MTTSPQLGILG-CGVMAEAILSRL
Q8DJK6_THEEB          ------------------------------MPNNTIVPRVPALGIIG-CGRMAEAMLARL
A3PBB4_PROM0          --------------------------------------MTDKIAVIG-FGNIASAIVTPL
Q31CE2_PROM9          --------------------------------------MTDKIAIIG-FGNIANAIITPL
A9BE14_PROM4          --------------------------------------MPFSIGIIG-LGRMAQAILTPL
Q7VDI3_PROMA          --------------------------------------MACSLGVIG-LGRMAQVILQSL
A5GJ84_SYNPW          --------------------------------------MSFAVGVIG-MGRMAQALVRPL
F8KX73_PARAV          ----------------------------------------MKIAIIG-CGTIGSGMASQW
P5CR_THET2            ----------------------------------------MRLAFVG-LGKMGRSILKGA
Q5SK00_THET8          ----------------------------------------MRLAFVG-LGKMGRSILKGA
Q9RU71_DEIRA          ----------------------------------------MQLAIVG-VGKLGLSLLTGV
P5CR_SCHPO            ---------------------------------------MSGFCVLG-CGTMGKALLTGI
P5CR_NEUCR            -----------------------------MAAPQVKSSSELTMAVLG-CGTMGISILSGI
P5CR_HELPJ            ---------------------------------------MEILQFIG-YGNMAQAILEGS
E1S9U8_HELP9          ---------------------------------------MEILQFIG-YGNMAQAILEGS
E8QH86_HELP7          ---------------------------------------MEILQFIG-YGNMAQAILEGA
G2MAG2_HELPX          ---------------------------------------MEILQFIG-YGNMAQAILEGS
P5CR_HELPY            ---------------------------------------MEILQFIG-YGNMAQAILEGA
Q7M801_WOLSU          --------------------------------------MPPTLTLYG-YGKMALAIAKG-
Q0P9H8_CAMJE          -----------------------------------------MLYILA-NGSMATALAYG-
D1B3R8_SULD5          ----------------------------------------MKLLLIG-AGNMGGAMLQGL
D1B951_THEAS          -----------------------------------MDRRRLKVAILG-AGTIGGAV--AM
G7V6Z1_THELD          -----------------------------------MSGNKTTVTIIG-AGIIGGAI--AE
Q8U084_PYRFU          ----------------------------------------MKVAVIG-AGTIGSAV--AK
B6YWB3_THEON          ----------------------------------------MKVAVIG-AGTIGGAV--AK
Q9HLT6_THEAC          -----------------------------MIKIPQAGRDLETIAVIG-AGTIGSAI--SI
D0KSI7_SACS9          ------------------------------------MEGLT-IGIVG-AGKIGSAIIKAI
Q97ZT3_SACS2          ---------------------------------MKIMEDLT-IGILG-AGKIGSAIVRAI
A1S1A4_THEPD          ----------------------------------MTLEGLSSVAILG-AGKIGGAFVRQI
A2BJN9_HYPBU          ------------------------------------------------------------
B1L4V5_KORCO          -----------------------------------------------------------M
P5CR_AQUAE            ---------------------------------MHAIILTMRVGIVG-FGNMGQAFALCF
Q9WZ47_THEMA          ----------------------------------------MTIGIVG-VGNMGSIFAEKF
F9UL32_LACPL          ----------------------------------------MKIGFIG-AGNMGRAIIDGW
Q836Y3_ENTFA          ----------------------------------------MKISFIG-AGNMASAIAKGA
Q9CEF7_LACLA          ---------------------------------------MKTIGFIG-VGKMATAIISGL
A2RMV8_LACLM          ---------------------------------------MQTIGFIG-VGKMATAIISGL
Q1J8V8_STRPF          ----------------------------------------MKIGIIG-VGKMASAIIKGL
Q8A6I2_BACTN          ----------------------------------------MKITIIG-AGNIGSAVAACL
Q8A1A9_BACTN          ----------------------------------------MKIAIIG-AGNMGGSIARGL
A6GVR3_FLAPJ          ----------------------------------------MKIHIIG-GGNLGVAIALGI
K4IB55_PSYTT          ----------------------------------------MKIAIIG-TGNLGKSIAKGL
Q5KWY3_GEOKA          ----------------------------------------MNIGVIG-TGNMGTILIEAF
A0A1M6IFX8_9BACI      ----------------------------------------MNIGIIG-TGNMGNILIDAF
E1RHU1_METP4          ---------------------------------------MSRIGIIG-TGSMGSMLTRKF
F6D4H6_METPW          ---------------------------------------MEKIGFIG-YGSMGSMIINGI
B8E0D3_DICTD          ----------------------------------------MKLGIIG-GGMMGEAILSGI
Q04FB4_OENOB          ----------------------------------------MKYGFLG-AGNLSSAIIMGL
A0A0H3FVS2_ZYMMA      ------------------------MSDTASDSAPLLPKDQAPFWAFG-AGNMAGSMISCW
B9KWY6_RHOSK          ----------------------------------------MRIGIIGGAGWLGAALVRGL
Q83FH8_TROWT          ------------------------MLRSLPQSKPLDDLIGRTIAVIG-LGTMGAAIAEGI
                                                                                  

B9IXD3_BACCQ          LHANVVKGEQITVS-------------NRSNETRLQELHNKYGVKGTHN-----------
B7JLZ1_BACC0          LHANVVKGEQITVS-------------NRSNETRLQELHQKYGVKGTHN-----------
Q818V7_BACCR          LHANVVKGEQITVS-------------NRSNETRLQELHKKYGVKGTHN-----------
Q5KXH0_GEOKA          TKAFCHPA-HIVVA-------------NRQNRARLEELARQYGVCTAGC-----------
P5CR2_BACSU           LQSGITKPEHIYIT-------------NRSNDERLIELKETYSVRPCRD-----------
P5CR1_BACSU           VRANKIPKQNICVT-------------NRSNTERLTELELQYGIKGALP-----------
P5CR1_BACPZ           VRANKIPKQNICVT-------------NRSNTERLAELELQYGIKGASP-----------
A0A0H3DZV9_BACA1      VRANKIPKQNICVT-------------NRSNTERLTELQRKYGIQSVTL-----------
I0JJ37_HALH3          VESGNISADQIIVT-------------NRSNQDRLNEINDKYGVRTVLK-----------
P5CR_STAAC            INSSNLDANDIYLT-------------NKSNEQALKAFAEKLGVNYSYD-----------
Q2FY68_STAA8          INSSNLDANDIYLT-------------NKSNEQALKAFAEKLGVNYSYD-----------
B7HJN3_BACC4          LKTSKEYIEEIIVS-------------NRSNIEKLKQLQRRYNVSTTTD-----------
Q81IX6_BACCR          LKTSKEYIEEIIVS-------------NRSNIEKLKQLQHQYNVSTTTD-----------
A7GKA6_BACCN          LKTSKPYIEEIIVS-------------NRHNTKKLQQLQEQYPISTTTD-----------
B5YHK4_THEYD          VKEG----KKNIIV-------------SEPIDERRRYLENCYGVKTTPS-----------
P5CR_MYCTU            LRAGRQ-VKD--------------LVVAERMPDRANYLAQTYSVLVTS------------
P5CR_MYCTO            LRAGRQ-VKD--------------LVVAERMPDRANYLAQTYSVLVTS------------
P5CR_MYCLE            LRAGRQ-VKD--------------LVVAERMPDRARYLADTYSVLVTS------------
A0QR08_MYCS2          LRAGRQ-VKD--------------MVVAEKFPERAKYLADKYSVRVTS------------
Q82E92_STRAW          IRAGWA-PTD--------------LLVTARRPERAEELRARHGVTPVT------------
Q9X8G1_STRCO          IGAGWA-PAD--------------LLVTARRRERADELRARHGVTPVT------------
D7CHR5_STRBB          IRSGWS-PSD--------------LLVTARRPERAAELRARHGVEAVS------------
B1VT80_STRGG          IRAGWR-PAD--------------LLVTTRRGDRAQELRTRYGVESVT------------
A1SDY8_NOCSJ          VRAGRR-VDH--------------LLVGEKRPERAQELEERYGVAVVG------------
P5CR_CORGL            IAANMN-PQN--------------IRVTNRSEERGQELRDRYGILNMTD-----------
Q6NJK7_CORDI          VASGMS-PKD--------------IHVTNRNAERAQELKERYGVLTFLE-----------
C5CCT6_MICLC          LEAGAVRAED--------------VTATTRSAASAEKAASQHGVTVTSQERDE-----RA
Q729L8_DESVH          SGREGL---R--------------LVGCDPTGAKLAALADA-GVEGVAD-----------
Q312A7_DESAG          AGVEGL---Q--------------LAGFNRSAPKVEALRDEIGLEPAPD-----------
A0A0A7PX55_PSEPU      RAQGLD-ASQ--------------IRASDPGAETRSRIQAEHGIEAFE-----------D
Q1IGC4_PSEE4          RAQGLD-ASQ--------------IRASDPGAETRARIQAEHGIEAFE-----------S
P5CR_PSEAE            RAQGVP-AAQ--------------IRASDPGAEQRAKIAGEFAIDVVE-----------S
Q8P757_XANCP          LRQGAP-ASA--------------IRVAEPVAELRQALSADFGVQVFD-----------D
Q5H301_XANOR          IRQGMP-AAS--------------IRVAEPVAELRDALARDFGVQVVE-----------D
B4SMF7_STRM5          IRQGVP-AAH--------------IHVAEPVAALRESLAADFGVQVHD-----------N
Q9PA08_XYLFA          IRQGAP-STS--------------ICVIEPIAALRDALIADFNIKAVT-----------T
Q83A21_COXBU          IANGYD-PNR--------------ICVTNRSLDKLDFFKEKCGVHTTQ-----------D
A9KDE3_COXBN          IANGYD-PNR--------------ICVTNRSLDKLDFFKEKCGVHTTQ-----------D
D3RQW6_ALLVD          IADGYA-PQA--------------IQVSDPSPERRHALQASLGVRALA-----------T
D8KCA8_NITWC          VADGRD-AQA--------------IWVADPDRRKLDALHERFGVNTAP-----------D
B7J406_ACIF2          RRQGIA-GEQ--------------IQVHAPSSAHRDALAEEFGIRSLA-----------A
A9IM43_BORPD          AGKTCP-AGN--------------LHAIDPTPAVQD-AWRARGATAAG-----------A
Q7VYN6_BORPE          AGKVCP-AAN--------------IHVVDINADSHA-GWRARGMSAAA-----------A
Q12GA3_POLSJ          LKQGLP-AGQ--------------IQVVEPFAEQRARLVQQFGVAVSD-----------A
A2SMB0_METPP          LRSGVH-AHE--------------VLVVEPWAEQRERLKQAFGIVATE-----------Q
Q63R27_BURPS          VKRGVD-ASG--------------LLAVDVNEDARQRAQAQFGVRTAA-----------A
G8QFZ1_AZOOP          VNKGFA-AGD--------------IAVVELNADNRSKLEAAYGVRTFA-----------G
Q46XH0_CUPPJ          IARGVP-AGS--------------IRVVDPFPDAQQRLVRDLRVHVAG-----------A
A0A0H3AHF1_VIBC3      IASGYA-ADK--------------IIATAPSLTRREPLEAQYGIRTT-----------SD
Q9KUQ5_VIBCH          IASGYA-ADK--------------IIATAPSLTRREPLEAQYGIRTT-----------SD
Q87LJ5_VIBPA          VANGYP-AQN--------------IVATAPSEARRLPLEQDFGIRTT-----------SD
Q7MHJ4_VIBVY          VADGYP-ADK--------------ITATAPSETRRLPLEQQFGIQTT-----------SD
Q5E7S2_ALIF1          ISSGYP-KDK--------------ITATNPSTEKLDHLSQCYGIHTS-----------TD
A0A0E1NSU5_YERPA      VAGGYP-AKM--------------ISVCAPSAKNRDALATEFGVISS-----------DD
Q666N4_YERPS          VAGGYP-AKM--------------ISVCAPSAKNRDALATEFGVISS-----------DD
Q15PG7_PSEA6          CNSGYP-ADK--------------IIASNPSMPKLTALESDFSIQIT-----------QQ
Q8EBZ1_SHEON          IRSGYP-ASQ--------------VQATNPSQGKLDALATDFGVRVS-----------QD
P5CR_HAEIN            LKQGYP-AEQ--------------IIVNDPNEEKR-AFFANLDVATS-----------EN
Q5QY55_IDILO          CKSGYP-ADK--------------VWVSNPSDAKLEKMKSELGVNTS-----------ND
Q5NER0_FRATT          TSHGYK-SQD--------------IIVFDRNEHKCLNLIKKYNINTS-----------TS
Q21EI2_SACD2          VKQGVA-PAN--------------IEVCAPSEGNRARLASEYGVVHS-----------AD
A0A0D5YKR7_ACIBA      VLKGFQ-REK--------------INLIEEVKFENQIILKQ-------------------
V5VGV7_ACIBA          ISRGLP-PTR--------------ITVSDPVEQIRQLLQEKEVHVTQ------------D
Q4FVC0_PSYA2          VSCGIK-PNL--------------ITVSDPSSEAREQLAAKGLNTVDPM---------TD
A9LZV3_NEIM0          VKQGG---YR--------------IYIANRGAEKRERLEKELGVETS------------A
Q5F5L8_NEIG1          VKQGG---YR--------------IHIANRGAEKRERLGKELGVETS------------A
Q9K1N1_NEIMB          VKQGG---YR--------------IYIANRGAEKRERLEKELGVETS------------A
Q3IWW7_RHOS4          LGRGLA-LS---------------AVWVTDPR-PSDWLKSLAARGLHLN---------EA
A3PP43_RHOS1          LGRGLA-LS---------------AVWVTDPR-PSDWLKSLAARGLHLN---------EA
A8IL23_AZOC5          LGLGIE-PA---------------RLVVLDPNLNPEAAKALADKGVSAN---------PA
Q89DI5_BRADU          LAGGLD-PR---------------RVAVVDPHIAPEIS-ALAAKGVALN---------PD
F7X1E2_SINMM          LKSGVR-GS---------------DVLVIDPGPSPAMAKLLADSGVQHA---------TS
Q1MDM9_RHIL3          LKSGVP-GS---------------AVIVVDPGPSPAMLSTINEAGATHL---------TA
Q7CXL8_AGRFC          LKKGVP-GS---------------KVIVIDPRPSDAMRTTIAEAGATHS---------ES
Q2RP69_RHORT          LGRGLE-PS---------------AVHVVDP--LADLPAGVTRLTAEQA---------VA
C0RLT4_BRUMB          LDSGIL-KAG--------------DVHVVEPAEALRERAALAHVHVYAD---------AA
Q7WAQ8_BORPA          LRAGLL-AGI--------------DAV--DPG-----RDGAGLRARLVR---------GA
Q9AAU9_CAUVC          QAAGAF-DAA--------------DLIIRDPH-----VDAAAFAGAVVN---------PP
A9WFV0_CHLAA          LRNELV-AAD--------------QILASHPREDRRRELSHHYGIQTT----------HD
Q88GE6_PSEPK          KAYFKS-ATD--------------LRVIEIDTQ---RSNDWRAKGFET----------SS
D4GXS3_HALVD          WKAGGH---S--------------VVACDLDPDALAAVADYCEETTDD------------
L9UT99_HALVD          WKAGGH---S--------------VVACDLDPDALAAVADYCEETTDD------------
I7BLK2_NATSJ          WRAGNH---T--------------VIACDLDPDALESVADYVDRTTSD------------
M1Y5X6_NATM8          ARAGGH---H--------------LMAIDLDSEALAAVEAHADETSND------------
Q18J37_HALWD          ATVEGY---R--------------TIGYDVDPAVLDDVKSYCDRTTTD------------
P5CR_ECOLI            IASGQVLPGQ--------------IWVYTP-----SPDKVAALHDQF-GINAA-----ES
Q3Z524_SHISS          IASGQVLPGQ--------------IWVYTP-----SPDKVAALHDQF-GINAA-----ES
B2U3Y8_SHIB3          IASGQVLPGQ--------------IWVYTP-----SPNKVAALHDQF-GINAA-----ES
Q32JD5_SHIDS          IASGQVLPRQ--------------IWVYTP-----SPDKVAALHDQF-GINAA-----ES
Q1RFF8_ECOUT          IASGQVLPGQ--------------IWVYTP-----SPDKVTVLHDQF-GINAA-----ES
A0A0R9P6Y1_SALNE      IASGQVLPGQ--------------IWVYTP-----SPDKVAALHDQY-GINAA-----QS
Q8ZRF0_SALTY          IASGQVLPGQ--------------IWVYTP-----SPDKVAALHDQY-GINAA-----QS
A5I6R1_CLOBH          VNSKLVGPEN--------------IILSDL-----NEKALEAAKERF-GVRVT-----TN
A0A0E1L194_CLOBO      VNSRLVAPEN--------------IILSDL-----NEKALEAAKEKF-GVRVT-----TN
A7GIC3_CLOBL          VNSKLVAPEN--------------IILSDL-----NEKALESAKEKF-GVRVT-----TN
Q7BYC2_BACCR          IKKNIVSPDQ--------------IICSDL-----NVINLKNASNEY-GITIT-----TN
B7HAA7_BACC4          IKKNIVFPDQ--------------IICSDL-----NVINLKNASNEY-GITIT-----TN
Q6HGV3_BACHK          INKNIVSPNQ--------------IICSDL-----NVSNLKNASDKY-GITIT-----TN
A0A6H3AEP9_BACAN      INKNIVSPNQ--------------IICSDL-----NVSNLKNASDKY-GITIT-----TN
Q81C08_BACCR          INKNIVSSNQ--------------IICSDL-----NTANLKNASEKY-GLTTT-----TD
B3ZIM7_BACCE          LNKKIVSSNK--------------IMCSDL-----NTTNLENASEKY-GISIT-----TD
