CLUSTAL format seed alignment for MF_01926

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PURS_ARCFU            -------------MIADVYIELKEGVADPEGEATLKAL-RLLGF-KRVKKVSTVKVFRID
C7M1W1_ACIFD          --------MSAHTWVALVVVEPRPGIADPEGRAITDAA-RHLEL-APGVNVSAGRAFRLE
Q9HJC6_THEAC          -------MFVYSIMKFRVEIRYKEGVEDPEAVTILKNF-NILGY-KGIRDVRTSKVYYID
Q97BA6_THEVO          -------------MKFKVEVSYKPGVEDPEALTLLKNL-NILGY-HEISNVSISKVYYFD
Q6KZR3_PICTO          -------------MKAKIEVTYLPNVEDPEALSIEKNL-SMLGY-NGIKGLSIKKIYEFT
PURS_METJA            ------------MYKATVIIKLKKGVLNPEGRTIQRAL-NFLGF-NNVKEVQTYKMIDII
B5IH32_ACIB4          ------------MLKATIIVKLKEGVDDPEGKTIKHSL-ELLNF-EGIKEVKVAKLYEIY
Q5JFP3_THEKO          -----------MKWKVKVIVRLKEGLNDPEGRVIGNAL-KNLGF-S-VENLRVPKYFEFE
Q8U493_PYRFU          -----------MRWRVRVLVRLKEGLNDPEGRVIGNAL-RNLGY-R-VEELRVPKCFEFI
PURS_METTH            -----------MKFMVEVRIRLKKGMLNPEAATIERAL-ALLGY-E-VEDTDTTDVITFT
I7CMW3_NATSJ          ----------MTAYTATVTVRLKQGVLDPEAETTKQAL-ERLGF-E-LEGLRSADRFEVD
Q9HNU1_HALSA          ----------MTAYTATVTVRLQHGVLDPEAETTQQAL-ERLGF-E-LDALRSADRFEID
D4GVC2_HALVD          ----------MTTYTATVTVRLKRGVLDPEAETTKRAL-ERLGF-E-LEALRFTERYEVD
C7NUP1_HALUD          ----------MSTYTATVTVQLKEGVLDPEAETTREAL-ERLGF-E-LDALRAADRFEID
A3CWL6_METMJ          -----------MKYTVAITIGLKEGMLDPEARAIRHAL-ANLMF-P-TDDLTTARLVRIT
Q8TPE9_METAC          ------MRLTKMQYQATVTIEQKAGMLDPEGTTAKRAL-GHLGY-A-VESVKTAKLYEIV
Q8TX84_METKA          ---------MTQLVTVEVRVSLKPKALDPEGETVKRAL-HRLGY-EEVEDVRTAKIYRIE
PURS_BACSU            ------------MYKVKVYVSLKESVLDPQGSAVQHAL-HSMTY-NEVQDVRIGKYMELT
Q81IQ5_BACCR          ------------MYKVKVYVTLRESVLDPQGTAVKGAL-HSLSF-TEVQDVRIGKYMELT
A0A0E0T8B0_GEOS2      ------------MYKVKVYVTLRESVLDPQGIAVKGAL-HSLSY-TEVKDVRIGKFMELV
Q92AN7_LISMO          ------------MYNVKVYVTLKKSVLDPQGVAVKDAA-KSMGY-EEVEDVRIGKFMELK
Q9RXT2_DEIRA          ----------MPHYQAKIYVTLRPSILDPQGRTVERAL-SHLNH-DNVGSVRIGKYIELN
Q833Y7_ENTFA          ------------MYFVKVYVTYKESILDPQGEAVKEAV-HRLGF-TEVAEIRVGKYFEMH
F9URK2_LACPL          ------------MYLVKIYVTYKQSILDPKGEAIHDAL-HRLGY-TNVDAVELGKYFEVK
B1MY36_LEUCK          ------------MYLAKIYVTYKPSILDPQGEVIKSAL-HRMDY-AGISQVTQGKYFEVK
