CLUSTAL format seed alignment for MF_01927

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

K9ZLA2_ANACC          -------------------------MTKPTATLLISCPDQRGLVAKIANFIYSNGGNIIH
B2J869_NOSP7          ------------------------MMTNPTATLLISCPDQRGLVAKFANFIYSNGGNIIH
Q8YWJ0_NOSS1          -------------------------MTNPTATLLISCPDQRGLVAKIANFIYANGGNIIH
K9RT10_SYNP3          -------------------------MSIPTATLLVSCPDQRGLVAKLSQFIYSNGGNIIH
K9Z549_CYAAP          -------------------------MAVDTATLLVSCPDQQGLVAKIANFIYANGGNIIH
PURU_SYNY3            -------------------------MQNLTATLLVSCPDQPGIVAQIAQFIYQNQGNIIH
Q3AVM7_SYNS9          ------------------------MVSEATVILQMICPDRSGLVSDLAGWVAANGGNIRH
O67681_AQUAE          ---------------------------MQNAILLVSCPDRKGLVKEISSFIADNGGNIVS
Q1GYI8_METFK          --------------MAVLRFKAARATMKNTATLLVTCPDRKGIVASIADFLYRHDANILH
PURU_BACSU            -MKSYMTQRLDEYRDGN----------EDKGRLLVSCPDQPGIVSAVSAFLFEHGANIIE
G8U094_SULAD          -----MSTR-------------------TPFRLLIACPDRPGIIAHVSSTLAHHGANITA
PURU_MYCBO            MGKGSMTAHATPNEPDYPPPPGGPPPPADIGRLLLRCHDRPGIIAAVSTFLARAGANIIS
PURU_MYCTU            MGKGSMTAHATPNEPDYPPPPGGPPPPADIGRLLLRCHDRPGIIAAVSTFLARAGANIIS
Q6N2L8_RHOPA          -------------------------MPHHQYVLTLSCPDRAGIVSAVSTFLFENGQNILD
D3P1G1_AZOS1          -------------------------MPVTQAVLTLSCPNQPGIVARVSTYLFEQGCNIGE
Q9A2D5_CAUVC          ------------------------------MILTLSCPDQRGIVAKVSAFLFERGCNILD
Q2G4C5_NOVAD          --------------------------MSASLILTLSCEDKPGIVARVTGNLFEAGGNIRE
B6A334_RHILW          ---------------------------MKNVVLTVSCKSTRGIVAAISSYLADKGCNIID
Q1MMT0_RHIL3          ---------------------------MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVD
A9CG96_AGRFC          ---------------------------MTNFVLTVTCKSTRGIVAALSGLLAEKGCNIVD
Q3IZA8_CERS4          ---------------------------MPKFVLTVTCPTRRGIVAAISTFLADHGCNITD
Q47WX7_COLP3          --------------------MSDIKPVSQTHIITADCPSRPGTVDVVTRFLCEKGFYINE
Q47Y32_COLP3          --------------------MSDIKPVSQTHVITASCPSQPGTVDVVTRFLFEQGFYINE
B1YZQ7_BURA4          ---------------------MTADSRPDQFVLTLSCPSAAGQVAAVVGFLERHRCYVDA
A2RYN4_BURM9          ---------------------MSVPQRPHQFVLTLSCPSAAGQVAAVVGLLDRHRCYVDE
Q8PDM5_XANCP          --------------------MAIISPMRSDYILTLSCPDRTGIVYRVTGLLFDLACNILD
Q87CM9_XYLFT          --------------------------MRHDYILTLSCPDCTGLVYRISGELFRAGCNILD
G4QCF9_TAYAM          ---------------------------MKHYILTLSCPDRTGIVHTVSGFLLNLGGNIID
Q72BU4_DESVH          --------------------------MPSAYILTIACPDRIGIVATVSTFLAVQQCNIID
C5ADI4_BURGB          ------------------------MSTDHSFILKLSCPDKHGIVHAVSGFLFERDTNIVD
C6BJB1_RALP1          -------------------------MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILD
Q21I43_SACD2          ------------------MSAGSSSNKVSELILKFSCDDQPGIVASVASLFSLQGFNIRE
Q6A6Z6_CUTAK          ------------------------MSESHELVVTWTSPDRPGLVHAVTGACAQVGGNLTE
G0FKX9_AMYMS          ---------------M--------TAPERRYVITFGCPDRTGIIARISGFLAEHGGWIVE
Q5YP34_NOCFA          ----------MSPAVP--------SQEDRRYVLTLGCPDRPGIIARITSFIAEFGGSISE
A4QB23_CORGB          ----------MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAERGGWITE
C1DSM7_AZOVD          ---------------------------MRTFRLVIACPDRVGIVAKVSNFLATYNGWITE
A0A1G3DDG3_9GAMM      ---------------------------MRTFRLVIACPDGVGIVAKVSNFLATYNGWITE
A6VAY3_PSEA7          ---------------------------MRTFRLVIACPDGVGIVAKVSNFLATYNGWITE
Q3K7T1_PSEPF          ---------------------------MRTFRLVISCPDRVGIVAKVSNFLAAHNGWITE
F2JWM9_MARM1          --------------------------MKNHYRLVISCPDRVGIVAAVSQFLNERQGSIVE
PURU_ECOL6            ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
A0A0H3MKN8_ECO7I      ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
PURU_SHIFL            ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
PURU_ECOLI            ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
B2TZX6_SHIB3          ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
A8AG34_CITK8          ------------------------MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
A0A0H3BS69_SALNS      ------------------------MQSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
A4WBA0_ENT38          ------------------------MQSLQRKVLRTICPDQKGLIARITNICYKHELNIVQ
E0SBD2_DICD3          ----------------------MQSQNIQRKILRTICPDAKGLIAKITNICYKHELNIVQ
C7BIH6_PHOAA          ----------------------MPHQNIQKKILRTICPDAKGLIAKITNICYKHQLNIVQ
Q7N450_PHOLL          ----------------------MQHQHIQKKILRTICPDAKGLIAKITNICYKHQLNIVQ
PURU_HAEIN            --------------------------MIEKKILLTDCPDDKGLIAKITNICYKHQLNILH
C3LNU3_VIBCM          ---------------------------MEKKTLLTHCPDAPGLISKITNICYKHQLNIIH
A3D2K0_SHEB5          --------------MTETRGN--NSPSIERKILLTDCADAQGLIAKITSVCFTHKLNIIK
Q085E7_SHEFN          --------------MSHQDKTIITQANLQRKVLITDCADAQGLIAKITNVCFAHQLNIIK
A0A1I7D8L8_9GAMM      ----------------------------MSYILTTQCADDIGLIAKITGLCHRHNLNIIR
A6Q2Y4_NITSB          ---------------------------MKTYRVLIDCKDQKGLVFHISKIFFDNNLNIEK
A0Q5K7_FRATN          ---------------------------MQKYRLLIETDDQKGLVYKVSKIIFENSLNVER
A0A649PT53_CAMJU      ----------------------------MISVLKICTKDQKGLIYRISDVIFKYHINIVK
Q0PAA0_CAMJE          ----------------------------MISVLKICTKDQKGLIYRISDVIFKYHINIVK
F0SBM4_PSESL          ------------------------------MVIVIQCKDKVGLVADIAGVMAKFNINILT
O25975_HELPY          ---------------------------MLEFILKIQARDSKGLVSTISTTIANKGYNIVK
D6XRW0_HELPV          ---------------------------MLEFILKIQARDSKGLVSAISTTIANKGYNIVK
E8QJY9_HELP4          ---------------------------MLEFILKIQAKDSKGLVSAISTTIANKGYNIVK
                                                      :        * :  .          :  