Q97E64_CLOAB          VKAKVVPNEN--------------IIVSNP-----SNEKLEKISKEC-GVLTT-----ND
Q8Y9X2_LISMO          AQANLVKREE--------------IIVGGR-----NLEKLKPLEAEFTGLQIT-----TD
A8MFQ7_ALKOO          VKSFEGMNQS--------------IYISNR-----TIKKAEKLCNQV-HINLC-----RT
A6TR68_ALKMQ          VKDYVGMENY--------------ISVNNRPTTQDKMSKAESLHKKF-NVNLE-----AS
Q8RA68_CALS4          LKSDFVEAED--------------LILYDP-----VREKVEGLEREF-GTVTA-----KD
B0K1A6_THEPX          LKADFIEAED--------------LILYDP-----VKEKTAGLEKEF-GVAIA-----KD
P5CR2_RAT             TAAGVLSAHK--------------IIASSP-----EMDLPTVSALRKMGVNLT-----RS
Q7UTG7_RHOBA          LESGCLKASE--------------LTIVHK-----TKSTGEWWSSKYSECTTT-----TD
P5CR_METAC            IKAGIVTPEN--------------IGASDVY-----EPFLKDLQAKL-GIRVS-----TD
C0QCA7_DESAH          VLSKVSLPEN--------------IICSDVR-----QDQLDAIQAKY-GIATT-----TE
Q2RK62_MOOTA          IQARLVQPER--------------LWAYDIR-----AARLKELEQRF-GLVAA-----AS
Q74A50_GEOSL          LAGGVAAADV--------------MVAEPV------AARREYLHGTY-GIDVC-----AD
Q2S2A0_SALRD          IGGNLIETED--------------VIATRRT-----GSALDALAEEFPGLRTT-----TD
D0MIZ9_RHOM4          LRGHELAPEQ--------------IRATRRN-----PAALEALQEEFPGIQTT-----TN
Q1IRM0_KORVE          LREGLLSPKR--------------VRATVNH-----ADKTAKLTQEF-GIQVG-----TD
B4S5S7_PROA2          VNDPAN---R--------------ICGYDKD-----PDAIAAVVKQF-GIEGT-----SS
Q8KG91_CHLTE          SHDPNI---V--------------ICGYDKM-----PDALHSVSLQY-GVNTE-----ES
Q8F631_LEPIN          KERYPTQVLG--------------YDPYIIS-------------NQK--IELI-----SS
T2I2W1_BIFLN          VAAGAVDGAD--------------IVACAAHY---DKLEKTTMKVGAKP---L-----HN
Q8G5S6_BIFLO          VAAGAVDGAD--------------IVACAAHY---DKLEKTTMKVGAKP---L-----HN
A9KPJ8_LACP7          LFKNVVKPRQ--------------IYASAKNY---EKLCKNTREKGMIP---C-----KS
P5CR_TREPA            VHAGALQAAQ--------------VYACALNQ---EKLRAQCTSLGIGA---C-----AS
A5VID9_LACRD          SRT---QNFT--------------LSAMNPVN---SRVTSLAEKLGFKL---V-----NT
Q831S6_ENTFA          LKAEAVKKEH--------------LYVKGGSS---GTAEALQKEWGFQL---V-----TD
A3CMT2_STRSV          AQDE-RFRSE--------------LLLANRSR---DKAEKIAAEVGGQP---V-----SN
Q8DQ59_STRR6          LQT--RTSDE--------------ILLANRSQ---AKVDAFIADFGGQA---S-----SN
A4VTT6_STRSY          SQQ---PDTQ--------------LLLSNHNP---AKAQALQEKVGGQL---F-----SN
D2BSY5_DICZ5          LQRGTLTPDK--------------VSLSDIDP---ERIETLKARYRLSNIQDL-----PN
A0A0H3FY46_ZYMMA      IKHKTASASD--------------ITAYDIRP---EREKELHDNYGITAFAKP-----KK
P5CR_SYNY3            IAEKTYAPEEIIVG-----------EPHGARRDYLQKTYQVRVSPDNQEAANV-------
A0A0H3K800_SYNP6      LAQGQVAATAVTVS-----------EPFAARCEFLNDRYGVRCVDDNAEAAQ--------
Q7NMR1_GLOVI          IAGAVYAPSEIAVS-----------DPVAERGEWLHRRYGVVAVTDNLVPAA--------
Q2JKS6_SYNJB          VAVGVYPAAQVALR-----------EPDLDKAVALQQELGIRLLADPSQAGE--------
K9RUH8_SYNP3          LAQGCYQPDQVMVT-----------TLSGQRQAWLAQTYGVKIAQANRELLQ--------
Q8DJK6_THEEB          LAKGLL-PDHVWVS-----------ARSPQRQQYLAHTYGVRVT-TNLEVAT--------
A3PBB4_PROM0          LDKKLIQPENVFCV-----------VNTEKSLEKIKNNYKHNINVYKSGSKES-------
Q31CE2_PROM9          FDKNLIQPERVYCV-----------VNSEKSLENIKKNYKYNINVYKSGSKES-------
A9BE14_PROM4          LERGDFKPDEVLGV-----------VGQRSSVKKVLGEFSQDLSIVSSDNPVS-------
Q7VDI3_PROMA          FEAGQFNPEEVFGV-----------VGKKNSVERVLHQFKSPFTVVDVNDKNA-------
A5GJ84_SYNPW          VEGGSLRGSDLIAV-----------VGREPSVAHLQSQLQSEITVISSSDPRM-------
F8KX73_PARAV          AK-----SHQLFLF-----------DRTFAKAEKLAQKLNADLSSNCAACPTI-------
P5CR_THET2            LERGFLRPEE--------------VGVLGRTPERSRELAEPFGVRPLT------------
Q5SK00_THET8          LERGFLRPEE--------------VGVLGRTPERSRELAEPFGVRPLT------------
Q9RU71_DEIRA          IARGVIAPQD--------------IGIIEANAARAQDIAAQTGVQVIT------------
P5CR_SCHPO            FDSIAENGND----VSDEIIIPNKFYACVKFPKEKEDVQKLFGDRVKV------VMGAKE
P5CR_NEUCR            LSSLSSIAQDPSPPPTNPPALPRHFIATVRSPSSVAKVESALSPLVKPSVSTLRVLQSTS
P5CR_HELPJ            HEILSKRFIL---------------EITGRNPEKIAPFLQEKNIQAQ---------IVPY
E1S9U8_HELP9          HEILSKRFIL---------------EITGRNPEKIAPFLQEKNIQAQ---------IVPY
E8QH86_HELP7          HETLSKRFIL---------------EITGRNPEKIAPFLQEKNIQAQ---------IVPY
G2MAG2_HELPX          HEILSKRFIL---------------EITGRNPEKIAPFLQEKNIQAQ---------IVPY
P5CR_HELPY            HEILSKRFIL---------------EITGRNPEKIAPFLQEKNIQAQ---------IVPY
Q7M801_WOLSU          ---LSGRFPL---------------EITGRNPQKIEELIALHGLNASP--------LFPH
Q0P9H8_CAMJE          ---LKDDYEI---------------CIVGRSIEKLQALAKEGFKTLL-------------
D1B3R8_SULD5          H--VKDITVV---------------EANATRASELKKLYPTITVVGE-------------
D1B951_THEAS          ALS-PHFDVC----------------ATRRRGSIAPGLIEAGVEEAPS------------
G7V6Z1_THELD          ALT-PHFNVI----------------ATRRKVHKLNGLEEKGVKVSQD------------
Q8U084_PYRFU          ALAESNYEVI----------------ATRRSIEKVKWLEKYGVKLEKD------------
B6YWB3_THEON          ALAEAGHSVI----------------ATRRSVEKAMWLEEHGVRVIRN------------
Q9HLT6_THEAC          SLAKAGYHVI----------------STRRRPDLNAGLKAYGITVTSD------------
D0KSI7_SACS9          RLKYPNVHVI----------------ATARKDETLRNVKDLEVETTKD------------
Q97ZT3_SACS2          RLKYPSIHVI----------------ATARKDETLRNVKDLEVETTKD------------
A1S1A4_THEPD          -LQKTGIRVY----------------ATGRRVETLRGAESLGAVATRD------------
A2BJN9_HYPBU          --------MV----------------ATARSQERLVLLREAGLEATSC------------
B1L4V5_KORCO          RALKDEWNVI----------------GTGRSDETIERVRRVGAIATKD------------
P5CR_AQUAE            SKKLG-----------------KENIIVTDKVQEKRNLATEMGIAFAS-----------D
Q9WZ47_THEMA          SKEAE-----------------RILLVEKDSEKLSRFNAPPYEIADLE-----------K
F9UL32_LACPL          LKQQAV--------------VPADIYIHSAHAASYQPYAQKNGLQACD-----------T
Q836Y3_ENTFA          LKKQFI--------------AAENLYFYDIQVEKTAAFAQEIGAHAVA-----------S
Q9CEF7_LACLA          DKN------------------KFKIIISGHNLTKTQKQAETLNVTATS-----------N
A2RMV8_LACLM          DKN------------------KFEIIISGHNLPKTKKQAEELDVKAAE-----------N
Q1J8V8_STRPF          KQT------------------PHELIISGSSLERSKEIAEQLTLPYAM-----------S
Q8A6I2_BACTN          AKGHLYNEKD--------------IIISTPHTDKLENLHKQFPAIRIMT----------E
Q8A1A9_BACTN          AKGSLIADSD--------------IIVSNPSAGKLEKLKEEFPGISTTL----------S
A6GVR3_FLAPJ          TKYTTNNHVT--------------VTKRNQ---ETISYLQE-KGIEISN----------N
K4IB55_PSYTT          LTNNAITSLY--------------LTKRDL---NDIQEFDGYKNVTLTT----------E
Q5KWY3_GEOKA          LDSGAVKADQ--------------LVITNRTLAKAFAIQRAHPGIAVV----------AD
A0A1M6IFX8_9BACI      LETRAVKPSC--------------LTIINRTPAKAYHIKEKYPSVHIA----------KT
E1RHU1_METP4          IESGKVSPGD--------------VFIYNRTPEKMNDLVNNYGAIGCA----------GN
F6D4H6_METPW          LSSKVLHPEE--------------VIIATRTESKLENLKKKYPEVEIA----------HK
B8E0D3_DICTD          IDSNFLKNDE--------------IIVSEPIEKRREYLRDKYNVEVISD-----------
Q04FB4_OENOB          LKAGFRSED-----------------IFVSSPHSAALLSKRLAINNVDE-----------
A0A0H3FVS2_ZYMMA      LNNGLNPKDM---------------LVIRPSGKPVAEGVKVVTSLPEDG-----------
B9KWY6_RHOSK          LERRLAAPAK--------------IAVLNRSGPRPDAFPQPVIWARDAD-----------
Q83FH8_TROWT          ARARKAMNEEIPRG----------QFYCTKREYKFERNSVITSESVVLYIQDD----PDA
                                                                                  

B9IXD3_BACCQ          KKELLTNTNILFLAMKPKDVAEALTPFKEDIHN-----------NLLIISLLAGVSTHSI
B7JLZ1_BACC0          KKELLTDTNILFLAMKPKDIAEALIPFKEYIHH-----------NVLIISLLAGVSTHSI
Q818V7_BACCR          KKELLTDANILFLAMKPKDVAEALTPFKEYINN-----------NVLIISLLAGVSTDSI
Q5KXH0_GEOKA          AQEAVKQADIVILAMKPKDVVEAMNAIAPTLRA-----------HQLILSLLAGITTETI
P5CR2_BACSU           KNEFFTHTDIIILAFKPKDAAESIDSIRPYIK------------DQLVISVLAGLTIETI
P5CR1_BACSU           NQLCIEDMDVLILAMKPKDAENALSSLKSRIQP-----------HQLILSVLAGITTSFI
P5CR1_BACPZ           NQICIEDMDVLILAMKPKDAESALSSLKTRIQP-----------HQLILSVLAGITTSFI
A0A0H3DZV9_BACA1      DNMPCEDIDVFILAMKPKDAESALSSLKTRIQP-----------HQLILSVLAGITTSFI
I0JJ37_HALH3          DDLDFSQVDQLILAMKPKDIDAVLEDLRYKLNP-----------NQVLVSVLAGISTSYM
P5CR_STAAC            DATLLKDADYVFLGTKPHDFDALATRIKPHITK-----------DNCFISIMAGIPIDYI
Q2FY68_STAA8          DATLLKDADYVFLGTKPHDFDALATRIKPHITK-----------DNCFISIMAGIPIDYI
B7HJN3_BACC4          WKQHVTSVDTVVLAMPPSAHEELLAELSPLIS------------NQLVVTVAAGIGPSYL
Q81IX6_BACCR          WKQHVTSVDTVVLAMPPSAHEELLAELSPLIS------------NQLVVTVAAGIGPSYL
A7GKA6_BACCN          WKECVKFVDTIILAMPPAAHEQLLTELAPLLT------------HQLVVTIAAGIGPSYL
B5YHK4_THEYD          NTDVVNLSEIIVLAVKPQNIKEVLEEIKDAVSE-----------RHTVVSIAAGIPLEFI
P5CR_MYCTU            AADAVENATFVVVAVKPADVEPVIADLANATAAAENDS-----AEQVFVTVVAGITIAYF
P5CR_MYCTO            AADAVENATFVVVAVKPADVEPVIADLANATAAAENDS-----AEQVFVTVVAGITIAYF
P5CR_MYCLE            VTDAVENAMFVVVAVKPTDVESVMGDLVQAAAVA-NDS-----AEQVLVTVAAGVTITYL
A0QR08_MYCS2          VADAAENAHYVVVAVKPADVEKVIGEIAEAAANAETDT-----AEQVFVTIAAGVGTAYY
Q82E92_STRAW          NAEAAKTADTLILTVKPQDMGTLLTELAPHVPTD-----------RLVISGAAGIPTSFL
Q9X8G1_STRCO          NAEAAKAADTLILTVKPQDMGTLLDELAPHVPAD-----------RLVISGAAGVPTSFF
D7CHR5_STRBB          NADAAKIADTLILTVKPQDMGALLDELAPHVPAD-----------RLVISGAAGIPTAFF
B1VT80_STRGG          NAEAAKNADILILAVKPQDMGKLLDELAPHVTAD-----------RLVISAAAGITTAFI
A1SDY8_NOCSJ          NAEAARKADTLALVVKPQDMGDLLEEIAGELRPG-----------QLVVSLAAGITTAFI
P5CR_CORGL            NSQAADEADVVFLCVKPKFIVEVLSEITGTLDNNS--------AQSVVVSMAAGISIAAM
Q6NJK7_CORDI          NIAAVDDVDMVFLCVKPQQVIPVVEEIADVVDNN---------TSTTIVSMAAGVTNAMI
C5CCT6_MICLC          NHAAVAEADIVLVGVKPKDMVATLTDLAPSLRPE-----------AVVVSVAAGVTSATM
Q729L8_DESVH          IAAAVRASDIVLVAVKPGQVGAVLGAAMPELDSG-----------KVVVSIASGVSVGSL
Q312A7_DESAG          AVALARRADIILLGVKPDQICDVIGQVRPVLDAG-----------KVLVSIAAGVSLEAM
A0A0A7PX55_PSEPU      NAQAIDGADVIVLAVKPQVMKTVCQALQPNLQD----------GQ-LIVSIAAGITCASL
Q1IGC4_PSEE4          NAQAIDGADVIVIAVKPQVMKAVCEALKPNLKA----------GQ-LVVSIAAGITCASL
P5CR_PSEAE            NAEAVADADVVVLSVKPQAMKAVCQALAPALKP----------EQ-LIVSIAAGIPCASL
Q8P757_XANCP          ARSAVEGAALWVLAVKPQVMSTVCTQLADLAQQ----------QHPLLLSIAAGITATQL
Q5H301_XANOR          ARTAVDAAATWVLAVKPQVLPTVCAQLAELAQA----------QQPLLVSIAAGITATQL
B4SMF7_STRM5          AADAAAQGNTWLLAVKPQVLRDVCQSLQALAQA----------NRPLVVSIAAGITSTQL
Q9PA08_XYLFA          ATEAATDTSTWVLAVKPQVMPDVCATLPLPVQP----------NTPLVISIAAGITTCKL
Q83A21_COXBU          NRQGALNADVVVLAVKPHQIKMVCEELKDILSE----------TKILVISLAVGVTTPLI
A9KDE3_COXBN          NRQGALNADVVVLAVKPHQIKMVCEELKDILSE----------TKILVISLAVGVTTPLI
D3RQW6_ALLVD          NAEALAGAETLVLCVKPQLAASVCAELAPLLDG----------QRPLIVSVMAGVPEQTL
D8KCA8_NITWC          NIQVAQDAAIIVLAVKPQQLRSVVTQLKNVATL----------SQPLWLTIAAGIGTPDV
B7J406_ACIF2          TAQSLPANSVVIYAAKPKQISAVLALWRQAFAD----------AGVLFLSVAAGIDSARI
A9IM43_BORPD          PDAALQACRVWIYAVKPQQLREAVAATRAWLQP-----------GTLVISVAAGIRADTL
Q7VYN6_BORPE          PDATLAGCRVWVYAVKPQHMREAVAGTRPWLRP-----------DTLIVSVAAGIRADTL
Q12GA3_POLSJ          PGASLSSAGLVVWAVKPQTFKEAAAQARAHTQA------------ALHLSVAAGIRSDSI
A2SMB0_METPP          ATPALADAGLVVWAVKPQIFREAAAPCAPHVGE------------AAQLSVMAGIRTDAI
Q63R27_BURPS          VDATLAGYDAIVLAVKPQVLKDVALALAPHLTT------------QLVVSIAAGIRGADL
G8QFZ1_AZOOP          AEAAAWDCDVIVLAVKPQSMKEAIAPIGPHLKD------------QLVVSIAAGLNLASL
Q46XH0_CUPPJ          PDAAFGGSDVLVLAVKPQQFREAAASLLPHLPATG--------AGNLIISVAAGIRLQDM
A0A0H3AHF1_VIBC3      NQQAAQQADVVVLAVKPQLMAEVCKPLQ--AVDF---------SGKLVISIAAGVSVKRL
Q9KUQ5_VIBCH          NLAAAQQADVVVLAVKPQLMAEVCKPLQ--AVDF---------SGKLVISIAAGVSVKRL
Q87LJ5_VIBPA          NMLAASEADVVVLSVKPQMMADVCKPLQ--SIDF---------SNKLVISIAAGINCSRL
Q7MHJ4_VIBVY          NFMAATQADVIVLSVKPQMMEEVCKPLQ--SVDF---------SNKLVISIAAGINCARL
Q5E7S2_ALIF1          NLQAAQQADVIVLAVKPQMMAMAAEPLQ--QIDF---------SNKLVISIAAGISAKRL
A0A0E1NSU5_YERPA      NIRESQKAEVVVLAVKPQLMADVCQQLQK-QVDF---------SDKLVLSIAAGVQVARF
Q666N4_YERPS          NIRESQKAEVVVLAVKPQLMADVCQQLQK-QVDF---------SDKLVLSIAAGVQVARF
Q15PG7_PSEA6          NEQAVQDADVIVLAVKPQLMEQMCSTLKD-NVSL---------NGKLFISIAAGIETSRL
Q8EBZ1_SHEON          NVSAAQDADVIILSVKPQLMEQVCQALQ--GIDM---------SNKLLITIAAGIKASRY
P5CR_HAEIN            NVGSAIKAEVVLLAVKPQMMAEVCSPLS--AVDF---------SDKLLISIAAGISTERL
Q5QY55_IDILO          NLEVVNNADAIVLSVKPQLMAEVCAHLRENVHNL---------TDKLIITIAAGIRIPKY
Q5NER0_FRATT          LLNTIKLADVLILAIKPQNMFELIKNIR--DTVT---------STQVIVTVAAGIQTSAY
Q21EI2_SACD2          NNAAAAKADILVLAVKPQMMREVCAQLA--EHRN---------PNCVVLSVAAGITCQSL
A0A0D5YKR7_ACIBA      KQHEVKKADIVVLLLDPKDLKAILAPLKK---WL---------ADKTIVSMMAGVNIQQL
V5VGV7_ACIBA          NTAAIQNADVVVLAVKPQVLANVLRPLKG---LL---------SDKLVISIIAGAEIKTI
Q4FVC0_PSYA2          AKAAVIDADIVVLAVKPQVMKAVVSAFAD---VL---------DKQLVISVAAGLSTDVL
A9LZV3_NEIM0          TLPELHSDDVLILAVKPQDMEAACKNIRT--------------NGALVLSVAAGLSVDTL
Q5F5L8_NEIG1          TLPELHSDDVLILAVKPQDMEAACKNIRT--------------NGALVLSVAAGLSVGTL
Q9K1N1_NEIMB          TLPELHSDDVLILAVKPQDMEAACKNIRT--------------NGALVLSVAAGLSVGTL