Q02Y53_LACLS          ------------MTKVRVYVAYKASILDPQAQAIKAAT-HKMGY-QEVSDLNVGKFFDFD
Q9CFE6_LACLA          ------------MTKVRVYVAYKASILDPQAQAIKAAT-HKMGY-QEVTELNVGKFFDFE
PURS_SYNY3            MADSPVRPSMSHSYHCRIYVTLRPSVLDPAGTAVQSGL-QQLGY-DGVSQVRIGKYIELT
Q7NNG9_GLOVI          -----------MHYKATIRVTLRPSVLDPAGVAVRSGL-QQLGY-ASVANVRIGKYIELE
Q2JWK1_SYNJA          -----------MQFQAQIQIHLRPSVLDPAGAALQASL-HRLGH-TQVQGVRIGKHIQLR
Q8DGX7_THEEB          ----------MAQFQAQVFVTLRPSVLDPAGVAVQAGI-HHLGY-TNVQSVRIGKLVELT
Q7VC89_PROMA          ----------MPNFKAKVQVSLRPSVLDPAGEAAKSAA-IKLGV-KGISKVRIGKAIDIE
Q2S3Y6_SALRD          ------------MYKATISITLRPSILDPEGKTIQHAL-TNLGY-DAVDQVRMGKQAEVW
Q8KCS4_CHLTE          -----------MAFKAKIKVTLRPSILDVQGKAAQHAL-ENLGY-SSVESIRIGKYIEVI
A0R4H2_MYCS2          ---------MNAVAKVVVHVMPKAEILDPQGQAIVGAL-GRLGH-KGISDVRQGKRFELE
I6Y8S6_MYCTU          ------------MARVVVHVMPKAEILDPQGQAIVGAL-GRLGH-LGISDVRQGKRFELE
PURS_MYCLE            ------------MARAVVHVMLRAEILDPQGQAIAGAL-GRLGH-TGISDVRQGKRFELE
F6EKG8_HOYSD          ------------MARVVVSVMPKAEILDPQGQAIVRAL-PRLGF-DGVTEVRQGKRFELE
C4LH50_CORK4          ------------MARVVVNVMPKTEILDPQGQAVLRAL-GRIGV-NGVRDVRQGKRFELD
D9QCA6_CORP2          ------------MARVVVNVMPKAEILDPQGQAVVRAL-GRIGV-TGVADVRQGKRFEIE
Q8NMI3_CORGL          ------------MARVVVNVMPKAEILDPQGQAVHRAL-GRIGV-SGVSDVRQGKRFELE
Q9RKK7_STRCO          ------------MARVVVDVMLKPEILDPQGQAVQRAL-PRLGF-EGISDVRQGKRFELE
B5GT56_STRCL          ----------MPVARVVVDVMLKPEILDPQGQAVQRAL-PRLGF-DGIADVRQGKRFELE
D7B9D5_NOCDD          ------------MARVVVDVMLKPEILDPQGQAIAGAC-SRLGF-EGIEQVRQGKRFEVE
F8B1X4_9ACTN          -----------------MDVMLKPEILDPQGQAILAAL-PRLDV-SGIAGVRQGKRFELE
D1C000_XYLCX          ------------MGRVVVEVMPKPEILDPQGKAVVGAL-PRLGF-TQFTSVRQGKRFELE
A6WFE4_KINRD          ------------MGRVVIDVMPKPEILDPQGKAVVGAL-PRLGF-DLFTSVRQGKRFELE
C7NLB6_KYTSD          ------------MGHVIVDVMPKPEILDPQGKAIAGAL-PKLGI-EGFTEVRQGKRFVLA
A1SPU5_NOCSJ          --------------------MPKPEILDPQGKAVLGAL-PRLGF-SGVTDVRQGKRFELE
A5CNW9_CLAM3          ------------MPTIVVEVMPKAELLDPQGKAVAGAL-ARLGK-DRFTGVRIGKRFELT
Q83FE6_TROWT          -------------<KIIIDVMPKPGLLDPQGRAIASVL-TERGW-DNSTRIRVGKRFELC
Q2FZJ2_STAA8          ------------MKTIELHITLQPQVLDTQGQTLTRAV-HDLGY-AQVNDIRVGKVLYMT
Q8F0I1_LEPIN          ------------MYIAKIQVVLKESVLDPQGSTVKKVL-SEVGE-KSVQDVRVGKYIELK
D1B9P3_THEAS          -----------MNYQISALIFPKRGVLDTQGRAVMGTL-VEMGF-RSVRDVSVGRFVRLS
N8NGB2_BRUOV          ------------MIKARVTVTLKNGVLDPQGKAIVGAL-GSLGF-DGVSSVRQGKVFDLE
Q8UEB6_AGRFC          ------------MIKARVTVTLKNGVLDPQGKAIEGAL-GSLGF-DGVGHVRQGKVFDLE
F2J483_POLGS          -------------MKARVTVTLKNGVLDPQGKAIEGAL-GALGF-SGIGGVRQGKVFDIE
B6JBP1_OLICO          -------------MKARVTVTLKNGILDPQGKAIEGAL-KSLGV-SGIASVRQGKVFDIE
Q3ST25_NITWN          -------------MKARVTVTLKAGVLDPQGKAIEGAL-KSLGV-DGIASVRQGKVFDIE
Q89IB1_BRADU          -------------MKARVTVTLKTGILDPQGKAIEGAL-KSLGV-AGVASVRQGKVFDIE
J7Q533_METSZ          -------------MKARVVVTLKSGVLDPQGKAIEGAL-KSLGV-EGVASVRQGKVFDVE
Q2RWI1_RHORT          ------MSKEYPTVKAKVHITLKSGVLDPQGKAIANAL-AHLGF-DGLGEVRQGKVIEIE
Q3J4K3_RHOS4          -------------MKARVHVMLKDGVLDPQGEAVKHAL-GTLGF-SGVEGVRQGKVIELD
Q9A5F8_CAUVC          -------------MKATVHVFLKPGVLDVQGKAVENAL-HGLGW-PSVKDARVGRVIEFD
Q0PB02_CAMJE          -------------MEVIVNISLKNGVLDPQGKAVEKAL-HSLNF-NSVKEVKIAKQIKIS
Q2RGU3_MOOTA          ------------MLLAKIHVTLKPGVLDPQGEAVGKGL-KAMGY-GGVAAVRVGKYLEIM
Q1ISZ9_KORVE          -------------MKAYVYVSLKKSVLDPQGKTIHGAL-NKMGY-KGLADVRQGKYFEIQ
B8E0V9_DICTD          ----------MKKWTVILEIFLKEGIFDPQGKTVKDAL-HNLGF-KEVEEVRIGKVLKID
Q5SI58_THET8          ----------MPRYQATLLIELKKGILDPQGRAVEGVL-KDLG--HPVEEVRVGKVLEIV
A9A5G2_NITMS          ----------MATYNVHVTIENKPGISDPEGDTILNDLVLKGTH-KTVSKIKTAKMLKFT
A0RUH2_CENSY          ----------MPEFEILVTIGNKPGISDPEGDTILKDLVLRGGY-KTVSRIRTAKTLKFT
A8AAS4_IGNH4          ----------MNEYLVEVIIRNKRVARDPEGETIKNELVSRSSLADSIKEVRSGKWLLFT
Q97ZQ8_SACS2          -----------MKYYVELIIINKDSVRDPEGETIQKYVIEKY-T-NNIIETRVGKYIQFK
C4KHN9_SULIK          -----------MKYYVELIIINKDSVRDPEGETIQRYVIEKY-T-NNIIETRVGKYIQFK
F4FZA6_METCR          ------------MIKVELIIINKDGVRDPEGETLKRYVVDEVGK-DKVADVRVGKVIVIK
PURS_THEMA            ----------MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGL--PVKKLRLGKSIHLE
                                                 :  .                           . 