Q3IWW7_RHOS4          -LPD--EPAVVLVAVKPQMMSEALPGLAALGEGR-----------VLFLTVAAGTPISYY
A3PP43_RHOS1          -LPD--EPAVVLVAVKPQMMSEALPGLAALGEGR-----------VLFLTVAAGTPISYY
A8IL23_AZOC5          -YDAIPHAAVLILAVKPQVAPAVIASIRGIVGPK-----------SVVVSIMAGRTIGFM
Q89DI5_BRADU          -AKAAGQVETMVVAVKPQMFREAGAKLKPFVSEK-----------TSVVSIMAGTTIASL
F7X1E2_SINMM          -APAGGKAGAIFLAVKPQVMETVLPPLKGLVGPQ-----------TVIVSVAAGKTLGFI
Q1MDM9_RHIL3          -LPKDLKASVLFLAVKPQVMETVLPAVKSAVGPD-----------TVVVSVAAGKTLGFL
Q7CXL8_AGRFC          -VPEGVKAGILFVAVKPQMMDAILPSLKPLLGPE-----------TVVVSIAAGTTIATF
Q2RP69_RHORT          -LPP---PDVCLVAIKPQVVPEVLPAYAPLAQAG-----------TVFLSVAAGKTIDGL
C0RLT4_BRUMB          DLPADLQPRMVLVAVKPQMMANVLPAYKRFA-PA-----------STFVSVAAGIPVALF
Q7WAQ8_BORPA          DELPEQAYDLVVLAVKPAMAQQALRPVPPARLAR-----------ACLVSIMAGVPAGAL
Q9AAU9_CAUVC          LETLGAA-KTVLLAVKPQIWREAIADVVPHLAPD-----------AVIVSIAAGVRAADI
A9WFV0_CHLAA          NLAAAQWGRVVIFAVKPQQLRRVLPPLRGALRDD-----------DLAISVIAGATIASF
Q88GE6_PSEPK          RIQTLQPQDCVVLAVPPQQFENMLAANPVLCRHR-----------GPVVSVMAGITHATL
D4GXS3_HALVD          -VSRAADADVVFVAVKPDIVEAVLSELDLSPDQ-------------TLVTIAAGVPTSFV
L9UT99_HALVD          -VSRAADADVVFVAVKPDIVEAVLSELDLSPDQ-------------TLVTIAAGVPTSFV
I7BLK2_NATSJ          -VSEAAESDVVVVAVKPDIVGAVLDDLDLTPEQ-------------TLLSIAAGVSTDYV
M1Y5X6_NATM8          -TAAAADADVVVLAVKPDVAEAVLEGLDLSADQ-------------TLVTLAAGVSREFV
Q18J37_HALWD          -IDAISDSDIVALTVKPDIVPTVLAEINLHAEQ-------------TLMTAAAGVERSFV
P5CR_ECOLI            AQEVAQIADIIFAAVKPGIMIKVLSEITSSLNK-----------DSLVVSIAAGVTLDQL
Q3Z524_SHISS          AQEVAQIADIIFAAVKPGIMIKVLSEITSSLNK-----------DSLVVSIAAGVTLDQL
B2U3Y8_SHIB3          AQEVAQIADIIFAAVKPGIMIKVLSEITSSLNK-----------DSLVVSIAASVTLDQL
Q32JD5_SHIDS          AQEVAQIADIIFAAVKPGIMIKVLSEITSSLNK-----------DSLVVSIAAGVTLDQL
Q1RFF8_ECOUT          AQEVAQIADIIFAAVKPGIMIKVLSEITSSLNK-----------DSLVVSIAAGITLDQL
A0A0R9P6Y1_SALNE      AQEVAQVADIVFGAVKPGIMVKVLSEISSSLNK-----------DSLVVSIAAGVTLDQL
Q8ZRF0_SALTY          AQEVAQVADIVFGAVKPGIMVKVLSEISSSLNK-----------DSLVVSIAAGVTLDQL
A5I6R1_CLOBH          SNELAKEVDILVLSVKPNLYPIVIKGIKDSVKK-----------EVIVVTIAAGKALEDT
A0A0E1L194_CLOBO      SNKLAKEVDILVLSVKPNLYPIVIKGIKDSVKK-----------EVIVVTIAAGKALEDT
A7GIC3_CLOBL          SNELAKEVDILVLSVKPNLYPIVIKGIKDSVKK-----------EVIVVTIAAGKALEDT
Q7BYC2_BACCR          NNEVANSADILILSIKPDLYSSVINQIKDQIKN-----------DVIVVTIAAGKSIKST
B7HAA7_BACC4          NNEVANSADILILSIKPDLYSSVINQIKDQIKN-----------DVIVVTIAAGKSIKST
Q6HGV3_BACHK          NNEVANSADILILSIKPDLYTSVINQIKDQIKN-----------DVIVVTIAAGKSIKST
A0A6H3AEP9_BACAN      NNEVANSADILILSIKPDLYTSVINQIKNQIKNQIKN-------DVIVVTIAAGKSIKST
Q81C08_BACCR          NNEVAKNADILILSIKPDLYASIINEIKEIIKN-----------DAIIVTIAAGKSIEST
B3ZIM7_BACCE          NNEVAKNADILILSIKPDLYASVINEIKEEIKS-----------DVIVVTIAAGKSVKST
Q97E64_CLOAB          NKQVALKADIIVLSVKPNKYEKVISEIKDLVQQ-----------SVIIVAIAAGVSIEKT
Q8Y9X2_LISMO          TEKLVEQADIIILAVKPYTIPEILTSVKEKLTP-----------DKIIISVAAGVTIQDL
A8MFQ7_ALKOO          NVELAENSDIIFLGVKPHMYDGVLREISSYVTK-----------DQIIVSLAAGITTEDM
A6TR68_ALKMQ          NLDIVKKSKIIFLTVKPNIYPKVLEEIREFITS-----------EHVIVSVAAGVSIALI
Q8RA68_CALS4          NLELTEKSDVVIVAVKPNVYDEVLKEIREKVTE-----------EKIIITIAPGITIDHV
B0K1A6_THEPX          NIDLTEKSDIIILAVKPNIYDVVLEEIRAKVTD-----------KKIIIIIAPGITISHV
P5CR2_RAT             NKDTVRHSDVLFLAVKPHIIPFILDEIGADVQE-----------RHIVVSCAAGVTISSV
Q7UTG7_RHOBA          TVEAVAGAKVVMLAVKPHIIAEVLAVKNSAGKS-----------ADWSGKLIVSIAAGIG
P5CR_METAC            NAVIVRESDILILAVKPQTLSSVLSNLKNEITS-----------EKLVISIAAGVPLSTY
C0QCA7_DESAH          NLEVIERSDIVVYATKPQILHTVFKETAKALDM-----------SKLIISIAAGVPLAAI
Q2RK62_MOOTA          REELAAAADIIILAVKPQNVEAALTGL--QVKG-----------DKLVISIIAGVTLSRL
Q74A50_GEOSL          NGRVAAAADALVMAVKPQVFRGMVAALGPAGLD-----------GKLLISIMAGITTADM
Q2S2A0_SALRD          NVEAVQDASIILLTIKPQSRAEVITNIRDHVDR-----------DVLVISVLAGITSERL
D0MIZ9_RHOM4          NLLAVRDATLVVLAVKPQNAREVIEEIRAHVQP-----------EALILSVLAGLTTATI
Q1IRM0_KORVE          NAAAIKGADIILVALKPQQIGTVLTSLRDEIKP-----------NQLLISVAASVPTAYM
B4S5S7_PROA2          AAEVARDARIIILAVKPYQIGEVVEELRPHLTT-----------GHLLISVAAGITSEFI
Q8KG91_CHLTE          IESLARDAEIIVIAVKPYQMAEVLAELKPALHG-----------QHLIVSVAAGISTGFI
Q8F631_LEPIN          WDEFVSKSDLILVCVKPGKVIELLRQIKVPKKI---------------ISVAAGIHIDTI
T2I2W1_BIFLN          AAEVVAASDMVVIAIKPYRIESVIKPVIGAIADE----------DKFVVSIAAGWDLDKY
Q8G5S6_BIFLO          AAEVVAASDMVVIAIKPYQIESVIKPVIGAIADE----------DKFVVSIAAGWDLDKY
A9KPJ8_LACP7          ANELVEQCDIIIIAVKPFMVPEVITPIKELLQK------------KIVISVAAGYPFDKY
P5CR_TREPA            VQELVQKSEWIFLAVKPSQISTVLRDRQSFQGK-------------VLISLAAGMSCAAY
A5VID9_LACRD          NSEVVNLTPDIVILTTPAPITTAVAKELA-VLND----------HTIFISAAAGITHADL
Q831S6_ENTFA          YALFQECK--VIFIATGAKVVLPVLQELAPHFSN----------ESLLISVATGHTIQEA
A3CMT2_STRSV          -EEVFAQAEVIFLGIKPAQFADLLTEYQEILEKRE---------SLLLVSMAAGLSLELL
Q8DQ59_STRR6          -EEMFAEADVIFLGVKPAQFSELLSQYQTILEKRE---------SLLLISMAAGLTLEKL
A4VTT6_STRSY          -GQIAEQAEIIFLGVKPHLIQTVLSGLQDQISQNP---------SAIWISMAAGVPLDSL
D2BSY5_DICZ5          ---GLAAADHIVIGVRPQDDIAGVAQLIKAHAAP----------KASVISIIAGVTLAQL
A0A0H3FY46_ZYMMA      NIETLQKADIVVIGVRPQDDLKAVTADIAQNAKE----------KALIVSIVAGVTLAQF
P5CR_SYNY3            -------SEVLLLAVKPQVLDRVLASLAG--GANRP----------LVISILAGVSLQRI
A0A0H3K800_SYNP6      -------ADWVLLAIKPQVFDPAVAGLAN--LRSDR----------LILSILAGVPLAKL
Q7NMR1_GLOVI          -------APTLLLAVKPQAFAVVSNQVAA--HVRSE----------LVVSILAGVPLARL
Q2JKS6_SYNJB          -------SEILFLAVKPQLFPTVVAEMGR--LSATE----------LVISIMAGIPLQQL
K9RUH8_SYNP3          -------APTLLLSIKPQVFLELGQDL----HPPIPS-------SGLLLSIVTGISLSTL
Q8DJK6_THEEB          -------AETLLLAVKPQVLADIESELAD--TPVAQE-------MGVVLSIMAGIHSGRL
A3PBB4_PROM0          -KIIW-DCQYKLLSIKPQQLNYISEAYHIK-----NK-------DNLIVSILAGVSINRL
Q31CE2_PROM9          -EIIW-DCQFKLLSIKPQHLKDITEGDIIK-----NK-------NNLLVSILAGVSINKL
A9BE14_PROM4          -LEVW-NSPIQLLAVKPQQLNDIKEQVSQLEIVPDRP-------KPVLISILAGVNLKRL
Q7VDI3_PROMA          -IDVW-NTPVKILAVKPQQLNQVQEKCSKEFLAKLPA-------KPLLISILAGVKLKRL
A5GJ84_SYNPW          -HEAW-EAPVQLLAVKPQQLDQVAASVPT---PPAGA-------APLLISVLAGVTLERL
F8KX73_PARAV          -LEAIKDNDLILLAFKPQNLTSATESFSQ----ALTS-------NQLLASVLAGVTLDTL
P5CR_THET2            -RADLGMAERVLIAVQPRDFPALAPEIAHHRLGY--------------ISIMAGISTSVL
Q5SK00_THET8          -RADLGMAERVLIAVQPRDFPALAPEIAHHRLGY--------------ISIMAGISTSVL
Q9RU71_DEIRA          -PPQLAQVGRIVVSVQPRVFPEVAPWLAQENAGY--------------ISTMAGVSAGTI
P5CR_SCHPO            NAEMAAISNVLLLSCKPQAAEDVLNSPKMKEALK----------GKLILSILAGKTISSL
P5CR_NEUCR            NVSAAAEADIILLGCKPYMVSGLLSASGMKDALTVKHTEGHARSQKIIISICAGVTVPDL
P5CR_HELPJ            KDAIDIHQKFVFLLFKPYNLKDFN--YQGQAKSV--------------LSALAGVNFEAL
E1S9U8_HELP9          KDAIDIHQKFVFLLFKPYNLKDFN--YQGQAKSV--------------LSALAGVNFEAL
E8QH86_HELP7          KDAIDIHQKFVFLLFKPYNLKDFN--YQGQAKSV--------------LSALAGVGFEAL
G2MAG2_HELPX          KDAIDIHQKFVFLLFKPYNLKDFN--YQGQAKSV--------------LSALAGVGFEAL
P5CR_HELPY            KDAIDIHQKFVFLLFKPYNLKDFN--YQGQAKSV--------------LSALAGVGFKAL
Q7M801_WOLSU          DSPLDITDRHLLLCVKPYALSELS--FSGEAKGV--------------YSILAGVSIERL
Q0P9H8_CAMJE          YKDFNIEGKDVILAFKPYALENIAQMLKGQARIL--------------ISVLANVDFEKL
D1B3R8_SULD5          --IPSLEGFVVILAIKPQSFASLQ--TKGIAEGV--------------ISIMAGISLEKL
D1B951_THEAS          NREAAGWADLVILSVKPKQVMPVLEEIS-SVEGPR-----------LLISLAAAMPTWIL
G7V6Z1_THELD          NRDAARKGDVIILSVKPSQVISVLKEIK-EEAKGK-----------VIISFAAAIPTELM
Q8U084_PYRFU          NKKASREADIVIIAVKPNKVGKVLEEIK-EEVESK-----------IVISLAAGIPIKLL
B6YWB3_THEON          NVEAAEWAEVVFIAVKPNKVPGVLREIN-KAIGGK-----------LVISLAAGIPLKNL
Q9HLT6_THEAC          NVQAVTSADMVILTLKPADLVSEMKKLS-QILEGK-----------IVVSMAAAVPIRVI
D0KSI7_SACS9          NNYAVNKSDVIILSVKPQHFPTVLRQVGIESWKGK-----------IVISIMAGVKLSTL
Q97ZT3_SACS2          NNYAVNKSDVIILSVKPQHFPTVLRQVGIESWRDK-----------VVISIMAGVKLSTL
A1S1A4_THEPD          NDEAVRRSELVVIAVKPYHFPQLLSEVKQESWKGK-----------IVVSLMAGVKLATL
A2BJN9_HYPBU          NRCAVESADLVFISVKPYHFPIVARDIG-GIVAGK-----------PVVSVMAGVPVSLL
B1L4V5_KORCO          NSMACRIADVVILSVKPSHLRDLLPLSR--HLEGK-----------LVISVLAGVRTSML
P5CR_AQUAE            VKFLADNSDVVLVAVKPKDSQEVLQKLKDYKG--------------IILSIMAGVSIEKM
Q9WZ47_THEMA          VR----EADLIVLAVKPQDAPIVLSALKGFDG--------------ILLSIVAGLKIEEI
F9UL32_LACPL          NLAVAQAADVIVLAVKPNIALAALKEVQAALTGK------------WVITMVSGLSLADY
Q836Y3_ENTFA          PQEAITVADLVILAVKPQFVQAALLEAKEAILDKQ----------PLIVSIAAGTTIAEL
Q9CEF7_LACLA          HEELVQESDFIILSVKPQVLPSVLSKLINHLTKD-----------KTLISIAAGLTLSDL
A2RMV8_LACLM          HEELVQQSDFIVLSVKPQVLPSVLSQLINHLSKD-----------KTLISIAAGLTLSDL
Q1J8V8_STRPF          HQDLIDQVDLVILGIKPQLFETVLKPL--HFK-------------QPIISMAAGISLQRL
Q8A6I2_BACTN          NQYAISEADIIILAVKPCIVDEVLSPLR--FSRT-----------QILVSLVTGISISHL
Q8A1A9_BACTN          NTEAATGADVVILAVKPWFVESVMRELK--LKSK-----------QTLVSVAAGISFEEL
A6GVR3_FLAPJ          NTHNIQQADIIILTVKPHQAETVLKEISDKIKHK-----------TIL-SAVSGTTINTL
K4IB55_PSYTT          NLEAVKQSDILIFAVQPTHFEQILIDIKPYLTEN-----------HILISTITGFLISKI
Q5KWY3_GEOKA          AAEVIKQSSLVFLCVKPLDIHPLLQQLAPHWTNE-----------HYLVSITSPISVEQL
A0A1M6IFX8_9BACI      IPEVIEQSQLIFICVKPIDIYPILKKYAEHFSDE-----------TCLVSITSPISPSQL
E1RHU1_METP4          G-EVAGRSDIIFLCVGPDEVKDVLPEIRPFLDGK-----------KLIVSIVSDVPLKKL
F6D4H6_METPW          NIDLAQKCPKIFIFVDTGDLKGLIREINNFFMKD-----------VHIIYISAGLSFEDV
B8E0D3_DICTD          NKLIAKKAKYILIAVKPQNIKDVLKEISPNIDEN-----------KTIISIAAGVKISLI
Q04FB4_OENOB          -DRLLADCDLIVLAFLPEQLGSIVQQVGSEKFAN-----------KLIVSVLGSTSLKEL
A0A0H3FVS2_ZYMMA      -----STPATLLLGVKPQMLPQIAPALAPYITEK-----------TTLISILAGVELETL
B9KWY6_RHOSK          --DLVARSEAVVVSVRPEDWPALRLRAEV----------------RLLLSFMAGVPLDLL
Q83FH8_TROWT          NITVTQRSDLIIIAVRPEHIKHVLNSISPALDRK-----------KLIVSLAKDVNLSNL
                                                                                  

B9IXD3_BACCQ          RNLLQ--------KDVPIIRAMPNTSAAILKSATAIS-SSKHATKEHIQTAIALFETIGL
B7JLZ1_BACC0          KNLLQ--------KDVPIIRAMPNTSAAILKSATAIS-PSKHATAEHIQTAIALFKTIGL
Q818V7_BACCR          RKLLQ--------KDVPIIRAMPNTSAAILKSATAIS-PSKHATAEHIRTATSLFETIGL
Q5KXH0_GEOKA          ERLAG--------RNIPVVRAMPNTSAAVGLSATAIA-GGRFAAKEHLEVAKQLFETVGI
P5CR2_BACSU           QHYFG--------RKLAVIRVMPNTSAAIRKSATGFS-VSTEASKNDIIAAKALLETIGD
P5CR1_BACSU           EQSLL--------NEQPVVRVMPNTSSMIGASATAIA-LGKYVSEDLKKLAEALLGCMGE
P5CR1_BACPZ           EQSLL--------NQQPVVRVMPNTSSMIGASATAIA-LGKYVSEDLQKLAEALLGCMGE
A0A0H3DZV9_BACA1      EQSLH--------NQQPVIRAMPNTSSMIGASATAMA-LGNYVSGDSKKLAALLLKCMGE
I0JJ37_HALH3          EDRLN--------DGQEVIRVMPNTSSTLRESATAMC-PGHYTDMENVLVSKALLQSIGE
P5CR_STAAC            KQQLE--------CQNPVARIMPNTNAQVGHSVTGIS-FSNNFDPKSKDEINDLVKAFGS
Q2FY68_STAA8          KQQLE--------CQNPVARIMPNTNAQVGHSVTGIS-FSNNFDPKSKDEINDLVKAFGS
B7HJN3_BACC4          EARLP--------KGTPVAWIMPNTAAEIGKSISLYT-MGQSVNEIHQETLQLLLKGIGT
Q81IX6_BACCR          EARLP--------KGTPVAWIMPNTAAEIGKSISLYT-MGQSVNEIHQETLQLLLKGIGT
A7GKA6_BACCN          EKRLP--------HGTPVAWIMPNTAASIGQSISLYT-TGHFVNENHKETLQLLLKGIGT
B5YHK4_THEYD          QKYLK--------TDK-LIRAMPNLAAIVGEAMTVLA-LCECLEMKIIAPVRDIFMSVGK
P5CR_MYCTU            ESKLPAG--------TPVVRAMPNAAALVGAGVTALA-KGRFVTPQQLEEVSALFDAVGG
P5CR_MYCTO            ESKLPAG--------TPVVRAMPNAAALVGAGVTALA-KGRFVTPQQLEEVSALFDAVGG
P5CR_MYCLE            ESKLPAG--------TPVVRAMPNAAALVGAGVTVLA-KGRFVTGQQFEDVLAMFDAVGG
A0QR08_MYCS2          EAKLPAG--------SPVIRVMPNAPVIVGGGVSALA-PGRFATPEQLKEVSTLFDAVGG
Q82E92_STRAW          EERLAQG--------TPVVRVMTNTPALVDEAMSVIS-AGSHATAGHLAHAEEIFGAVGK
Q9X8G1_STRCO          EERLAPG--------TPVVRVMTNTPALVDEAMSVIS-AGTHATAAHLTHTEEIFGAVGK
D7CHR5_STRBB          EARLAVG--------TPVVRVMTNTPALVDEAMSVIS-AGSHATEEHLAHAEAIFGSVGK
B1VT80_STRGG          EDRLTPD--------TPVVRVMPNTPVLVDEGMSVIS-AGSHATGAHLATAEEIFGGVGK
A1SDY8_NOCSJ          EARVPEG--------VAVVRVMPNTPALVDEGMAAVS-PGSHCSEEHLAEAESLMASVGR
P5CR_CORGL            EESASAG--------LPVVRVMPNTPMLVGKGMSTVT-KGRYVDAEQLEQVKDLLSTVGD
Q6NJK7_CORDI          EESLAAG--------SPVIRVMPNTPMLVGKGMSVVA-PGRYADEDTVASLTQLLEAVGS
C5CCT6_MICLC          AAVLPAG--------QPIVRTMPNTPLTVGSGVVGMA-PGPGVTEEQTTAVRALFEGSGL
Q729L8_DESVH          REMSGGR--------CPVVRVMPNTPAMVGAGVFALCFEDATLDEVRRTLVKELFEALGR
Q312A7_DESAG          RSAAQGA--------APVVRVMPNTPAMVGRGIYGMCLDDPALSAEAATAVRNLFAAIGK
A0A0A7PX55_PSEPU      QSWVG-AR--------PVVRCMPNTPALLRQGVSGLY-ATAEVSGEQRQQAEQLLSAVGT
Q1IGC4_PSEE4          QAWLG-AI--------PVVRCMPNTPALLRQGVSGLY-ATQEVSAEQRQQAEQLLSAVGT
P5CR_PSEAE            EAWLGQPR--------PVVRCMPNTPALLRQGASGLY-ANAQVSAAQCEQAGQLLSAVGI
Q8P757_XANCP          ERWCGGTA--------AVVRAMPNTPALLGAGVTGLY-ANARVSAAQRTQATRLLESAGV
Q5H301_XANOR          QRWSGGDI--------AVVRAMPNTPALLGAGVTGLY-ANARVSDPQRQQATRLLDSAGV