PURS_ARCFU            IEARSREEAEREIAEMCEKL-LANPVIQKYSIVWRE------------------------
C7M1W1_ACIFD          LRAVDERDALDQASVLAERL-LANPVIQTWRIAELEVVAP--------------------
Q9HJC6_THEAC          ADDR------DEVSEITSKI-LANPVIHTYTIEAIEGSSH--------------------
Q97BA6_THEVO          AGNE------EEVKQVADKI-LSNPVIHSYKVEKLG------------------------
Q6KZR3_PICTO          LDDDS----YNVLDEIAGRI-LTNPVIQSYKIIRD-------------------------
PURS_METJA            MEGENEEKVKEEVEEMCKKL-LANPVIHDYEIKVEKIE----------------------
B5IH32_ACIB4          LDLPLED-GKKEVEEMIKKL-LVNPIIHDYEFRVEEI-----------------------
Q5JFP3_THEKO          LESE---RPEEEVEEMCRKL-LANPLIHEWEYSIEPVS----------------------
Q8U493_PYRFU          LESD---NPEKDVEEMCRRL-LANPLIHTWEYTIEEW-----------------------
PURS_METTH            MDEDSLEAVEREVEDMCQRL-LCNPVIHDYDVSINEMEG---------------------
I7CMW3_NATSJ          LDADSVAAARERADEMAERL-LANPTIHDYDVEVAER-----------------------
Q9HNU1_HALSA          LDADDEQAAAERADEMAHRL-LANPTIHDYDVAVEARE----------------------
D4GVC2_HALVD          LDAADADEAEARADEMAERL-LANPTIHDYEVAVAEA-----------------------
C7NUP1_HALUD          LEATDSEAARDRVEEMAERL-LANPTIHDYEVAVEQ------------------------
A3CWL6_METMJ          LDAPDAVAAREEAARMCELL-LANPIIHDYTIEVE-------------------------
Q8TPE9_METAC          LEAESAEVAEQKVDEMCQKL-IANPIIHNYTIKLKELN----------------------
Q8TX84_METKA          LDINDEEEAVELVDEMCRRL-LANPVVEDYEIEVVE------------------------
PURS_BACSU            IEKSDR-DLDVLVKEMCEKL-LANTVIEDYRYEV-----------EEVVAQ---------
Q81IQ5_BACCR          IDKSVS-DLDSKVKEMCEKL-LANVVMEDFRYEV-----------EEVVAQ---------
A0A0E0T8B0_GEOS2      IEESDR-DINELVREMCEKL-LANPVIEDYRYEI-----------EEAVAR---------
Q92AN7_LISMO          VAKSDR-DIHEVLNEMCDKL-LTNPVMEDYRYEI-----------EEA------------
Q9RXT2_DEIRA          LSGEKA-DVEAQLKDIVENV-LSNPIMEDARWEL-----------EEVQ-----------
Q833Y7_ENTFA          VQQTE--AIEEKIEQICDQL-LANVNMESYRFEI-----------LSLEEI---------
F9URK2_LACPL          IHADDR-PVAAEIDEMCDRL-LANVNMETYRYEI-----------TEMEAL---------
B1MY36_LEUCK          LNAKDVDAATAEVESFTTAL-LINQNTETYRFDL-----------SLVEDEVTL------
Q02Y53_LACLS          FDAEAE-LAKEKATEIANEL-LANPNMETYKVEI-----------LTEQSEGVKK-----
Q9CFE6_LACLA          FDAEAE-IARAKAIEIANEL-LANPNMETYKVEI-----------LNEQSEGAN------
PURS_SYNY3            LEAPDEATASQQLDTMCDQL-LANTVIENYCFEI-----------TALEGAVTP------
Q7NNG9_GLOVI          LEADNDAEARHQVDRLCDQM-LANPVIEVYKFEV-----------VALEAARR-------
Q2JWK1_SYNJA          LEAPDAETAREQVNELCEQL-LANPVIETYQIQV-----------DPVES----------
Q8DGX7_THEEB          LEAGDRATAEAQLGHIADQL-LANPVIETFRIEL-----------QELATAAE-------
Q7VC89_PROMA          IEAPNKQDAIEQVEILSDRL-LSNPVIENWSLQL-----------DSAYSSNHD------
Q2S3Y6_SALRD          IDAASEAEAREVATEACEKL-LANPVTENFEIQI-----------ESASREAVGEGTA--
Q8KCS4_CHLTE          IGEDFRAEAEQVCTEICQKL-LSNPIMEDFSFEL-----------VPVN-----------
A0R4H2_MYCS2          VDDSVTDETLNEI---AESL-LANTVIEDFTVSR-----------EDA------------
I6Y8S6_MYCTU          VDDTVDDTTLAEI---AESL-LANTVIEDWTISR-----------DPQ------------
PURS_MYCLE            IDDTVDDSELAMI---AESL-LANTVIEDWTITR-----------ESQ------------
F6EKG8_HOYSD          VDDAIDDATLAKI---AESF-LANTVIEEWTVTR-----------VDGGE----------
C4LH50_CORK4          VDGSVSDEELDRL---ASTL-LANTVIEDYDVVA-----------ERADDSDATPVTSTS
D9QCA6_CORP2          TDGSVSREDLEKV---AETL-LANTVIEDFDVII-----------EGA------------
Q8NMI3_CORGL          VDDSVTEADLKKI---AETL-LANTVIEDFDVVG-----------VEVAK----------
Q9RKK7_STRCO          VDGPVDDAALARIHDLAESF-LANTVIEDFTVKV-----------ESEDVVAGAAK----
B5GT56_STRCL          VEGPVDEAALARIHEMAETF-LANTVIEDFIVKV-----------ES-------------
D7B9D5_NOCDD          VEGAVDEAKLADVRRLAETL-LANTVIEEYSVRV-----------ED-------------
F8B1X4_9ACTN          VDGDADADVLARIDQLAASL-LANPVIEDYVVRV-----------EPPQPAQASPAEANA
D1C000_XYLCX          VEGDVTPEVLAAAQQAAETL-LSNPIIEDVVNVF-----------DATQVPA--------
A6WFE4_KINRD          VAGEVTPEVLAQARRAAETL-LSNPVIEDVVSVR-----------EADPAEASA------
C7NLB6_KYTSD          VDGEVTDAVLSSAREAATTL-LSNPVIEDVVSVR-----------EATAAELEADKAQEA
A1SPU5_NOCSJ          VDGELTDEVLEQVRQMAATL-LSNPVIEDFTVAV-----------ETIPTVVEAAESHS-
A5CNW9_CLAM3          VEGEVDDALLADVQSLAADM-LSNSVIEDVISVHVAGLDGFGISAEADMATGNVTDDHTV
Q83FE6_TROWT          VDPVSETCELDFIRDLANDL-LINPVIEDVVDIRI----------EDD------------
Q2FZJ2_STAA8          VDEVSDEKVHNIITTLSEKL-FANTVIEEYSYKVL----------DDEKENA--------
Q8F0I1_LEPIN          IDAPSEEVARKDVERLCDKI-LVNHIIETYSMNI-----------QKI------------
D1B9P3_THEAS          IEAEDQASALSTARRICQEL-LANELIEDFSLKE-----------GDLSL----------
N8NGB2_BRUOV          LEGSDKAKAEADLKAMCEKL-LANTVIEDYSIAIA-------------------------
Q8UEB6_AGRFC          LEGADKAKAETDLKAMCEKL-LANTVIENYAISIL-------------------------
F2J483_POLGS          LDGRDAAAARTDLAAMCEKL-LANTVIENYSIEIL-------------------------
B6JBP1_OLICO          LDGADKAKAEAALKAAADKL-LANTVIENYRVEVLG------------------------
Q3ST25_NITWN          LDG-DKTKAEAALKAAADKL-LANTVIENYRVEVLG------------------------
Q89IB1_BRADU          LAGADKAKAEAALKEAADKL-LANTVIENYRVEIV-------------------------
J7Q533_METSZ          LAGADAVAAKAQLQTACEKL-LANTVIENYQIDV--------------------------
Q2RWI1_RHORT          LAETDPAKARDSVDAMCRKL-LANTVIENYAIEIA-------------------------
Q3J4K3_RHOS4          LTATDRAEAEAEVRRMCEKL-LANTVIEKYTVEIA-------------------------
Q9A5F8_CAUVC          LDATDAEAAKAEVKTMCEKL-LANTVIESYRIDVA-------------------------
Q0PB02_CAMJE          LDEKDEKLAKEQVKKMCEEL-LVNSVIEDYELIIEKE-----------------------
Q2RGU3_MOOTA          LNLDDREEAGRLVEEMCRRL-LANPVIEEYRYSLEDVAGVSTEGPLMRDATKASQR----
Q1ISZ9_KORVE          LDGLNHDQAKAEVERAAKEV-LTNPVIEEYRYSIEE------------------------
B8E0V9_DICTD          ILGENKEEIISKVKKMSEIF-LANPVTEDFVIRVEE------------------------
Q5SI58_THET8          FPAENLLEAEEKAKAMGAL--LANPVMEVYALEALKELP---------------------
A9A5G2_NITMS          IKEKDKKTAQSKVQEICDDLRIYNPMVSKVTIDVFDA-----------------------
A0RUH2_CENSY          ITEETKEEAIEAVKKACDGLRIYNPLVSAATIRVSGA-----------------------
A8AAS4_IGNH4          VLAEDEREALQKVEKLCKEMRIFNPVVHEMEVRPYQGGRA--------------------
Q97ZQ8_SACS2          IEANNEEDAKNLIEKIANEGRLYNPIIHKILVRVRRE-----------------------
C4KHN9_SULIK          IEANNEEDAKNLIEKIAREGRLYNPIVHKIFVRVRKE-----------------------
F4FZA6_METCR          VNSSSREEAEKFVTRLAEEKRLYNPIVHKVIVRSEKIEDGNN------------------
PURS_THEMA            VEAENKEKAYEIVKKACEEL-LVNPVVEEYEVREL-------------------------
                                           : *                                    

PURS_ARCFU            -------------------------
C7M1W1_ACIFD          -------------------------
Q9HJC6_THEAC          -------------------------
Q97BA6_THEVO          -------------------------
Q6KZR3_PICTO          -------------------------
PURS_METJA            -------------------------