B4SMF7_STRM5          ERWLGGNL--------PVVRAMPNTPALLGAGVTGLY-ATASVDAQQHARAEQVLASAGR
Q9PA08_XYLFA          KHWLGDTC--------AIVRAMPNTPALLGAGVTGLF-ATSHTTATQRTLAEELFNSVGK
Q83A21_COXBU          EKWLGKAS--------RIVRAMPNTPSSVRAGATGLF-ANETVDKDQKNLAESIMRAVGL
A9KDE3_COXBN          EKWLGKAS--------RIVRAMPNTPSSVRAGATGLF-ANETVDKDQKNLAESIMRAVGL
D3RQW6_ALLVD          QRWLGASL--------PIVRAMPNTPAMVQTGAIGLH-ASPEVDAEGRNRAETILRAVGL
D8KCA8_NITWC          EAWLGGPA--------PIVRAMPNTPALVQAGATALF-ANPHTSPNQRQTAESVLRAVGL
B7J406_ACIF2          AAELNPGS--------AIVRGMPNTPAQVGAGATALY-ARDSVSAAQRQTAGFIMSAVGE
A9IM43_BORPD          SGWLGEPGS----PWQNLVRCMPNTPALVGAGVTGLA-ALPGVDRAGRELAERLLGSVGQ
Q7VYN6_BORPE          AGWLGEPGQ----PWQRLVRCMPNTPALVGAGMTGLA-ALPGVTPQDRELAGQLLTSVGE
Q12GA3_POLSJ          AQWLGTE---------RVVRSMPNTPALVGKGMTALF-ARPAATAADRAAVERVIQTTGE
A2SMB0_METPP          VAATGNR---------CVVRAMPNTPALIGQGIAGLY-ARPEVDAGQRSSVEALLAPTGA
Q63R27_BURPS          SRWLGDYP--------RVVRTMPNTPALVGLGVTGLS-ALPGVDAAGRDLASKVLGAVGE
G8QFZ1_AZOOP          SRWLGGHR--------RLVRTMPNTPALIGAGVTGLY-ALPEVDAAGRAAAQRVLEAVGS
Q46XH0_CUPPJ          ERWLGGRT--------RLVRAMPNTPALSGMGMTGLA-APAGLSQHDRAIASAVAEAVGK
A0A0H3AHF1_VIBC3      NEMLA--------TQLNLVRVMPNTPSLVNLGMSGLY-APDSVSEADKAFTTQLMQSVGE
Q9KUQ5_VIBCH          NEMLA--------TQLNLVRVMPNTPSLVNLGMSGLY-APDSVSEADKAFTTQLMQSVGE
Q87LJ5_VIBPA          DEMLA--------TKLNLVRVMPNTPSQLGLGMSGLF-APEHVKEQDRAFAAELMQAVGK
Q7MHJ4_VIBVY          NEMLA--------TQLNLVRVMPNTPSQLGLGMSGLY-APVSVAEQDRHFAEQLMQAVGK
Q5E7S2_ALIF1          NEMFA--------SELNLVRVMPNTPALVGKGMSGLF-AVEHINEQDKCFASDLLSAVGE
A0A0E1NSU5_YERPA      YALLG--------NKLNLVRIMPNTPSLVGKGMSGLY-APEQVSAADRDFTTELMSAIGK
Q666N4_YERPS          YALLG--------NKLNLVRIMPNTPSLVGKGMSGLY-APEQVSAADRDFTTELMSAIGK
Q15PG7_PSEA6          SEMLG--------GQSNIVRTMPNTPSSLGKGMTGLF-APTQVSQEDKDYAGDLMAQVGE
Q8EBZ1_SHEON          SEYLA--------QPITLIRTMPNTPMQIGVGMTGLY-APQSLSDAQKAIAERLMSSGGE
P5CR_HAEIN            NALIP--------SVKSIVRVMPNTPALVGEGMAGLF-APKNTSENYRTFAQDLLGAVGR
Q5QY55_IDILO          REYLG--------ENIRIIRVMPNTPSLVGQGMSGLV-TDDSVDEADKNFVTEAFNGVGE
Q5NER0_FRATT          EELFN--------KEISFARTIPNTPSSLGYGATGIF-FNKVIAADKKDLVIDIMQTMGV
Q21EI2_SACD2          ANWLATPAQP--AENIAVVRTMPNTPSHIGLGACGLF-ASSAVAQTQKDQAQAIMAAVGL
A0A0D5YKR7_ACIBA      TSITGS---------KKIIRVISNPPVLTYTGTHVLI-GSDYLEPLDKEVIETIYSATGR
V5VGV7_ACIBA          SNLIDS---------ERIVRVMPNTPALVQTGAHGIY-ATDVVGASDRELTSQILAATGL
Q4FVC0_PSYA2          SSMLGGY--------RNIVRAMPNTPAMIQMGATGLY-GTDDISAEQKQLATAVMEASGL
A9LZV3_NEIM0          SRYLG--------GNRRIVRVMPNTPGKIGLGVSGMF-AEAEVSETDRRIADRIMKSVGL
Q5F5L8_NEIG1          SRYLG--------GSRRIVRVMPNTPGKIGLGVSGMY-AEAEVSETDRRIADRIMKSVGL
Q9K1N1_NEIMB          SRYLG--------GTRRIVRVMPNTPGKIGLGVSGMY-AEAEVSETDRRIADRIMKSVGL
Q3IWW7_RHOS4          ERTLGA--------ATPVIRAMPNTPAAVGRGITALV-GNAAASEAQMALAEDLLSAVGQ
A3PP43_RHOS1          ERTLGA--------ATPVIRAMPNTPAAVGRGITALV-GNGAASEAQMALAEDLLSAVGQ
A8IL23_AZOC5          QEALPR--------GAAIVRTIPNTPAAIGKGITVAV-ANAAVSPEARAATSALLGTVGP
Q89DI5_BRADU          QEVC----------GGAVVRAMPNTPAAIGRGITVAV-AAKNVSTAQRAVADALLRATGS
F7X1E2_SINMM          ERHLG---------EAATVRAMPNTPAMIGRGVTGAF-ANARVSEAQRALVHDLLKVSGP
Q1MDM9_RHIL3          EKHLG---------KAAMVRAMPNTPAMVGRGVTGAF-ANSGVSDPQRERVHSLLRVSGP
Q7CXL8_AGRFC          VSHFG---------AVAAVRAMPNTPAMVGRGVTGAY-ANDLVTAELKTVVDGLLKVSGP
Q2RP69_RHORT          SGLLGG--------DAAVVRAMPNTPAAVGRGASVLC-ANARVPAPTRALCETLMAAVGT
C0RLT4_BRUMB          ESHLGK--------DVAVIRCMPNTPAAIGKGMLVTF-KNANVSDANEAFVTSLLKTSGK
Q7WAQ8_BORPA          RQALQP--------PRPVARAMPNTPVMAGQGCTGLY-GGDDVAPAQRAAIGRLFEAVGA
Q9AAU9_CAUVC          SQAFGG---------RRVARVMPTTAVAIGQGAASLY-ADDAEALARARA---LFAPLAA
A9WFV0_CHLAA          AEALDH---------QAVVRSMPNTPAQIGCGMTVWT-AAPAVNERQRGWAATVLGALGR
Q88GE6_PSEPK          VRLLGH---------DAVVRAIPNTPSEVAQGVTMYY-APSDADAALIDSARQIFDVIGL
D4GXS3_HALVD          EARTDA----------RVVRIMPNLAAETRDM------AAAATGD-LTDEVRELLSDVGE
L9UT99_HALVD          EARTDA----------RVVRIMPNLAAETRDM------AAAATGD-LTDEVRELLSDVGE
I7BLK2_NATSJ          DARTDA----------NVVRIMPNLAAETRDM------AAAVTAEGITDEVRTLLDDVGE
M1Y5X6_NATM8          AGRTDA----------SVVRIMPNLAAETGDM------AAAATTEGLTDEVRELLEDLGA
Q18J37_HALWD          SNQTDA----------TVIRLMPNLAASLREM------AAAVAWDEPDPAVETMLSDLGS
P5CR_ECOLI            ARAL--------GHDRKIIRAMPNTPALVNAGMTSVT-PNALVTPEDTADVLNIFRCFGE
Q3Z524_SHISS          ARAL--------GHDRKSIRAMPNTPALVNAGMTSVT-PNALVTPEDTADVLNIFRCFGE
B2U3Y8_SHIB3          ARAL--------GHDRKIIRAMPNTPALVNAGMTSVT-PNALVTPEDTADVLNIFRCFGE
Q32JD5_SHIDS          ARAL--------GHDRKIIRAMPNTPALVNAGMTSVT-PNALVTPEDTADMLNIFRCFGE
Q1RFF8_ECOUT          ARAL--------GHDRKIIRAMPNTPALVNAGMTSVT-PNALVTPEDTADVLNIFRCFGE
A0A0R9P6Y1_SALNE      ARAL--------GHDRKIIRAMPNTPSLVNAGMTSVT-PNALVTPEDTADVLNIFRCFGE
Q8ZRF0_SALTY          ARAL--------GHDRKIIRAMPNTPSLVNAGMTSVT-PNALVTPEDTADVLNIFRCFGG
A5I6R1_CLOBH          ETMF--------GKRIKIVRVMPNTPALVGEGMAAVC-PNDLVSKEEAEEVISIFESFGK
A0A0E1L194_CLOBO      ETMF--------GKRIKIVRVMPNTPALVGEGMAAVC-PNDLVSKEEAEEVISIFESFGK
A7GIC3_CLOBL          ETMF--------GKRIKIVRVMPNTPALVGEGMAAIC-PNDLVSKEETEQVISIFESFGK
Q7BYC2_BACCR          ENEF--------GRKLKVVRVMPNTPALVGEGMSALC-FNEMVTEKDIKEVLNIFNIFGQ
B7HAA7_BACC4          ENEF--------GRKLKVVRVMPNTPALVGEGMSALC-FNEMVTEKDIKEVLNIFNIFGQ
Q6HGV3_BACHK          ENEF--------DRKLKVIRIMPNTPVLVGEGMSALS-FNEMVTEKDIKEVLTIFNIFGQ
A0A6H3AEP9_BACAN      ENEF--------DRKLKVIRVMPNTPVLVGEGMSALS-FNEMVTEKDIKEVLNIFNSFGQ
Q81C08_BACCR          ENAF--------NKKVKVVRVMPNTPALVGEGMSALC-PNEMVTEKDLEDVLNIFNSFGQ
B3ZIM7_BACCE          EDSF--------DTKLKVVRVMPNTPALVGEGMSALC-PNEMVTEKDLEDVLNIFNSFGQ
Q97E64_CLOAB          RIMFK-------NSNIRVVRAMPNTPALVGEAMTAIS-PCEEIDKGELKNVTEIFESFGK
Q8Y9X2_LISMO          EELT--------SAKTKIVRVMPNTPALVGEAMSSVS-PNTNVTSEELKEVTAIFTSFGE
A8MFQ7_ALKOO          GEYF--------KEPMKIIRIMPNVPVSVGEGMIALS-SNGNVTGEEVDFVVQLLSSVGK
A6TR68_ALKMQ          EGFF--------DKPVKVIRTMPNTPVFVGEGMTAVT-PNNYVTDDELRTVVEIFSSMGE
Q8RA68_CALS4          KKLL---------GRGKIVRTIPNTPALIGEGITAVT-YSEEVKEEDKELVRKIFSTCGE
B0K1A6_THEPX          KDIL---------KAGKIVRTIPNTPALIGEGVTAIS-YSQEIQQEDKEIVEKIFKTCGE
P5CR2_RAT             EKKLMA-F----QPAPKVIRCMTNTPVVVREGATVYA-TGTHALVEDGKLLEQLMSSVGF
Q7UTG7_RHOBA          LDKLID-G----VGHDRVVRVMPNTPSLVGEGASGFC-VSGGVSDDDVQLIETMLNSVGI
P5CR_METAC            EDALL--------EGTRVVRVMPNIAATVSEAASGIA-PGKNATPEDLKAALEIFSAVGT
C0QCA7_DESAH          ESCLQ--------KKLRLIRVMPNICAFVRESATAIA-AGKNVLKGDVELAKAVFDSVGK
Q2RK62_MOOTA          AGYLG--------D-VPLVRVVPNTPALVGAGVSALA-AGARVGQEDLEKALAIFRSVGE
Q74A50_GEOSL          EEVCG--------SAARVIRVMPNTPALVLEGASTLC-RGRNATDDDLFFATGIFDLVGT
Q2S2A0_SALRD          QLGFG--------QDQPVIRAMPNTPALVDAGATALS-PGTYATDAHLEKARAIFEAVGN
D0MIZ9_RHOM4          ERLFG--------RPLPIVRAMPNTPALVDEGATALA-AGAHARPEHLELCRQIFEAVGK
Q1IRM0_KORVE          EERLA--------AKVPIIRAMPNTPSMLGAGMTGIC-KGAHATAAQLDLAQAMFNTVGR
B4S5S7_PROA2          RQHSI--------DAMRVIRVMPNTPAFTGQGMTALS-KGIMATQEDIALATTMFSAIGR
Q8KG91_CHLTE          ESNCP--------EGTRVVRVMPNTPAFVGEGMTALC-KGMHATADDLLVAERIFNAIGK
Q8F631_LEPIN          LKNLP--------TGSNVVRVMPNLPLLVSEGAIGFF-GD----EELYETVSEIFQPLGH
T2I2W1_BIFLN          RDLFGAD-----FNAAHIQCTIPNTPMAVGKGVLVTE-ADNTLTDTQAEVFERLFSSISL
Q8G5S6_BIFLO          RDLFGAD-----FNAAHIQCTIPNTPMAVGKGVLVTE-ADNTLTDTQAEVFERLFSSISL
A9KPJ8_LACP7          EAIL--------VPGTHHLSTIPNTPVSIGEGIIICE-NHHSLTKEEYDTVADLFSKIAL
P5CR_TREPA            EALFAADP----HQGIRHLSLLPNLPCQVARGVIIAE-ARHTLHHDEHAALLAVLRTVAQ
A5VID9_LACRD          AKVL---P----NK--EIVNIIPNTPVEVNAGTIGLA-LPTGISAEAISKVMTVLDSLGD
Q831S6_ENTFA          QMAL---G----NKEAKVVHAIPNTPVSVNQGVIGVA-LAPTIEGQTKDLAMELLATLGL
A3CMT2_STRSV          EKLTS--------SQHRWIRIMPNTPVAVAEGVITYA-LSPEANQADEDLLHELLSSAGL
Q8DQ59_STRR6          ASLIP--------SQHRIIRMMPNTPASIGQGVISYA-LSPNCRTEDSELFCQLLSKAGL
A4VTT6_STRSY          AAFV---------SADKVIRIMPNTPVAIGQGMTTYS-L---VNQNLAPLLEQILEKSGK
D2BSY5_DICZ5          SAMLG--------ESRPITRIIPNTLTDTGLGYSGVA-FNAYVNSA---SVMPFLESFGK
A0A0H3FY46_ZYMMA      EDLLG--------KKRAIARIIPNTLTDTGLGYSGVV-INNQADKA---LTEKFVSGFGK
P5CR_SYNY3            QKGFPDHAI---------IRAMPNTPATVGAGMTAIAANKM-VEPDQLAKAKAIFSAVGN
A0A0H3K800_SYNP6      EAAFPHEAV---------IRAMPNTPATVGAGVTAIAAGQQ-VTADQLSQAQEFFAAVGR
Q7NMR1_GLOVI          QAAFTGRAV---------VRAMPNTPALVRSGITALSRSER-VTPEQFAVARTLFACVGE
Q2JKS6_SYNJB          QQAFPKQKV---------VRTMPNTPALVGAGITAISYGPG-VTPMQVEQVEKLFRAVGE
K9RUH8_SYNP3          EQVFPGRTV---------IRAVPNTPGRVGAGITAIAAPSS-ITPPELHQAETFFQVIGQ
Q8DJK6_THEEB          RRLFPQRLI---------FRAMPNTPAQVGAGVIALASDSA-ASELEIQKIKNLLGVLGQ
A3PBB4_PROM0          AQKFPNHKC---------VRVVTNIPITIGKGLTGISWGKE-ITEDQKQFTKKLFENTSK
Q31CE2_PROM9          HQKFPNHKC---------VRVVTNIPITVGKGLTGIAWGEN-LTEDQKEFTKKLFENTSK
A9BE14_PROM4          QSIFPAHNC---------VRAVPNIPVIVRSGLTGLSWGAG-VTTDQRLSVEAIFKPISE
Q7VDI3_PROMA          QSLFPDHVC---------VRAVPNTPALVSAGLTGLSWGEE-VTEDQKSLVESIFKPISQ
A5GJ84_SYNPW          QSTFPGRVC---------VRAVPNTPCLVAEGLCGLAWGCD-VTSEQQAWVRRMFEPVSE
F8KX73_PARAV          RRYFPHGQL---------LRVMPNIALNYGQGVIGLANQQF-HPPFSKEIIEELFGLLGW
P5CR_THET2            ARRLDNRRV---------VRAMPNLAVVIGESSTALTALKEAREAEDLAFARALFATVGD
Q5SK00_THET8          ARRLDNRRV---------VRAMPNLAVAIGESSTALTALKEAREAEDLAFARALFATVGD
Q9RU71_DEIRA          GRRLGTRRV---------VRVMPNLAATIGRSQTAITGPREAHEAGDIAFAEQLFGAVGQ
P5CR_SCHPO            QSMLDESTR--------VIRIMPNTASRIRESMSVICP-GPNATEEDIKFAEWVFNGIGR
P5CR_NEUCR            ERVLREDVGLSADNLPIVVRAMPNTASKIRESMTVINTVDPPLPDTVTELLTWIFERIGE
P5CR_HELPJ            SNAINSLHY---------LKCMPNIASKFALSSTAVCEKSVAPSISEKALN--IIESFGN
E1S9U8_HELP9          SNAIDSLHY---------LKCMPNVASKFALSSTAVCEKSVAPSISEKALN--IIESFGN
E8QH86_HELP7          SDAIDSLHY---------LKCMPNIASKFALSSTAVCEKSPMPLISQKALS--VIESFGN
G2MAG2_HELPX          NNAINSLHY---------LKCMPNIASKFALSSTAVCEKSPMPLISQKALS--VIESFGN
P5CR_HELPY            SDAIDSLHY---------LKCMPNIASKFALSSTAVCEKSPMPLISQKALS--VIESFGN
Q7M801_WOLSU          REKIPAQSY---------IRAMPNMAASLGSSCTALCGDE---SLKALASE--IFAPLGT
Q0P9H8_CAMJE          -QTIKAQNY---------VRIIPNTAAKYKASTTPYILKN--SHFENEILD--ILKTFGS
D1B3R8_SULD5          HAGIMAKHY---------IRSMPNMAALVRKSATSLCGDV---ALKEVATE--VLGSIGY
D1B951_THEAS          ERICH-IPV---------IRAMTNTACRIRRGYTVYANGRG-VSQAEEDLARDVFRSMGS
G7V6Z1_THELD          KKVVSGSKI---------VRAMTNTAVKVRKGYTLYTHSDD-LNDEELSLLCTIFSKLGE
Q8U084_PYRFU          KRFA-NAKF---------VRAMPNIAVLVKESFTAYATED--LSEEEIRTVEKIFESFGK
B6YWB3_THEON          KRLAPKAKF---------VRAMPNIAILVKESFTAYTSDG--LSEEDITIVENLFSSFGK
Q9HLT6_THEAC          RHILPRSFI---------VRSMTNIAAEVNAGYTPFCTLE--EDEGKISFVSRVLGVFGE
D0KSI7_SACS9          STLLNSAEV---------YRAMPNINAIVCKSTTAIAEN-G-GKSR--ELVENIFKTLGN
Q97ZT3_SACS2          STLLNNAEV---------YRAMPNINAIVYKSTTTIAEN-N-GKSR--ELVENIFKTLGN
A1S1A4_THEPD          RAALHGAKV---------FRAMPNLNAYVGKSSTAVSENLY-DDAS--RTVEEFLGLFGQ
A2BJN9_HYPBU          QKVLKGAEV---------YRAMPNLNIRVGRSLTALYSPPN-ARHY--GLVRRALSCFGT
B1L4V5_KORCO          ESEFPKARI---------VRAMPNINAIIGASVTAISAGRS-ARESDIEVAERIFRKLGD
P5CR_AQUAE            EKILG--------KDKKIVRVMPNVNVAVGSGVMAIT-DNGNLSEEERSKVEELLLSCGT
Q9WZ47_THEMA          RKYG----------IHKVARIMPNVAVRVGEGVLATA-FSADMSLEERELVKSLLEKLGF
F9UL32_LACPL          ATV---------APDLPVLRIMPNVNVAIGAGMTALV-GNDALTPEQYAAGQQLFDAIGA
Q836Y3_ENTFA          YQLFET------TQPLRLVRVMPNMNALIGAGAAAVC-GNAFASPEDIQTVLSLFRAVGQ
Q9CEF7_LACLA          KHLAD-------SENQPIIRVMPNINAQIGQSTSAIV-KNEFVDDSAYATVQEIFKSTGS
A2RMV8_LACLM          KHLAD-------SENQPIIRVMPNINAQIGQSTSAIV-KNEFVDDSAYEIAQRIFNAVGS
Q1J8V8_STRPF          ATFV--------GQDLPLLRIMPNMNAQILQSSTALT-GNALVSQELQARVRDLTDSFGS
Q8A6I2_BACTN          AHLS--------ETEMPIFRVVPNIAITEHSSLTLIT--SRKAGKEHQQLIKQTFEEGGK
Q8A1A9_BACTN          AHFVI-------APEMPMFRLIPNTAISELESMTLIA--ARNTNDEQNLFMLRLFNEMGM
A6GVR3_FLAPJ          QNIV--------ENNHTIIRIMPNIAIQFGESATCIS--FEEKDKNQAQKAISLFQQLGT
K4IB55_PSYTT          EGLV--------GNDQFIIRAMPNTAIAVGKSMTCLC--SNEKGAKRIKVAEAIFNRLGH
Q5KWY3_GEOKA          EAAVPC----------QIVRAIPSIANRALSGSILVT-FGSRCSAACRQTIDDLLRRIAS
A0A1M6IFX8_9BACI      ETLVPC----------HVARIIPSITNRALSGASLFT-FGDNCSEEWQQKLLRLFKNIST
E1RHU1_METP4          SELSGV----------NVVRVIPSITSEYGAGVSVLV-FGEEVPQFAREEILSLFGSISR
F6D4H6_METPW          ATVFSG----------KTSKVIPTITSKVGEGVSLVC-HSPDVNPKDVEFVDKIFGAIGD
B8E0D3_DICTD          KRYLNKFKC--------IIRIMPNLPCTVKKGAIALT--FDKYDKEEVEFVKNLFSTIGS
Q04FB4_OENOB          TEFLPT---------AKIVRVLPNVNAEFNNSLTSVA-FGQNLSNEDLKLTKNFLQAFGT
A0A0H3FVS2_ZYMMA      RHFFPKA--------KSIVRAMPNLPVALGKGVVALC--TDKLTDEQRKCIEKLASTLGI
B9KWY6_RHOSK          AESGA-----------RCVRAMPNAAAEIGASYTPWV-AAEAVTEADRRIVTTILSAMGT
Q83FH8_TROWT          AAMLPSG--------TAIVRCATNLPITVRHGFTGLS-CNKHVLPSDVKAVYTLFELLGR
                                            ..                                  . 

B9IXD3_BACCQ          VSVVEEE-EMHAVTALSGSGPAYIYYVVEAMEEAAKK-IGLKEDVAKSLILQTMIGAAEM
B7JLZ1_BACC0          VSVVEEE-DMHAVTALSGSGPAYIYYVVEAMEAAAKK-IGLKEDVAKSLILQTMIGAAEM
Q818V7_BACCR          VSVVEEE-DMHAVTALSGSGPAYIYYVVEAMEEAAKK-IGLKEDVAKSLILQTMIGAAEM
Q5KXH0_GEOKA          VAVVPEK-DLHAVTGLSGSGPAYVYYLVEAMEKAAAD-IGLERDVAKRLILQTIIGAAEM
P5CR2_BACSU           ATLVEER-HLDAVTAIAGSGPAYVYRYIEAMEKAAQK-VGLDKETAKALILQTMAGATDM
P5CR1_BACSU           VYTIQEN-QMDIFTGIAGSGPAYFYYLMEFIEKTGEE-AGLDKQLSRSIGAQTLLGAAKM
P5CR1_BACPZ           VYTIQEN-QMDIFTGIAGSGPAYFYYLMEFIEKTGEE-AGLDKQLSRSIGAQTLLGAAKM
A0A0H3DZV9_BACA1      VYIIKES-QMDIFTGIAGSGPAYFYYLMEFIEKAGEE-AGLDKKLSRSIGAQTLLGAAKM
I0JJ37_HALH3          VFIIPED-KMDVFTGIAGSGPAYFYYLMEHIEETGRA-EGMDSKTLREIGAQTLLGAAKM
P5CR_STAAC            VIEVSED-HLHQVTAITGSGPAFLYHVFEQYVKAGTK-LGLEKEQVEESIRNLIIGTSKM
Q2FY68_STAA8          VIEVSED-HLHQVTAITGSGPAFLYHVFEQYVKAGTK-LGLEKEQVEESIRNLIIGTSKM
B7HJN3_BACC4          SQLCTEE-EVHQLTAVTGSAPAFLYYFAESLIEATKS-YGVDEETAKHLVIQMISGSASM
Q81IX6_BACCR          SQLCTEE-EVHQLTAVTGSAPAFLYYFAESLIEATKS-YGVDEETAKHLVIQMISGSASM
A7GKA6_BACCN          SQLCTEE-EIHQLTAITGSAPAFLYHFAESLIEATKN-YGIDETTAHHLVIQMIAGAATM
B5YHK4_THEYD          VITLPEH-YMNLVTALSGSGPGFLCYIVEQLIDVATE-LGFAEDIAKELIVQTFIGTAKL
P5CR_MYCTU            VLTVP-ESQLDAVTAVSGSGPAYFFLLVEALVDAGVG-VGLSRQVATDLAAQTMAGSAAM
P5CR_MYCTO            VLTVP-ESQLDAVTAVSGSGPAYFFLLVEALVDAGVG-VGLSRQVATDLAAQTMAGSAAM
P5CR_MYCLE            VLTVP-ESQMDAVTAVSGSGPAYFFLLVEALVDAGVA-VGLTRQVATELAAQTMAGSAAM
A0QR08_MYCS2          VITVS-ESQLDAVTALSGSGPAYFFLMAEAMVDAGVA-VGLSRAVATDLVAQTMAGSAAM
Q82E92_STRAW          TLRVP-ESQQDACTALSGSGPAYFFYLVEAMTDAGIL-LGLPRDKAHDLIVQSAIGAAIM
Q9X8G1_STRCO          TLRVP-ESQQDACTALSGSGPAYFFYLVEAMTDAGIL-LGLPRDKAHDLIVQSAIGAAKM
D7CHR5_STRBB          TLRVP-ETQQDAATALSGSGPAYFYFLVEAMTDAGIL-LGLPRDKAHDLIVQAAIGAAVM
B1VT80_STRGG          TLRVP-ESQQDAATALSGSGPAYFYFLVEAMTDAGIL-LGLPRAQAHDLIVQAAIGAAVM
A1SDY8_NOCSJ          VLRIP-ERQQDAVTAISGSGPAYIFFVVESMIEAGVH-LGLPRATATDLVVQTVVGSAKM
P5CR_CORGL            VLEVA-ESDIDAVTAMSGSSPAYLFLVTEALIEAGVN-LGLPRATAKKLAVASFEGAATM
Q6NJK7_CORDI          VEVIE-ESSMDAVVALSGSSPAYLFLMVEALIDAGVF-LGLPRDKAKNLAVSSFAGAATM
C5CCT6_MICLC          VVPVA-EEQLSAVVATAGSAPAYVFLLAELIAAHGAE-MGLDAASAEAMAAATVKGAGIM
Q729L8_DESVH          VLVLP-EEKFNAFTAVVGCGPAYVFHFMEAVVEAAVT-LGFPRHEATDMVVDLFAGSVKL
Q312A7_DESAG          VIVLP-EQKFEAFTAVAGCGPAYVFHMMEAVIEAAVT-VGFTRQQATEMVTELFSGSCAL
A0A0A7PX55_PSEPU      ALWLEQEQQLDAVTAVSGSGPAYFFLLIEAMTAAGEK-LGLPRETASQLTLQTALGAAHM
Q1IGC4_PSEE4          ALWLDEEQQLDAVTAVSGSGPAYFFLLIEAMTAAGEK-LGLPRETASQLTLQTALGAARM
P5CR_PSEAE            ALWLDDEAQIDAVTAVSGSGPAYFFLLMQAMTDAGEK-LGLSRETASRLTLQTALGAAQM
Q8P757_XANCP          TVWLDDEAQMDAVTAVSGSGPAYVFLLAEAMEAAARA-QGLPAETARTLVLHTLLGAARM
Q5H301_XANOR          TVWIDDEAQMDAVTAVSGSGPAYVFLLAEAMEAAAQA-QGLPAETARTLVLQTLLGAARM
B4SMF7_STRM5          TVWIDSESLMDSVTAVSGSGPAYVFLLAEAMEAAGIA-QGLPAEAARTLVVQTLLGASRM
Q9PA08_XYLFA          TLWITEEALMDAVTAVSGSGPAYAFLLAEAMEAAAIM-QGLSTANARTLVQQTLLGAARM
Q83A21_COXBU          VIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQ-LGLTKETAELLTEQTVLGAARM
A9KDE3_COXBN          VIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQ-LGLTKETAELLTEQTVLGAARM
D3RQW6_ALLVD          VRWVEDESHIDAVTAISGSGPAYFFLFMEALEQAAIE-LGLDGETARLLTIQTALGAAKM
D8KCA8_NITWC          TLWLNDENLMEVVTALSGGGPAYFFLVMEAMEKAAID-LGLESNTARLLTLETAFGAAKM
B7J406_ACIF2          IYWLSDESLMDAVTALSGSGPAYVLLFLEALEDAAVL-QGLDRATARALALQTVLGTAQM
A9IM43_BORPD          VVWVDDDVALDAVTALSGSGPAYVFLFLEALIAGGVA-VGLSPDQARQLALGTLDGATRL
Q7VYN6_BORPE          VVWVDGDAGLDAVTALSGSGPAYVFLFIEALIAGGRA-VGLTDEQARQLALGTLAGATRL
Q12GA3_POLSJ          YLWLNDEVQLDAVTALSGSGPAYVFYFLEAMIQAGTD-MGLEPEQARKLAVGTFVGASAL
A2SMB0_METPP          TLWVDREADLDAVTALSGSGPAYVFLFIEALMDAARD-MGLTPEQGRALALGTFSGATAL
Q63R27_BURPS          TVWFDDESQLDAVTAISGSGPAYVFYFIEALQEAARQ-LGMNDEQGRALAVATFAGAAQL
G8QFZ1_AZOOP          AVWFADESQMDAVTAVSGSGPAYVFLFIEALQQAGKD-LGFDDEQARRLAIETVLGAAQL
Q46XH0_CUPPJ          SAWVDGDEQIDAVTAISGSGPAYVFYFIEAMERAATE-LGLTTQQGRELAVQTFLGAATL
A0A0H3AHF1_VIBC3      VCWVENESGINSVIAAAGSAPAYFFLFMQAMQQEAMA-QGFDEATARLLVQQSALGAAAM
Q9KUQ5_VIBCH          VCWVDNESGINSVIAAAGSAPAYFFLFMQAMQQEAMA-QGFDEATARLLVQQSALGAAAM
Q87LJ5_VIBPA          VCWVEQESGINNVIAAAGSAPAYFFLFMEAMQAEAIA-QGFDKETARLLVQQAALGAASM
Q7MHJ4_VIBVY          TCWVDEESGINHVIAAAGSAPAYFFLFMEAMQAEAMA-QGFDKQTARLLVQQSALGAASM
Q5E7S2_ALIF1          VCWVAQESGINSVIAAAGSAPAYFFLFMEAMQAEAIN-QGFDEATARQLVQQAALGAAEM
A0A0E1NSU5_YERPA      VCWVDNEDGINSIIAAAGSSPAYFFLFMEAMQQETER-LGFDSETARQLVQQAASGACAL
Q666N4_YERPS          VCWVDNEDGINSIIAAAGSSPAYFFLFMEAMQQETER-LGFDSETARQLVQQAASGACAL
Q15PG7_PSEA6          VAWVEKESMINGVIAAAGSSPAYFYAFLEAMQKEAQS-QGFDHQTARLLVQQAMLGAAEM
Q8EBZ1_SHEON          IVWVNEESDINQVIALAGSSPAYFFLLMESMIDAGKQ-MGMDEAKARSLVQQAALGAAMM
P5CR_HAEIN            TVWVNDETQMHAVTAASGSSPAYFFLMLEAMQKALIK-MNIDEKTARELVQQSMLGAAKM
Q5QY55_IDILO          TLWVSDEDQLDILGAVAGSGPAYFFEFMDSLAKAATE-LGFDAEKARAMVQQTCLGAAQM
Q5NER0_FRATT          VTVVEDEKEIDIVAAIASSGPAYYFQFMEHMVEAAIK-QGLDKKQAEKLVVQTCLGAAQM
Q21EI2_SACD2          AVWVNSEDEINIVTAVSGSGPAYFFLVFEAMIDAAEK-MGLDRQTATQLTLQTALGAAKL
A0A0D5YKR7_ACIBA      TYWANSESQSDAIIALSGSGPAYFFYILDSMVKTGVS-MGLDKQFALDLILQAASGAVEM
V5VGV7_ACIBA          TIWVNSEAQIDAVTAVSGSGPAYFFYLMESMIRAGKN-LGLDEKVATALTLQTALGAAQM
Q4FVC0_PSYA2          VMWVEDEAHMHAVTAVSGSAPAYMFYIIEAMVDGAVA-LGLDKEQASALAMQTMLGAAKM
A9LZV3_NEIM0          TVWLEDEAQMHSITGISGSGPAYVFYLLDALQNAAIR-QGFDMAEARALSLATFKGAVAL
Q5F5L8_NEIG1          TVWLEDEAQMHSITGISGSGPAYVFYLLDALQNAAIR-QGFDMAEARALSLATFKGAVAL
Q9K1N1_NEIMB          TVWLDDEEKMHGITGISGSGPAYVFYLLDALQNAAIR-QGFDMAEARALSLATFKGAVAL
Q3IWW7_RHOS4          VVRLEGEHQMDAVTAVSGSGPAYVFHLIEALAAAGEA-EGLPADLAMTLARATVTGAGEL
A3PP43_RHOS1          VVRLEGEHQMDAVTAVSGSGPAYVFHLIEALAAAGEA-EGLPADLAMTLARATVTGAGEL
A8IL23_AZOC5          VEWVESESLIDAATAVSGSGPAYVFLLAEALAKAGAA-AGLPADLADRLARATVSGAGAL
Q89DI5_BRADU          VEWVEDESLMDAVTAVSGSGPAYVFLLAEELARAGVE-AGLPEALATKLARETVAGSGEL
F7X1E2_SINMM          VEWVGSEADIDAVTAVSGSGPAYVFYLVECMAEAGRK-AGLEADLAMRLARETVAGAGEL
Q1MDM9_RHIL3          VEWVPAEADIDAVTALSGSGPAYVFYLVECMAEAGRK-LGLQADLAMRLARETVAGAGEL
Q7CXL8_AGRFC          VEWVEAESDIDAVTAVSGSGPAYVFYLVECMAEAGRK-AGLPADVAMRLARETVAGAGEL
Q2RP69_RHORT          VEWVDDESLIDAVTALSGGGPAYVFLLVECLAEAGRA-NGLPADLAMRLARSTVAGSGAL
C0RLT4_BRUMB          VASVDEEGLMDAVTAVSGSGPAYIFHFIEALTDAGVN-LGLPRETAALLAMQTVMGAGAL
Q7WAQ8_BORPA          AFWVDTEDQLHAVTALSGSGPAYYHLFSEALAQAGEQ-LGLPAALARSLAARTALGAASL
Q9AAU9_CAUVC          VAELASEDLMHAATAVSGSAPAYLYAFIEALEAAGAA-QGLDPAQSARLARATIIGAAAL
A9WFV0_CHLAA          ELFVDNETYLDMATAINGTGPAYVFLMMEAMIDAGVH-LGLSRRIAEELVQQTMLGSVQY
Q88GE6_PSEPK          SLRVNDERQIDTGTALAGGGPALVAHFADALQDYGLH-MGLDSEQAAVVALQLLSGTAAL
D4GXS3_HALVD          FVEVE-ESQMDIATAVNGSGPAFVFYLIEAVTQAGVA-GGLSEEDAEILAAQTFKGAAET
L9UT99_HALVD          FVEVE-ESQMDIATAVNGSGPAFVFYLIEAVTQAGVA-GGLSEEDAEILAAQTFKGAAET
I7BLK2_NATSJ          FAEID-ERQMDIATAVNGSGPAFVFYLIQAMAEAGIE-GGLDEAHAETLAAQTFKGAAET
M1Y5X6_NATM8          FVEID-ESLMDVSTAVNGSGPAFAFYIIDAMKTAGVE-GGLDPEQAETLAAQTFKGAAET
Q18J37_HALWD          YVVID-ETHMNIATALNGSGPAFVYYLIQSMQTRAIK-EGLDKSDAQTLAIQTFIGAAEM
P5CR_ECOLI            AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
Q3Z524_SHISS          AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
B2U3Y8_SHIB3          AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
Q32JD5_SHIDS          AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
Q1RFF8_ECOUT          AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
A0A0R9P6Y1_SALNE      AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
Q8ZRF0_SALTY          AEVIAEP-MIHPVVGVSGSSPAYVFMFIEAMADAAVL-GGMPRAQAYKFAAQAVMGSAKM
A5I6R1_CLOBH          AEIVEEK-LMDAVTAVSGSSPAYVYMFIEAMADAAVL-EGMPRDKAYKFAAQAVLGSAKM
A0A0E1L194_CLOBO      AEIVEEK-LMDAVTAVSGSSPAYVYIFIEAMADAAVL-EGMPRDKAYKFAAQAVLGSAKM
A7GIC3_CLOBL          AEIVEEK-LMDAVTAVSGSSPAYVYMFIEAMADAAVL-EGMPRDKAYKFAAQAVLGSAKM
Q7BYC2_BACCR          TEVINEK-LMDVVTSISGSSPAYVYMFIEAMADAAVL-GGMPRKQAYKFAAQAVLGSAKM
B7HAA7_BACC4          TEVINEK-LMDVVTSISGSSPAYVYMFIEAMADAAVL-GGMPRKQAYKFAAQAVLGSAKM
Q6HGV3_BACHK          TEVVNEK-LMDVVTSISGSSPAYVYMFIEAMADAAVL-DGMPRKQAYKFAAQAVLGSAKM
A0A6H3AEP9_BACAN      TEVVNEK-LMDVVTSISGSSPAYVYMFIEAMADAAVL-DGMPRKQAYKFAAQAVLGSAKM
Q81C08_BACCR          TEIVSEK-LMDVVTSVSGSSPAYVYMIIEAMADAAVL-DGMPRNQAYKFAAQAVLGSAKM
B3ZIM7_BACCE          SEIVSEK-LMDVVTSVSGSSPAYVYMIIEAMADAAVL-DGMPRNQAYKFAAQAVLGSAKM
Q97E64_CLOAB          CEVVDEA-LMNAVTGVSGSSPAYVYMFVEAMADAAVL-NGMTREKAYKFAAQSVLGAAKM
Q8Y9X2_LISMO          AEVVSEN-LMDAVIGVSGSSPAYVYMFIEALADGAVL-SGMPRDKAYKFAAQAVLGAAKT
A8MFQ7_ALKOO          VDQIDES-LIDAVTTISGCSPAFIAMFVEALADGSVR-KGMPRDKAYLYAAQTLIGTGKM
A6TR68_ALKMQ          VEIIGEG-IMDAIPAISGSSPAYVYTFIEALADGGVS-LGIPRDKAYKFAAQAVYGAAKM
Q8RA68_CALS4          IVEIEEK-LIDVAMAVSSCSPAFVYMFIEALADGGVL-LGLPRDVAYKLASKAVSGAGSM
B0K1A6_THEPX          IVEVEEK-LIDAAMAVSSCSPAFVYMFIEALADGGVL-LGLPRDVAYKLASKAVAGAGNM
P5CR2_RAT             CTEVEED-LIDAITGLSGSGPAYAFMALDALADGGVK-MGVPRRLAVRLGAQALLGAAKM
Q7UTG7_RHOBA          AAQVTEP-QMNGVTGVSGSGPAYVFLIIEALADGGVA-AGLPRATALQLATQTVLGAAKM
P5CR_METAC            AVQVPES-LMDAVTGLSGSGPAFIFPVIEAMADGAVL-EGMDRKSALTLAAQTVLGAAKM
C0QCA7_DESAH          SVFIQENVLMDAFTGLSGSGPAYIFMIIDAMADAGVK-MGLSRKDSLFLSTQTVLGAAKL
Q2RK62_MOOTA          AMVLPEE-QLNAVTGLSGSGPAYVYMIIEALADGGVR-QGLARPVALELAARTLLGGAQM
Q74A50_GEOSL          TCVVEEK-LMDAVTGVSGCGPAYVFLFMEALSDAGVK-NGLPRDVATRLAAQTVLGAARL
Q2S2A0_SALRD          AVVVPED-HMDAVTGLSGSGPAYVYMFIEALTDAGVK-QGMSREDASTLARQTVYGAAKL
D0MIZ9_RHOM4          VEIVPEY-LMDAVTGLSGSGPAYVFMFIEALTDAGVK-QGLPRPVAFRLAAQTVYGAAKL
Q1IRM0_KORVE          TAIVEEK-HMDAVTGLSASGPAFIYIIIESLAEAGVK-VGLPRDLATLLAAQTTMGAAQV
B4S5S7_PROA2          VAVLDER-LMDAATAVSGSGPAYMFSLIASIAEGGRQ-CGLSMQDAILLSAQTMLGAATM
Q8KG91_CHLTE          TAIIEES-GMDAATAVSGSGPAYMFRIIDSLAEGGEA-CGLDRETAQLLAAQTMLGAAKM
Q8F631_LEPIN          SVKLGSETLMDAVTGLSGSGPAYVFKFIQALAEGGVL-SGLGYQEALDLSIQTVIGSAQL
T2I2W1_BIFLN          IERVDSA-HMGIGMCIAGCAPAFTDMYIEALGDAGVK-YGLQRATAYRLAAKMVEGVGAL
Q8G5S6_BIFLO          IERVDSA-HMGIGMCIAGCAPAFTDMYIEALGDAGVK-YGLQRATAYRLAAKMVEGVGAL
A9KPJ8_LACP7          LEFVDTK-QLTVAGTLSGCGPAFVSMFLEALADGAVK-HGLPRDTSYRLASQMVAGTGKL
P5CR_TREPA            VEVVDTA-YFAIAGVIAGCAPAFAAQFIEALADAGVR-YGLARDQAYRLAAHMLEGTAAL
A5VID9_LACRD          VIEVPER-QLDIIGVIGGCGPAFVDVMMDAMSDAAVK-YGLDRQTAYEVIASMVKGTGTL
Q831S6_ENTFA          VKEIREA-QLETFGTVAGCSPAFVDIFMEALGDAAVL-EGLPRDLSYEIVAQMIKGTATL
A3CMT2_STRSV          LVKLEEK-QLDAATALAGCGPAFVYLFIEALADAGVR-AGLSRDISLELANQTLLGAAKL
Q8DQ59_STRR6          LVELGES-LINAATGLAGCGPAFVYLFIEALADAGVQ-TGLPRETALKMAAQTVVGAGQL
A4VTT6_STRSY          VQQVPES-LIDAATAIAGCGPAFVYQMIEALTDAGVQ-NGLTAQDAKVLAAQTLAGTAQM
D2BSY5_DICZ5          VMVLEER-LIDVFTGFAVAGVNYVYYFVEALADAGVL-AGLTRTQSTQVVWENLVGAVEM
A0A0H3FY46_ZYMMA      CLFLEES-LIDIFTGFGVCGPNYVYYFIEALVDAGVL-AGLPRDIAWKTTMENLVGSVKM
P5CR_SYNY3            VVEV-PENLMDAVTGVSGSGPAYVALMIEALADGGVL-AGLPRAIAQKLALQTVLGTAEL
A0A0H3K800_SYNP6      VVTV-PESQLDAVTGLSGSGPGYVALIVEALSDGGVA-AGLPRAIATELAIQTVRGTAEL
Q7NMR1_GLOVI          VVEV-PESAMDAVTGLSGSGPGYLALVVEALIDGGVA-AGLPRATASQLVLATLRGSAEL
Q2JKS6_SYNJB          VVTV-AESQMDAVTALSGSGPGYLAVILEGLIDGGVQ-VGLPRPIATQLALQTLAGTAAL
K9RUH8_SYNP3          VITV-PEKLINSVTALAGSGPAFVALIVEALTDGGVL-VGLPRPTAQKLVLATITGTIKL
Q8DJK6_THEEB          VVAV-SEGQMDAVTALSGSGPAFVALIVEALCDAGVA-VGLSRSLTQELVYGTIAGTVQL
A3PBB4_PROM0          IYEF-TEDYLDIFLALTSSGPAIIALIIEALSDGGLS-GGLPKIISEELVMEMILGTICL
Q31CE2_PROM9          IYEF-TEEYLDIFLALTSSGPAIIALIIESLSDGGLS-GGLPKILSEELVMEMIIGTISL
A9BE14_PROM4          VLEL-PEKQLDAFLALTSSGPAYVAVIAEALADGAVA-AGLPRSLANDLSNMTLAGSAKL
Q7VDI3_PROMA          VFEL-PEDQLDAFLALTSSGPAYLALISEALADGAVA-AGLPRALAQSLTNFTLEGTAIL
A5GJ84_SYNPW          VLEL-PESQLDAFLALTSSGPAYVALMAEAMADGAVA-AGLPRDQALRLAQRTLAGTAAL
F8KX73_PARAV          IHWV-DEAKIDALSALAGSGMAFAAAIMEAGTEASIA-MGLNAEEGLNILIETFTGTITT
P5CR_THET2            VYEI-PEHLFDAFTGMSASAPAYLAVVAEALADAGVK-MGMPRALALRLAADALAATGEL
Q5SK00_THET8          VYEI-PEHLFDAFTGMSASAPAYLAVVAEALADAGVK-MGMPRALALRLAADALAATGEL
Q9RU71_DEIRA          VYEL-PEHLFNAFTGMSASGPAYVAVVAEALADGGVR-MGLPRPLANELAARLLASTGEL
P5CR_SCHPO            SMKL-PEKLIDAATAVCGSGPAFVATMIEAMTDGGVM-MGIPFPQAQELAAQTMVGTGRM
P5CR_NEUCR            VVYL-PPHLMDACTSLCASGTAFFALMMEAAADGGVA-MGLPRAEANRMAAQTMRGAAGL
P5CR_HELPJ            CVRVGNEEQVDSSVATNGSALAFLSLVASSLKDAGIR-EGLNAKDSLELVKMSFKGFAKL
E1S9U8_HELP9          CVRVGNEEQVDASIATNGSALAFLSLVASGLKDAGIR-EGLNARDSLELVEMSFKGFAKL
E8QH86_HELP7          CVRVGNEEQVDASIATNGSALAFLSLVASSLKDAGIR-EGLNARDSLELVKMSFKGFAKL
G2MAG2_HELPX          CVRVGHEELVDASVATNGSALAFLSLVASSLKDAGIR-EGLNARDSLELVKMSFKGFAKL
P5CR_HELPY            CVRVGHEELVDASVATNGSALAFLSLVANSLKDAGIR-EGLNARGSLELVKMSFKGFAKL
Q7M801_WOLSU          SLWLDKESKIDAATALAGSGPAYLALMAEALMDAGVR-EGLSREESKALTQGLFSGFADL
Q0P9H8_CAMJE          AYKLDNEIQMNAAMAISGCAPAFLALIAESIANAGVY-EGLSKELSLNLTRSLFKSSNAL