B5IH32_ACIB4          -------------------------
Q5JFP3_THEKO          -------------------------
Q8U493_PYRFU          -------------------------
PURS_METTH            -------------------------
I7CMW3_NATSJ          -------------------------
Q9HNU1_HALSA          -------------------------
D4GVC2_HALVD          -------------------------
C7NUP1_HALUD          -------------------------
A3CWL6_METMJ          -------------------------
Q8TPE9_METAC          -------------------------
Q8TX84_METKA          -------------------------
PURS_BACSU            -------------------------
Q81IQ5_BACCR          -------------------------
A0A0E0T8B0_GEOS2      -------------------------
Q92AN7_LISMO          -------------------------
Q9RXT2_DEIRA          -------------------------
Q833Y7_ENTFA          -------------------------
F9URK2_LACPL          -------------------------
B1MY36_LEUCK          -------------------------
Q02Y53_LACLS          -------------------------
Q9CFE6_LACLA          -------------------------
PURS_SYNY3            -------------------------
Q7NNG9_GLOVI          -------------------------
Q2JWK1_SYNJA          -------------------------
Q8DGX7_THEEB          -------------------------
Q7VC89_PROMA          -------------------------
Q2S3Y6_SALRD          -------------------------
Q8KCS4_CHLTE          -------------------------
A0R4H2_MYCS2          -------------------------
I6Y8S6_MYCTU          -------------------------
PURS_MYCLE            -------------------------
F6EKG8_HOYSD          -------------------------
C4LH50_CORK4          ANEGAN-------------------
D9QCA6_CORP2          -------------------------
Q8NMI3_CORGL          -------------------------
Q9RKK7_STRCO          -------------------------
B5GT56_STRCL          -------------------------
D7B9D5_NOCDD          -------------------------
F8B1X4_9ACTN          VRAEPTT------------------
D1C000_XYLCX          -------------------------
A6WFE4_KINRD          -------------------------
C7NLB6_KYTSD          TA-----------------------
A1SPU5_NOCSJ          -------------------------
A5CNW9_CLAM3          AEGGTAETNAAAHPLPHGSAAAEQR
Q83FE6_TROWT          -------------------------
Q2FZJ2_STAA8          -------------------------
Q8F0I1_LEPIN          -------------------------
D1B9P3_THEAS          -------------------------
N8NGB2_BRUOV          -------------------------
Q8UEB6_AGRFC          -------------------------
F2J483_POLGS          -------------------------
B6JBP1_OLICO          -------------------------
Q3ST25_NITWN          -------------------------
Q89IB1_BRADU          -------------------------
J7Q533_METSZ          -------------------------
Q2RWI1_RHORT          -------------------------
Q3J4K3_RHOS4          -------------------------
Q9A5F8_CAUVC          -------------------------
Q0PB02_CAMJE          -------------------------
Q2RGU3_MOOTA          -------------------------
Q1ISZ9_KORVE          -------------------------
B8E0V9_DICTD          -------------------------
Q5SI58_THET8          -------------------------
A9A5G2_NITMS          -------------------------
A0RUH2_CENSY          -------------------------
A8AAS4_IGNH4          -------------------------
Q97ZQ8_SACS2          -------------------------
C4KHN9_SULIK          -------------------------
F4FZA6_METCR          -------------------------
PURS_THEMA            -------------------------