D1B3R8_SULD5          CFWLESEKELDIATGIAGSAPAWIALVAEALSDGAVN-LGMKRDISYAYVAALFEGVGEV
D1B951_THEAS          FDRV-DEQHLDVLTAMAGSGPAYIYTVLEAMILGALK-VGLPRDIALKAAAHTAIGASCL
G7V6Z1_THELD          KQRV-DEAHMDVLTAMSGSGPAYIFTVVEAMIYGALR-EGLPRALALQAAAHTAIGASCL
Q8U084_PYRFU          YIRI-DEEYMDAITGLSGSGPAYVSVFLEAMIYGGLR-VGLPRDIAKLAAAQTLLGTAKL
B6YWB3_THEON          CLRV-DEEHMDAITGLSGSGPAYVSVFLEAMIYGGLR-VGLPRDVAKLAAAQTLLGTAKL
Q9HLT6_THEAC          TERV-DEKYMDALTALSGSGPAYILTIIEAMMYGGLK-VGLPRSIALKASYQTVMGSAKL
D0KSI7_SACS9          VYWL-PEEYLDVWTALVGSGPAFISEIIDALSLGAVA-CGMQREIAYNAVLDMISGTVNM
Q97ZT3_SACS2          VYWL-PEEYLDIWTALVGSGPAFISEIIDALSLGAVA-CGMQREIAYNAVLDMISGTIIM
A1S1A4_THEPD          VYWV-PEEYLDVWTGLAGSGPAFIAEVLDALAMGAVA-AGMPRELSYKAVLDVLEGTAIL
A2BJN9_HYPBU          VYDV-PEEFIDAWTAVAGSGPALVAEFLDALVLAALA-VGLPRSIARRVAAELLESTARY
B1L4V5_KORCO          VFRV-PEEYMDPITALIGSGPALISEIIDAMLLGAVA-AGMPRELAYEMLLKLMEGTVRA
P5CR_AQUAE            LYRIEER-LFDAFTALAGSGPAFVFSFIDALALAGVH-QGFSYEQALRIALDTVMGSAKL
Q9WZ47_THEMA          VVEIEEK-LFSAVTALTGSGPAFIFVVVEAFLDAALK-MGIPLDTAKELVYRLFKGSAEL
F9UL32_LACPL          TSAIAEK-DFPTFSALAGSSPAYIYFFIDAMARAGVK-HGLSKDAATKIAAQATLGSAQN
Q836Y3_ENTFA          AWELEEQ-YFSIFTAIAGSTPAYAFLFIDSIARAAVK-NGMNKELALEIATQAVLGSAQT
Q9CEF7_LACLA          VHEIAEK-DFSTFAAIAGSSPAFIYMFIDAMARAGVL-HGIPKDQATAIVAETVRASAEM
A2RMV8_LACLM          VHEIAEK-DFSTFAAIAGSSPAFIYMFIDAMARAGVL-HGLPKDQATAIVSETVKASAEM
Q1J8V8_STRPF          TFDISEK-DFDTFTALAGSSPAYIYLFIEALAKAGVK-NGMPKAKALEIVTQTVLASASN
Q8A6I2_BACTN          CLFAEEK-QLDIISALTSSGIAFALKYIHAAMQAGIE-LGISAEDAMRMTAYSMEGATEL
Q8A1A9_BACTN          AMLIPED-KIAATTALTSCGIAYVLKYIQAAMQAGIE-MGIRPKDAMEMVAQSVKGAAAL
A6GVR3_FLAPJ          APVIEEK-LMDAATVLGACGTAYALRYIRASMQAGIE-IGFDAQTALAIAAQTAKGAAKM
K4IB55_PSYTT          TLAIPES-QMQAATVICASGIAFWMRLIRASTQAAIQ-LGFDAKEAQELAMYTSEGAANL
Q5KWY3_GEOKA          PVYIDEA-ITRVASDISSCGPAFFSYLLQRFIDAAAAKTAITKEQATMLATDMIIGLGEL
A0A1M6IFX8_9BACI      PLVIEED-ITRVSSDIASCGPAFFSYLLQCFINAAVDKTNITHEEATTLVSEMVVGMGKL
E1RHU1_METP4          SYVTTED-KISLLSDLTSSSPAIIASIMQQYALAGVRRGGISIEDAEFLVRETFTGTAKL
F6D4H6_METPW          VKVINEE-DLEAATNLTSCSPAFLALILMKFAEAGSRISGFSMQETEEMVIKTFYGTSKL
B8E0D3_DICTD          VWIVDEK-YFDTITALTGSGPAFVSTILQGFTLSGVK-GGLSYDISKEMVLKLFEGVIEY
Q04FB4_OENOB          IIELAER-DFPAFSAIAGSGPAFVALFIKALQEAGIK-QGIDSKESLQIALHTIKGSTEN
A0A0H3FVS2_ZYMMA      FEWVNEN-QFDTATALAGCGPAFVYRFIDALAQAGQK-LGLTADQALPMAIATVEGAASM
B9KWY6_RHOSK          SDPLETEAQIDLMTAVSGSGPAYPALMAAAILDFLRA-EGVPETVARRSAEAVVCGAAPL
Q83FH8_TROWT          CTMLSEE-HLTIVSAITGFYPVYMLYMLTKIKEATEK-LGLPRDISQAAVETAWIGYAQV
                                                              .              .    

B9IXD3_BACCQ          LKASE-----------------KHPSILRKEITSPGGTTEAGIEVLQEHQ--FQQALISC
B7JLZ1_BACC0          LKASE-----------------KHPSILRKEITSPGGTTEAGIEVLQEHK--FQQALISC
Q818V7_BACCR          LKASD-----------------KHPSILRKEITSPGGTTEAGIEVLQEHK--FQQALISC
Q5KXH0_GEOKA          LKASD-----------------KHPSVLRREVTSPGGTTEAGIGVLEQYR--FQEAVIAC
P5CR2_BACSU           LLQSG-----------------KQPEKLRKEITSPGGTTEAGLRALQDSR--FEEAIIHC
P5CR1_BACSU           LMETG-----------------EHPEILRDNITSPNGTTAAGLQALKKSG--GGEAISQA
P5CR1_BACPZ           LMETG-----------------EQPEVLRDNITSPNGTTAAGLQALKKSG--GGEAISQA
A0A0H3DZV9_BACA1      LMETG-----------------EQPNVLRKNITSPNGTTAAGLEALKKCG--GGEAISQA
I0JJ37_HALH3          MLEGE-----------------ESPAELRKKVTSPNGTTAAGLDALEESG--GGDAISAA
P5CR_STAAC            IERSD-----------------LSMAQLRKNITSKGGTTQAGLDTLSQYD--LVSIFEDC
Q2FY68_STAA8          IERSD-----------------LSMAQLRKNITSKGGTTQAGLDTLSQYD--LVSIFEDC
B7HJN3_BACC4          LEQT------------------QNPANLREQVTTPGGSTAEGLKTLYEYN--FSEAIQKA
Q81IX6_BACCR          LEQT------------------QNPANLREQVTTPGGSTAEGLKTLYEYN--FSEAIQKA
A7GKA6_BACCN          LGQV------------------QNPALLREQVTTPGGSTAEGLKVLYEHH--FSKIIQQA
B5YHK4_THEYD          LDSG------------------LPPDKIRQKVTSPGGTTEAGLKVLSDGA--LRGIFFKT
P5CR_MYCTU            LLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGG--FRMAVDAA
P5CR_MYCTO            LLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGG--FRMAVDAA
P5CR_MYCLE            LLERMDQDRHSAEVAPLGAQVDVPAAQLRATITSPGGTTAAALRELERGG--LRMVVDAA
A0QR08_MYCS2          LLDRLDQ-----VNAAGGAALDTTPAQLRATVTSPAGTTAAGLRELERGG--LRAAVANA
Q82E92_STRAW          LRDSGEH-----------------PVKLRENVTSPAGTTINAIRELENHG--VRAALIAA
Q9X8G1_STRCO          LRDSGEH-----------------PVKLRENVTSPAGTTINAIRELENHG--VRAALIAA
D7CHR5_STRBB          LRDSGEH-----------------PVKLREAVTSPAGTTISAIRELESHG--VRAALIAA
B1VT80_STRGG          LRDSGEH-----------------PVKLREAVTSPAGTTISAIRELENHG--VRAALIAA
A1SDY8_NOCSJ          LRETGTH-----------------PAVLREQVTSPAGTTAAALRELEIHK--VRAAFLAA
P5CR_CORGL            MKETGKE-----------------PSELRAGVSSPAGTTVAAIRELEESG--IRGAFYRA
Q6NJK7_CORDI          LEQTGEE-----------------PAVLRANVSSPGGTTIAAIREFEESG--LRAAVYRA
C5CCT6_MICLC          LQQEGAR-----------------AEALRKAVMSPNGTTEKAVEAFLDGG--MGDLVNRA
Q729L8_DESVH          AATSGTH-----------------LSLLREAVCSPAGNTIAAMNQFDRDA--VRGRIIDA
Q312A7_DESAG          AEQTGIH-----------------PSLLREMVTSPAGTTIAGTNHLDRTA--VRGHIIDA
A0A0A7PX55_PSEPU      AVAS-DVD----------------AAELRRRVTSPAGTTEAAIKSFQASG--FEAIVEQA
Q1IGC4_PSEE4          AVAS-DVD----------------AAELRRRVTSPAGTTEAAIKSFQASG--FEAIVEQA
P5CR_PSEAE            ALSS-EVE----------------PAELRRRVTSPNGTTEAAIKSFQANG--FEALVEQA
Q8P757_XANCP          LTES-GEA----------------PEVLRRRVTSPNGTTQAAIEEFQAGG--FEALTATA
Q5H301_XANOR          LTES-GEA----------------PDVLRRRVTSPNGTTHAAIETFQAGG--FEALTANA
B4SMF7_STRM5          LDEA-GES----------------PAELRRRVTSPNGTTQAAIESFQAGG--FETLVDKA
Q9PA08_XYLFA          MTEL-GET----------------PAALRHRVTSPHGTTEAAIATFQEND--FQALVAKA
Q83A21_COXBU          ALET-EQS----------------VVQLRQFVTSPGGTTEQAIKVLESGN--LRELFIKA
A9KDE3_COXBN          ALET-EQS----------------VVQLRQFVTSPGGTTEQAIKVLESGN--LRELFTKA
D3RQW6_ALLVD          AMES-TDP----------------PARLREQVTSPGGTTERALAVFDEAD--LRALVERA
D8KCA8_NITWC          ALKS-EEG----------------CASLRQRVTSPGGTTERAIAALEEAN--IRKAFARA
B7J406_ACIF2          AAAS-TLS----------------PTALRHQVTSPGGTTAAGLAVWEE-H--LRPLAQRA
A9IM43_BORPD          AAQS-DDP----------------PSVLRERVTSKGGTTAAALQVFQQAD--LAAIVRQA
Q7VYN6_BORPE          AAQS-DEP----------------PAVLRERVTSKGGTTAAALDVYAQGD--FAGLVERA
Q12GA3_POLSJ          AHAS-DEP----------------LEVLRARVTSKGGTTYAALTSMEQAG--IKQQFMQA
A2SMB0_METPP          AAQS-AEP----------------PSVLRERVTSRGGTTHAALVAMQADG--VPAAIVRA
Q63R27_BURPS          AVQS-GEP----------------AGVLRERVTSKGGTTAAALASFDAQH--VKDAIVRG
G8QFZ1_AZOOP          AAQS-PDP----------------ASVLRERVTSKGGTTAAALAVMETAG--VKAGIIAG
Q46XH0_CUPPJ          AGQS-TEP----------------VATLRERVTSKGGTTYAALTAMESAG--IGDAFVRA
A0A0H3AHF1_VIBC3      VKANPELS----------------LTTLREQVTSKGGTTAQAIQTFNDHQ--LSDIVAKA
Q9KUQ5_VIBCH          VKANPELS----------------LATLREQVTSKGGTTAQAIQTFNDHQ--LSDIVAKA
Q87LJ5_VIBPA          VVSNPDTE----------------LSTLRENVTSKGGTTAEALRTFNEHQ--LTDIVAKA
Q7MHJ4_VIBVY          VVENPDTE----------------LATLRENVTSKGGTTAEALRTFNEHQ--LSDIVAKA
Q5E7S2_ALIF1          VVANPETQ----------------LSTLREQVTSKGGTTAEALRTFNEHQ--LQEIVAKA
A0A0E1NSU5_YERPA      VEANPHVP----------------LSALREQVTSKGGTTAEAIRVFNEQH--LPEMVANA
Q666N4_YERPS          VEANPHVP----------------LSALREQVTSKGGTTAEAIRVFNEQH--LPEMVAHA
Q15PG7_PSEA6          VCHNPQLE----------------ISELRAQVTSKGGTTAKAVEHFQNNG--IDTLVSGA
Q8EBZ1_SHEON          AKQNPELT----------------LGNLRENVTSKGGTTAQAIATFEAAD--LRGVVKKA
P5CR_HAEIN            VTENPQIA----------------LSTLRENVTSKGGTTAAALAVFDAQH--FNQTIEQA
Q5QY55_IDILO          AKES-ELS----------------LEDLRKQVTSKGGSTAKGVEAYQDSD--LHGISEKA
Q5NER0_FRATT          ALNT-NEN----------------MSELRKNVTSKKGITYEALNIFEQFN--LGGIVDKA
Q21EI2_SACD2          AQTS-EDD----------------AVTLRKKVTSPNGTTERAIASFEQNK--LRDTFAAA
A0A0D5YKR7_ACIBA      VRKS-NVQ----------------PSELCGKVTLANGITESALRMFELGN--LSDDIRLA
V5VGV7_ACIBA          AITS-SNT----------------PSELRKNVTSPNGTTQAALEVFDRAQ--ISQNIQSA
Q4FVC0_PSYA2          AMGS-EDA----------------PAELRRKVTSPNGTTQAAIESMQAND--IGRQISEA
A9LZV3_NEIM0          AEQT-GED----------------FEKLQKNVTSKGGTTHEAVEAFRRHR--VAEAISEG
Q5F5L8_NEIG1          AEQT-GED----------------FEKLQKNVTSKGGTTHEAVEAFRRHR--VAEAISEG
Q9K1N1_NEIMB          AEQT-GED----------------FEKLQKNVTSKGGTTHEAVEAFRRHR--VAEAISEG
Q3IWW7_RHOS4          AHRA-PES----------------ASQLRVNVTSPGGTTAAALGVLMDPESGLPPLLRRA
A3PP43_RHOS1          AHRA-PES----------------ADQLRINVTSPGGTTAAALGVLMDPESGLPPLLRRA
A8IL23_AZOC5          LEQS-GID----------------PAILRQNVTSPGGTTAAALAVLMDEAKGFGPLLTQA
Q89DI5_BRADU          LHQS-ELP----------------SGTLRQNVTSPGGTTAAALGVLMGEP-GLRDLMIRA
F7X1E2_SINMM          LHQS-PDD----------------AARLRQNVTSPGGTTAAALAVLMADD-GMQPLFDRA
Q1MDM9_RHIL3          MHQS-PDD----------------ASRLRENVTSPGGTTAAALAVLMAED-GMQPLFDAA
Q7CXL8_AGRFC          LHQS-PEE----------------AARLRQNVTSPGGTTAAALSVLMAED-GMQPLFDRA
Q2RP69_RHORT          LDGS-AED----------------AATLRKNVTSHKGTTAAALAVLMAED-ALQPMVTRA
C0RLT4_BRUMB          ADAS-TDS----------------PSKLREQVTSPNGTTAAALDVLMGGD-RLKELVAEA
Q7WAQ8_BORPA          QCEE-GAD----------------FAALRREVTSPHGTTHAAIEVFEQAG-ALRTLVRDA
Q9AAU9_CAUVC          MAQS-GEE----------------PAELRKQVTSPGGTTAAALSVLMGAG-GFGDLLPKA
A9WFV0_CHLAA          AIQS-GLH----------------PAQLRNAVTSPGGTSAAALSELERGG--LRTVLADA
Q88GE6_PSEPK          IQAS-GKP----------------ASQICQEVQTAGGTTERAIRALDAAG--FKGLVNAA
D4GXS3_HALVD          VVQD-DRT----------------ADELIDAVCSPNGTTIEGMEVLWDSD--ADDAVTEA
L9UT99_HALVD          VVQD-DRT----------------ADELIDAVCSPNGTTIEGMEVLWDSD--ADDAVTEA
I7BLK2_NATSJ          VLRS-DRD----------------IEDLIDAVCSPNGTTIEGMDVLWDSD--AKASVAEA
M1Y5X6_NATM8          VLRD-DRS----------------VDELVDAVCSPNGTTIEGMEVLWDSD--ADEAVAEA
Q18J37_HALWD          VRAA-DEP----------------IESLIDAVCSPNGTTIEGMNVLFDSN--VDAEVGDA
P5CR_ECOLI            VLETGE-----------------HPGALKDMVCSPGGTTIEAVRVLEEKG--FRAAVIEA
Q3Z524_SHISS          VLETGE-----------------HPGALKDMVCSPGGTTIEAVRVLEEKG--FRAAVIEA
B2U3Y8_SHIB3          VLETGE-----------------HPGALKDMVCSPGGTTIEAVRVLEEKG--FRAAVIEA
Q32JD5_SHIDS          VLETGE-----------------HPGALKDMVCSPGGTTIEAVRVLEEKG--FRAAVIEA
Q1RFF8_ECOUT          VLETGE-----------------HPGTLKDMVCSPGGTTIEAVRVLEEKG--FRAAVIEA
A0A0R9P6Y1_SALNE      VLETGK-----------------HPGELKDMVCSPGGTTIEAVRVLEERG--FRAAVIEA
Q8ZRF0_SALTY          VLETGK-----------------HPGELKDMVCSPGGTTIEAVRVLEERG--FRAAVIEA
A5I6R1_CLOBH          VLETGM-----------------HPGALKDMVCSPGGTTIEAVATLEKNG--FRNAIIEA
A0A0E1L194_CLOBO      VLETGM-----------------HPGALKDMVCSPGGTTIEAVATLEKHG--FRNAIIEA
A7GIC3_CLOBL          VLETGM-----------------HPGALKDMVCSPGGTTIKAVATLEKNG--FRNAIIEA
Q7BYC2_BACCR          VLETGI-----------------HPGELKDMVCSPSGTTIEAVVTLEEKG--LRTAIISA
B7HAA7_BACC4          VLETGI-----------------HPGELKDMVCSPGGTTIEAVVTLEEKG--LRTAIISA
Q6HGV3_BACHK          VLETGI-----------------HPGELKDMVCSPGGTTIEAVATLEEKG--LRTAIISA
A0A6H3AEP9_BACAN      VLETGI-----------------HPGELKDMVCSPGGTTIEAVATLEEKG--LRTAIISA
Q81C08_BACCR          VLETGI-----------------HPGELKDMVCSPGGTTIEAVATLEEKG--LRTAIISA
B3ZIM7_BACCE          VLETGI-----------------HPGELKDMVCSPGGTTIEAVATLEEKG--LRTAIISA
Q97E64_CLOAB          ILETGE-----------------HPGKLKDDVCSPSGTTIEAVYALEKSG--FRASVIAA
Q8Y9X2_LISMO          VLETGE-----------------HPGKLKDMVTSPGGTTIEAVKSLENDG--FRSAVINA
A8MFQ7_ALKOO          ILEKGL-----------------HPGELKDMVSSPGGVTIEGVYELEKRG--FRNMLIEV
A6TR68_ALKMQ          VLESNE-----------------HPGVLKDQVCSPAGSTIEALYVLEKNG--FRGTIIEA
Q8RA68_CALS4          VFKTGF-----------------HPGQLKDMVTSPGGTTIEGIRVLEKSG--MRSAVIEA
B0K1A6_THEPX          VLKTGF-----------------HPGQLKDMVTSPGGTTIEGIRILEKNA--MRSAVIEA
P5CR2_RAT             LLDSED-----------------HPGQLKDNVCSPGGATIHALHFLESGG--FRSLLINA
Q7UTG7_RHOBA          VRETGE-----------------HPGFLKDNVCSPGGTTIAAMSVLEQNA--VRGAMIQA
P5CR_METAC            ALETGM-----------------HPGELKDMVTSPAGTTIQGIHSLEEAG--IRAAFMNA
C0QCA7_DESAH          LLESKE-----------------HPGQLKDRVTSPGGTAIAGIHTLEQGG--LRTTMINA
Q2RK62_MOOTA          VLATGE-----------------HPGVLKDRVTSPAGTTIAGLAVLEDRG--VRGALIRA
Q74A50_GEOSL          LLETGD-----------------HPGVLKEKVTSPGGSTIAGIASLERDA--FRGAVMAA
Q2S2A0_SALRD          AIDTDK-----------------HPAILRDEVTTPGGTAIAAVSSLEEHG--LRTMLINA
D0MIZ9_RHOM4          VLETGR-----------------HPAILRDEVTTPGGTAIAAVAELEAHG--LRTMLINA
Q1IRM0_KORVE          VLETGQ-----------------HPAQLKDAVTTPAGCTIDGILELEEGK--LRVTLIKA
B4S5S7_PROA2          VLNGEK-----------------TPEELIREVTTPGGTTEAGLKQMDAHH--VRQAMIET
Q8KG91_CHLTE          VLSGHK-----------------SPEELVREVTTPGGTTEAGLKAMDERD--LRGALIDT
Q8F631_LEPIN          LRKEREKDPTT------------HPEVWKNKVTSPGGTTIAGLVELEKNG--FSNAVLEA
T2I2W1_BIFLN          YLKNET-----------------HPGVMKDAVCSPGGTTIKGVTSLEESA--FRGAVIKA
Q8G5S6_BIFLO          YLKNET-----------------HPGVMKDAVCSPGGTTIKGVTSLEESA--FRGAVIKA
A9KPJ8_LACP7          QIETGA-----------------HPGAMKDAVCSPGGTTIVGVATLERKG--LRSAVIEA
P5CR_TREPA            IQHSGV-----------------HPAQLKDRVCSPAGSTIRGVLALEEQG--LRRAVIHA
A5VID9_LACRD          AYDSKL-----------------APALLRDQVTSPAGTTIKGVEALEKNG--FRYAVMDA
Q831S6_ENTFA          ALDTKK-----------------HPGALKDEVTSPGGSTIRGVVALEKNG--FRYAVMDA
A3CMT2_STRSV          SQVSGQ-----------------HPAQLKDQVCSPAGSTIAGVASLEENA--FRGTVMDA
Q8DQ59_STRR6          VLESQQ-----------------HPGVLKDQVCSPGGSTIAGVASLEAHA--FRGIVMEA
A4VTT6_STRSY          VLTSDK-----------------HPAQLRQEVTSPGGSTIAGVVALEKEG--FRYAIIKA
D2BSY5_DICZ5          LKLSGC-----------------HPRQLMDINNSPAGVGINGLYELNKSD--FAAGLQSS
A0A0H3FY46_ZYMMA      LEISGK-----------------HPRQLLDINNSPAGVGMNSLFALNQSD--FTAGLQKS
P5CR_SYNY3            IKETE-----------------EHPAQIKDKVTSPGGTTIAGVAVLEKMG--FRSAIIEA
A0A0H3K800_SYNP6      LQETG-----------------WHPGELKDRVCSPGGTTIAGVATLEQNG--LRSALIEA
Q7NMR1_GLOVI          LIQEK-----------------LHPAVLKDRVTSPGGTTIAGIEQLEGRS--VRGAFIEA
Q2JKS6_SYNJB          LQQEN-----------------LHPAVLKDRVTSPGGTTIAGIQALEQAG--VRGALMQA
K9RUH8_SYNP3          LEEQN-----------------LHPGQLKDQVTSPGGTTITGLSILEAGG--VRGSLIKT
Q8DJK6_THEEB          LKERG-----------------LHPAQLKDAVASPAGTTIAGLEVLEAAG--MRGTLMQT
A3PBB4_PROM0          IKEKK-----------------LTTSELKNLVTSPGGTTISALRVLEKKS--VRSALIES
Q31CE2_PROM9          IKEKK-----------------LTTSELKNLVTSPGGTTISALRVLEKKG--VRSALIES
A9BE14_PROM4          LKESN-----------------LHPGELKDMVASPAGTTITALRHLEMAG--IRSALIEA
Q7VDI3_PROMA          LKKKE-----------------LHPGQLKDMVASPAGTTISALRHLEKEG--VRSALIEA
A5GJ84_SYNPW          LDQQQ-----------------LHPAQLKDMVASPGGTTIAALRVLEKAG--LRSALIEA
F8KX73_PARAV          LKETG-----------------MHPGQLKWKVSSPGGTTIAGLFKLEEKG--LRSALMET
P5CR_THET2            LKGR-------------------HPAQVKDEVASPGGTTIHGLHALEARA--VRAAFYEA
Q5SK00_THET8          LKGR-------------------HPAQVKDEVASPGGTTIHGLHALEARA--VRAAFYEA
Q9RU71_DEIRA          LLERA------------------HPGLLKDEVASPGGTTIAGLEELEAAG--VRGGVMRA
P5CR_SCHPO            VLQGQ------------------HPAMIRNDVSTPAGCTISGLLALEDGK--IRSTIARG
P5CR_NEUCR            VLEGE------------------HPAILREKVSTPGGCTIGGLLVLEEGG--VRAAVARA
P5CR_HELPJ            LEKE-------------------RPEMIIEQICTPKGATIEGLSVLEKKG--VRGAFIKA
E1S9U8_HELP9          LEKE-------------------RPEVIMEQICTPKGATIEGLSVLEKRG--VRGAFIKA
E8QH86_HELP7          LEKE-------------------RPEMIIEQICTPKGATIEGLSVLEKKG--VRGAFIKA
G2MAG2_HELPX          LEKE-------------------RPEMIIEQICTPKGATIEGLSVLEKKG--VRGAFIKA
P5CR_HELPY            LEKE-------------------RPEMIIEQICTPKGATIEGLSVLEKKG--VRGAFIEA
Q7M801_WOLSU          LEDR-------------------HPALIKEEVTSPGGTTAEALALLESKG--LRGILIEA
Q0P9H8_CAMJE          LEHE-------------------HPAIIKENICSPGGVTIKGIKILEQKG--IRGSFFEA
D1B3R8_SULD5          LKHE-------------------HPALLKDKVMSPAGTTAAGYAKLEEGK--VRDSFIKA
D1B951_THEAS          LLDSG-----------------DHPAELRDQVITPGGVTIEGLYELEEGR--VRTAFMRA
G7V6Z1_THELD          LLESG-----------------KHPAELRDMVLTPGGVTIDGIYELEESR--IRTAFMKA
Q8U084_PYRFU          LLNFE-----------------GHPAEIRDMVITPGGTTIDGIFELEEGK--IRTTIMKA
B6YWB3_THEON          LLESE-----------------NHPAEIRDMVITPGGTTIDGIFELEEGK--IRTAIMKA
Q9HLT6_THEAC          LAMSG-----------------DHPSAIKEKVITPGGVTIDGIYELENGK--IRTSIMKA
D0KSI7_SACS9          LKEGRI----------------DHPMLLRDQVTTPAGTTIRGLMVMEAKG--VKSALIET
Q97ZT3_SACS2          LKEGKI----------------DHPMLLRDQVTTPVGTTIRGLMVMEAKS--VKSALIET
A1S1A4_THEPD          LKNGFY----------------QHPAMLRDDVTTPAGTTIRGLMVLESGG--VKATLMKV
A2BJN9_HYPBU          LLENPD----------------VHPGVLRDEVITPAGTTIAAIRTLESRG--FKSAVIDA
B1L4V5_KORCO          LEETS-----------------MHPAQLRDLVTTPGGTTIAGISVMEEMR--VKSGIIYA
P5CR_AQUAE            LKEFQVN-----------------PNELIAKVTSPGGTTIEGIKYLEEKG--FKGTVMEC
Q9WZ47_THEMA          LTETGEH-----------------PALWKHRVSSPAGTTIEGLITMERFA--VRSGVIES
F9UL32_LACPL          VLASDKI-----------------PFDLIDQVSSPGGTTVAGLLAMEEAG--FMTAVVKG
Q836Y3_ENTFA          LANSTEN-----------------PWTLIDQVSSPGGTTVAGIVELENNA--FISTVIKG
Q9CEF7_LACLA          ILQSGEN-----------------PWSLVDKVSSPGGTTVAGVVSLEQNH--FIGTVIDA
A2RMV8_LACLM          LLQSGEN-----------------PWSLVDKVSSPGGTTVAGVVSLEQNH--FGGTVIDA
Q1J8V8_STRPF          LKTSSQS-----------------PHDFIDAICSPGGTTIAGLMELERLG--LTTTVSSA
Q8A6I2_BACTN          ILNHDT-----------------HPLLEIEKAATPGGATIKGLNELEHRG--FTSAVIHA
Q8A1A9_BACTN          ILNNDT-----------------HPSVEIDKVTTPGGITIKGINELEHNG--FTSAVIKA
A6GVR3_FLAPJ          LLEEKV-----------------HPEQLIDRVTTPQGCTIVGLNEMEHQG--FSSSLIKG
K4IB55_PSYTT          LITNGL-----------------HPEEEIDRVTTPKGCTIEGLNEMEHKG--LSSSLIQG
Q5KWY3_GEOKA          LKRNLYTL-----------------PTLQEKVCVKGGITGEGIAVLEQRMNGVFEEVLAK
A0A1M6IFX8_9BACI      LEKEIFTL-----------------PTLQEKVCVKGGVTGEGIRVLEEHVGDMFHKLIER
E1RHU1_METP4          LSGNDYDF-----------------SSLISGVATEGGITAEGLDVIEKEIPEVFDNVLSR
F6D4H6_METPW          LYEENMGV-----------------EDIISRVATPGGITEEGLKVLKRDLPPVFDELFKT
B8E0D3_DICTD          IREKNLSF-----------------EEVVKMTSSPAGTTIMGLETLHKEG--IVGIIMEA
Q04FB4_OENOB          ILQSGK-----------------TADQLVKKVASPGGSTADGVESLEENH--FIETVNNA
A0A0H3FVS2_ZYMMA      AKQADIT-----------------PAELADKVASPGGSTRKGMDVLDKDE-ALYQLMDAT
B9KWY6_RHOSK          LAGRIET-----------------APDLVETFRSYAGTTAAGLAAAERAG--FGAAPRAA
Q83FH8_TROWT          VLKHKT-------------------TAKGLLRLIPRGPRSAVVKCLDRTD--LGSVTYKV
                                                          *                       

B9IXD3_BACCQ          ITQAAQRSHNLGKTLEQLTKEK--------------------------------------
B7JLZ1_BACC0          ITQAAQRSHNLGKTLEQLTKEK--------------------------------------
Q818V7_BACCR          ITQATKRSHNLGKTLEQLTKEK--------------------------------------
Q5KXH0_GEOKA          IRRATARSEELGSALLAAIAEA--------------------------------------
P5CR2_BACSU           IEETAKRSAEIKEQFAGAALERHS------------------------------------
P5CR1_BACSU           IKHAAKRSKEISEDIEKTAAPLSGVIK---------------------------------
P5CR1_BACPZ           IKHAAKRSKEISDDIEKTAAPLSGVIK---------------------------------
A0A0H3DZV9_BACA1      IKNATDRSIEISENIEKATATL--------------------------------------
I0JJ37_HALH3          IKGAAGRSKELSKEIEGLLVGSK-------------------------------------
P5CR_STAAC            LNAAVDRSIELSNIEDQ-------------------------------------------
Q2FY68_STAA8          LNAAVDRSIELSNIEDQ-------------------------------------------
B7HJN3_BACC4          VEATNKKARGK-------------------------------------------------
Q81IX6_BACCR          VEATNKKARGK-------------------------------------------------
A7GKA6_BACCN          IEATNKKVRGK-------------------------------------------------
B5YHK4_THEYD          LQEATKRAQQLSVV----------------------------------------------
P5CR_MYCTU            VQAAKSRSEQLRITPE--------------------------------------------
P5CR_MYCTO            VQAAKSRSEQLRITPE--------------------------------------------
P5CR_MYCLE            VQAAKIRSEQLRITSE--------------------------------------------
A0QR08_MYCS2          VEAAKTRSEQLGITSE--------------------------------------------
Q82E92_STRAW          LEAARDRSRELASGSS--------------------------------------------
Q9X8G1_STRCO          LEAARDRSRELATGTKD-------------------------------------------
D7CHR5_STRBB          LEAARDRSRELASGNG--------------------------------------------
B1VT80_STRGG          LEAARDRSRELASGNG--------------------------------------------
A1SDY8_NOCSJ          MEAARDRSRALAEGS---------------------------------------------
P5CR_CORGL            AQACADRSEELGKR----------------------------------------------
Q6NJK7_CORDI          ATAAATRNSSLG------------------------------------------------
C5CCT6_MICLC          MDAAAQRDKEMAEEFGA-------------------------------------------
Q729L8_DESVH          ILAAYRRGQEMER-----------------------------------------------
Q312A7_DESAG          VLAAYEKGLAMRR-----------------------------------------------
A0A0A7PX55_PSEPU      LQAAATRSAELAEQLGK-------------------------------------------
Q1IGC4_PSEE4          LQAAATRSAELAEQLGK-------------------------------------------
P5CR_PSEAE            LNAASQRSAELAEQLGQ-------------------------------------------
Q8P757_XANCP          IAAATERGRSLSAAND--------------------------------------------
Q5H301_XANOR          IAAATERGRSLSAAND--------------------------------------------
B4SMF7_STRM5          LRAAQVRGQELSAAND--------------------------------------------
Q9PA08_XYLFA          IDAATRRARALGKANDTEPT----------------------------------------
Q83A21_COXBU          LTAAVNRAKELSKTVDQ-------------------------------------------
A9KDE3_COXBN          LTAAVNRAKELSKTVDQ-------------------------------------------
D3RQW6_ALLVD          ARAARDRAVELSKTLSEAP-----------------------------------------
D8KCA8_NITWC          LQAARDRARELAQELGSKHA----------------------------------------
B7J406_ACIF2          LAAAAERSRALGSPEKDIP-----------------------------------------
A9IM43_BORPD          IEAAAQRSRELASEFGK-------------------------------------------
Q7VYN6_BORPE          MQAAARRSRELAEEFGR-------------------------------------------
Q12GA3_POLSJ          IEAARQRAGELGDEFGAA------------------------------------------
A2SMB0_METPP          VRAAQRRAVELGDEFGG-------------------------------------------
Q63R27_BURPS          VLAAQARAREMGDELGGA------------------------------------------
G8QFZ1_AZOOP          VKAAEARGVELGQQLGAD------------------------------------------
Q46XH0_CUPPJ          MQAAAARGKEMGEEFGKD------------------------------------------
A0A0H3AHF1_VIBC3      MQAAVTRAQEMEQLF---------------------------------------------
Q9KUQ5_VIBCH          MQAAVTRAQEMEQLF---------------------------------------------
Q87LJ5_VIBPA          MQAAVARAEEMEKLF---------------------------------------------
Q7MHJ4_VIBVY          MQAAVARAQEMEKLF---------------------------------------------
Q5E7S2_ALIF1          MQAAVSRAEEMESLF---------------------------------------------
A0A0E1NSU5_YERPA      MRAAIARAKEMEKLF---------------------------------------------
Q666N4_YERPS          MQAAITRAKEMEKLF---------------------------------------------
Q15PG7_PSEA6          MQAAVTRAEEMAKLF---------------------------------------------
Q8EBZ1_SHEON          MENCINRAEEMAKTF---------------------------------------------
P5CR_HAEIN            MQACLSRSQEMETLF---------------------------------------------
Q5QY55_IDILO          VKAAVNRNQEMAKLF---------------------------------------------
Q5NER0_FRATT          IQANIARAQQLAIEFTKLIDN---------------------------------------
Q21EI2_SACD2          MQACSDRAQQLATELAK-------------------------------------------
A0A0D5YKR7_ACIBA      LKAAYHRSKEISLEINAEITRH--------------------------------------
V5VGV7_ACIBA          LAAAQKRSQELAQELSDSAK----------------------------------------
Q4FVC0_PSYA2          MQACYDRSQALSEEMSK-------------------------------------------
A9LZV3_NEIM0          VCACVRRSQEMERQYQ--------------------------------------------
Q5F5L8_NEIG1          VCACVCRSQEMERQYQ--------------------------------------------
Q9K1N1_NEIMB          VCACVRRSQEMERQYQ--------------------------------------------
Q3IWW7_RHOS4          VKAAADRGRELGR-----------------------------------------------
A3PP43_RHOS1          VKAAADRGRELGR-----------------------------------------------
A8IL23_AZOC5          VAEATHRSRELAG-----------------------------------------------
Q89DI5_BRADU          IAAATQRSKELAK-----------------------------------------------
F7X1E2_SINMM          IAAARKRAEELAG-----------------------------------------------
Q1MDM9_RHIL3          LAAARKRAEELAG-----------------------------------------------
Q7CXL8_AGRFC          VAAAKTRAEELAG-----------------------------------------------
Q2RP69_RHORT          IAAAAERSRELAS-----------------------------------------------
C0RLT4_BRUMB          VKAAHKRSVELGKS----------------------------------------------
Q7WAQ8_BORPA          VRQAQARSRELARP----------------------------------------------
Q9AAU9_CAUVC          LDAAVARSKELGG-----------------------------------------------
A9WFV0_CHLAA          IWAAYRRSVELGRNG---------------------------------------------
Q88GE6_PSEPK          LDAAARRSAELGQ-----------------------------------------------
D4GXS3_HALVD          VVAAERRSKELAEEFADE------------------------------------------
L9UT99_HALVD          VVAAERRSKELAEEFADE------------------------------------------
I7BLK2_NATSJ          VAAAEERSEELAAEFNDE------------------------------------------
M1Y5X6_NATM8          VGAAERRSRELAEAFENA------------------------------------------
Q18J37_HALWD          LTAATERSAELAAEVDHE------------------------------------------
P5CR_ECOLI            MTKCMEKSEKLSKS----------------------------------------------
Q3Z524_SHISS          MTKCMEKSEKLSKS----------------------------------------------
B2U3Y8_SHIB3          MTKCMEKSEKLSKS----------------------------------------------
Q32JD5_SHIDS          MTKCMEKSEKLSKS----------------------------------------------
Q1RFF8_ECOUT          MTKCMEKSEKLSKS----------------------------------------------
A0A0R9P6Y1_SALNE      MTKCMEKSEALSKS----------------------------------------------
Q8ZRF0_SALTY          MTKCMEKSEALSKS----------------------------------------------
A5I6R1_CLOBH          MRDCAIKSKEMSK-----------------------------------------------
A0A0E1L194_CLOBO      MRDCAIKSKEMSK-----------------------------------------------
A7GIC3_CLOBL          MRDCAIKSKEMSK-----------------------------------------------
Q7BYC2_BACCR          MKRCTQKSMEMSSLTSK-------------------------------------------
B7HAA7_BACC4          MKRCTQKSMEMSSLTSK-------------------------------------------
Q6HGV3_BACHK          MKRCTKKSMEMSSLTSK-------------------------------------------
A0A6H3AEP9_BACAN      MKRCTKKSMEMSRLTSK-------------------------------------------
Q81C08_BACCR          MQRCTQKSVELSGQTKK-------------------------------------------
B3ZIM7_BACCE          MQRCTQKSVELSGQTKK-------------------------------------------
Q97E64_CLOAB          VDACIKKSKLMSSK----------------------------------------------
Q8Y9X2_LISMO          VQAAAKKNSSM-------------------------------------------------
A8MFQ7_ALKOO          VEACERKTKSMKSKKVEE------------------------------------------
A6TR68_ALKMQ          MKACTHRAKELGLSEHKTHIE---------------------------------------
Q8RA68_CALS4          VIAAYQKAKGLK------------------------------------------------
B0K1A6_THEPX          VAAAYQKTKGLK------------------------------------------------
P5CR2_RAT             VEASCIRTRELQSMADQEKVSPAALKKTLLDRVKLESPTVSTLAPPSSGKLLTRNPAQGS
Q7UTG7_RHOBA          VQASANRSRELA------------------------------------------------
P5CR_METAC            VIRASERSKELGKK----------------------------------------------
C0QCA7_DESAH          VEAASKRSTELGELMIKNFAKNNEEE----------------------------------
Q2RK62_MOOTA          VEAATLRAGELE------------------------------------------------
Q74A50_GEOSL          VDAATARSAELGKK----------------------------------------------
Q2S2A0_SALRD          VGTATQRSEELNDE----------------------------------------------
D0MIZ9_RHOM4          VATATRRSQELSQLNNHD------------------------------------------
Q1IRM0_KORVE          VVKAAQRAKELVFS----------------------------------------------
B4S5S7_PROA2          VKAAAARSNELKQ-----------------------------------------------
Q8KG91_CHLTE          VRAAAARSKELMK-----------------------------------------------
Q8F631_LEPIN          VKAAANRSKELGV-----------------------------------------------
T2I2W1_BIFLN          VDAIEA------------------------------------------------------
Q8G5S6_BIFLO          VDAIEA------------------------------------------------------
A9KPJ8_LACP7          IDEIEKSRK---------------------------------------------------
P5CR_TREPA            VRAALSSS----------------------------------------------------
A5VID9_LACRD          VDKANGES----------------------------------------------------
Q831S6_ENTFA          VQQANHE-----------------------------------------------------
A3CMT2_STRSV          VQAAYKRTQELGNN----------------------------------------------
Q8DQ59_STRR6          VHQAYKRTQELGK-----------------------------------------------
A4VTT6_STRSY          VAAALKKTRKLGKK----------------------------------------------
D2BSY5_DICZ5          VLAAVRRTTELSGQK---------------------------------------------
A0A0H3FY46_ZYMMA      VLAAVKRTTELGQKKD--------------------------------------------
P5CR_SYNY3            VRAAYRRSQELGKK----------------------------------------------
A0A0H3K800_SYNP6      VKAAALRSQQLG------------------------------------------------
Q7NMR1_GLOVI          VQAATRRARELSG-----------------------------------------------
Q2JKS6_SYNJB          VRAAYERSCQLQGS----------------------------------------------
K9RUH8_SYNP3          IQVAQARAVELGQIAND-------------------------------------------
Q8DJK6_THEEB          VKAAYERSQALN------------------------------------------------
A3PBB4_PROM0          IVSASNRSKEFR------------------------------------------------
Q31CE2_PROM9          IVSASNRSKEFS------------------------------------------------
A9BE14_PROM4          VVLAAERSRELGC-----------------------------------------------
Q7VDI3_PROMA          VILAAKKSREMA------------------------------------------------
A5GJ84_SYNPW          VVAATERGRALR------------------------------------------------
F8KX73_PARAV          FLATYKRNQELGKKI---------------------------------------------
P5CR_THET2            VEAATRRGHELGESE---------------------------------------------
Q5SK00_THET8          VEAATQRGHELGESE---------------------------------------------
Q9RU71_DEIRA          VVAATRRGTELGKDQED-------------------------------------------
P5CR_SCHPO            IEQATKTASGLGK-----------------------------------------------
P5CR_NEUCR            VREATVVASLLGGGGAKNVNGTRH------------------------------------
P5CR_HELPJ            CHESVKKMRL--------------------------------------------------
E1S9U8_HELP9          CHESVKKMRPLKNCTPKNT-----------------------------------------
E8QH86_HELP7          CQKSVKKCASKNYTLKK-------------------------------------------
G2MAG2_HELPX          CQKSVEKMHPKNYTLKK-------------------------------------------
P5CR_HELPY            CHKSVKKMRL--------------------------------------------------
Q7M801_WOLSU          VRAALLKAKKL-------------------------------------------------
Q0P9H8_CAMJE          INASSAK-----------------------------------------------------
D1B3R8_SULD5          MEASYERAKGLSK-----------------------------------------------
D1B951_THEAS          VFAASAKAVELAETVRGQAEVRDSVENPRGVN----------------------------
G7V6Z1_THELD          ISAASSRARVLSEEVRRKAE--GEIEE---------------------------------
Q8U084_PYRFU          IDAATKKSKILSTRLSP-------------------------------------------
B6YWB3_THEON          VDAATKKSKILSVEIKK-------------------------------------------
Q9HLT6_THEAC          IESSTLKARKISKDLFPEESDKN-------------------------------------
D0KSI7_SACS9          IEASYKRAAEIGNEIDKSIRNNIK------------------------------------
Q97ZT3_SACS2          IEASYKRAVEIGNEIDKSIRNNSK------------------------------------
A1S1A4_THEPD          IEAAARRSREIGNEIDSRIREKINSRIGHTA-----------------------------
A2BJN9_HYPBU          VRDATLRAGEIAREIASMLDNSLGGSD---------------------------------
B1L4V5_KORCO          IKGASDRAKELGMHMESLVLAQT-------------------------------------
P5CR_AQUAE            INRTSQKAKKL-------------------------------------------------
Q9WZ47_THEMA          LISSYRRALELEEK----------------------------------------------
F9UL32_LACPL          IDATIAK--ELGES----------------------------------------------
Q836Y3_ENTFA          IEATILRDQELAKQD---------------------------------------------
Q9CEF7_LACLA          ISATIEKEKNL-------------------------------------------------
A2RMV8_LACLM          ISATIEREKHLK------------------------------------------------
Q1J8V8_STRPF          IDKTIDKAKSL-------------------------------------------------
Q8A6I2_BACTN          IKSSATVSTDKETEE---------------------------------------------
Q8A1A9_BACTN          MKASK-------------------------------------------------------
A6GVR3_FLAPJ          IKTSLQKIKG--------------------------------------------------
K4IB55_PSYTT          MVASFNKINNIKKEQI--------------------------------------------
Q5KWY3_GEOKA          THEKFKEDVEKVKQQFP-------------------------------------------
A0A1M6IFX8_9BACI      THEKFDEDLECVDQQFNKHT----------------------------------------
E1RHU1_METP4          MSEKHLRVEENSL-----------------------------------------------
F6D4H6_METPW          TIGKHEVLKKNSKS----------------------------------------------
B8E0D3_DICTD          ITSAKLRSEEISKYLEEGEA----------------------------------------
Q04FB4_OENOB          ILATINHGRKKFR-----------------------------------------------
A0A0H3FVS2_ZYMMA      LEASFKQNRYMAEKAKETIAQ---------------------------------------
B9KWY6_RHOSK          LAAATGKAREMTEAQRRRAREGAD------------------------------------
Q83FH8_TROWT          LLASIEQDSELLDGIIDQ------------------------------------------
                                                                                  

B9IXD3_BACCQ          ---
B7JLZ1_BACC0          ---
Q818V7_BACCR          ---
Q5KXH0_GEOKA          ---
P5CR2_BACSU           ---
P5CR1_BACSU           ---
P5CR1_BACPZ           ---
A0A0H3DZV9_BACA1      ---
I0JJ37_HALH3          ---
P5CR_STAAC            ---
Q2FY68_STAA8          ---
B7HJN3_BACC4          ---
Q81IX6_BACCR          ---
A7GKA6_BACCN          ---
B5YHK4_THEYD          ---
P5CR_MYCTU            ---
P5CR_MYCTO            ---
P5CR_MYCLE            ---
A0QR08_MYCS2          ---
Q82E92_STRAW          ---
Q9X8G1_STRCO          ---
D7CHR5_STRBB          ---
B1VT80_STRGG          ---
A1SDY8_NOCSJ          ---
P5CR_CORGL            ---
Q6NJK7_CORDI          ---
C5CCT6_MICLC          ---
Q729L8_DESVH          ---
Q312A7_DESAG          ---
A0A0A7PX55_PSEPU      ---
Q1IGC4_PSEE4          ---
P5CR_PSEAE            ---
Q8P757_XANCP          ---
Q5H301_XANOR          ---
B4SMF7_STRM5          ---
Q9PA08_XYLFA          ---
Q83A21_COXBU          ---
A9KDE3_COXBN          ---
D3RQW6_ALLVD          ---
D8KCA8_NITWC          ---
B7J406_ACIF2          ---
A9IM43_BORPD          ---
Q7VYN6_BORPE          ---
Q12GA3_POLSJ          ---
A2SMB0_METPP          ---
Q63R27_BURPS          ---
G8QFZ1_AZOOP          ---
Q46XH0_CUPPJ          ---
A0A0H3AHF1_VIBC3      ---
Q9KUQ5_VIBCH          ---
Q87LJ5_VIBPA          ---
Q7MHJ4_VIBVY          ---
Q5E7S2_ALIF1          ---
A0A0E1NSU5_YERPA      ---
Q666N4_YERPS          ---
Q15PG7_PSEA6          ---
Q8EBZ1_SHEON          ---
P5CR_HAEIN            ---
Q5QY55_IDILO          ---
Q5NER0_FRATT          ---
Q21EI2_SACD2          ---
A0A0D5YKR7_ACIBA      ---
V5VGV7_ACIBA          ---
Q4FVC0_PSYA2          ---
A9LZV3_NEIM0          ---
Q5F5L8_NEIG1          ---
Q9K1N1_NEIMB          ---
Q3IWW7_RHOS4          ---
A3PP43_RHOS1          ---
A8IL23_AZOC5          ---
Q89DI5_BRADU          ---
F7X1E2_SINMM          ---
Q1MDM9_RHIL3          ---
Q7CXL8_AGRFC          ---
Q2RP69_RHORT          ---
C0RLT4_BRUMB          ---
Q7WAQ8_BORPA          ---
Q9AAU9_CAUVC          ---
A9WFV0_CHLAA          ---
Q88GE6_PSEPK          ---
D4GXS3_HALVD          ---
L9UT99_HALVD          ---
I7BLK2_NATSJ          ---
M1Y5X6_NATM8          ---
Q18J37_HALWD          ---
P5CR_ECOLI            ---
Q3Z524_SHISS          ---
B2U3Y8_SHIB3          ---
Q32JD5_SHIDS          ---
Q1RFF8_ECOUT          ---
A0A0R9P6Y1_SALNE      ---
Q8ZRF0_SALTY          ---
A5I6R1_CLOBH          ---
A0A0E1L194_CLOBO      ---
A7GIC3_CLOBL          ---
Q7BYC2_BACCR          ---
B7HAA7_BACC4          ---
Q6HGV3_BACHK          ---
A0A6H3AEP9_BACAN      ---
Q81C08_BACCR          ---
B3ZIM7_BACCE          ---
Q97E64_CLOAB          ---
Q8Y9X2_LISMO          ---
A8MFQ7_ALKOO          ---
A6TR68_ALKMQ          ---
Q8RA68_CALS4          ---
B0K1A6_THEPX          ---
P5CR2_RAT             KRE
Q7UTG7_RHOBA          ---
P5CR_METAC            ---
C0QCA7_DESAH          ---
Q2RK62_MOOTA          ---
Q74A50_GEOSL          ---
Q2S2A0_SALRD          ---
D0MIZ9_RHOM4          ---
Q1IRM0_KORVE          ---
B4S5S7_PROA2          ---
Q8KG91_CHLTE          ---
Q8F631_LEPIN          ---
T2I2W1_BIFLN          ---
Q8G5S6_BIFLO          ---
A9KPJ8_LACP7          ---
P5CR_TREPA            ---
A5VID9_LACRD          ---
Q831S6_ENTFA          ---
A3CMT2_STRSV          ---
Q8DQ59_STRR6          ---
A4VTT6_STRSY          ---
D2BSY5_DICZ5          ---
A0A0H3FY46_ZYMMA      ---
P5CR_SYNY3            ---
A0A0H3K800_SYNP6      ---
Q7NMR1_GLOVI          ---
Q2JKS6_SYNJB          ---
K9RUH8_SYNP3          ---
Q8DJK6_THEEB          ---
A3PBB4_PROM0          ---
Q31CE2_PROM9          ---
A9BE14_PROM4          ---
Q7VDI3_PROMA          ---
A5GJ84_SYNPW          ---
F8KX73_PARAV          ---
P5CR_THET2            ---
Q5SK00_THET8          ---
Q9RU71_DEIRA          ---
P5CR_SCHPO            ---
P5CR_NEUCR            ---
P5CR_HELPJ            ---
E1S9U8_HELP9          ---
E8QH86_HELP7          ---
G2MAG2_HELPX          ---
P5CR_HELPY            ---
Q7M801_WOLSU          ---
Q0P9H8_CAMJE          ---
D1B3R8_SULD5          ---
D1B951_THEAS          ---
G7V6Z1_THELD          ---
Q8U084_PYRFU          ---
B6YWB3_THEON          ---
Q9HLT6_THEAC          ---
D0KSI7_SACS9          ---
Q97ZT3_SACS2          ---
A1S1A4_THEPD          ---
A2BJN9_HYPBU          ---
B1L4V5_KORCO          ---
P5CR_AQUAE            ---
Q9WZ47_THEMA          ---
F9UL32_LACPL          ---
Q836Y3_ENTFA          ---
Q9CEF7_LACLA          ---
A2RMV8_LACLM          ---
Q1J8V8_STRPF          ---
Q8A6I2_BACTN          ---
Q8A1A9_BACTN          ---
A6GVR3_FLAPJ          ---
K4IB55_PSYTT          ---
Q5KWY3_GEOKA          ---
A0A1M6IFX8_9BACI      ---
E1RHU1_METP4          ---
F6D4H6_METPW          ---
B8E0D3_DICTD          ---
Q04FB4_OENOB          ---
A0A0H3FVS2_ZYMMA      ---
B9KWY6_RHOSK          ---
Q83FH8_TROWT          ---