K9ZLA2_ANACC          ADQH-TDFAAGLFLTRLEWQLDGFNL-------PRDLIAKAFNAIAQ-------PLNAKW
B2J869_NOSP7          ADQH-TDFAAGLFLTRIEWQLEGFNL-------PREFIAPAFNAIAQ-------PLSAKW
Q8YWJ0_NOSS1          ADQH-TDFAAGLFLTRIEWQLEGFNL-------PREIIGAAFNAIAQ-------PLGAKW
K9RT10_SYNP3          ADHH-TDAQAGLFLTRLEWQLDGFHL-------PRELIGPAFQAIAQ-------PLQAQW
K9Z549_CYAAP          ADHH-TDLEAGLFLSRIEWQLQGFNL-------PRHLINEAFGELAQRHFVTASPLQAKW
PURU_SYNY3            ADQH-TDFSSGLFLNRVEWQLDNFRL-------SRPELLSAWSQLAE-------QLQATW
Q3AVM7_SYNS9          ADHH-TDVGAGLFLSRIEWTLDGFGI-------PRQALPEAACALAD-------RLKGQV
O67681_AQUAE          FDQH-IDEQTKTFLARVEWSLEDFKI-------PREKIENEFKKVAQ-------KFSMNF
Q1GYI8_METFK          ADQH-QDAENNLFLMRVEFDLEGAKV-------TLDNFPGHFSSIAD-------QFSMNW
PURU_BACSU            SNQYTTDPEGGRFFLRIEFDCAGIRE-------KKSSLQAAFAS-VAE------KFDMTW
G8U094_SULAD          FDQHSEGGDQGMFFMRAEFDLPDA---------EILFLRQALEA-LAP------AYHMHW
PURU_MYCBO            LDQHSTAPEGGTFLQRAIFHLPGLTA-------AVDELQRDFGSTVAD------KFGIDY
PURU_MYCTU            LDQHSTAPEGGTFLQRAIFHLPGLTA-------AVDELQRDFGSTVAD------KFGIDY
Q6N2L8_RHOPA          AQQY-NDTESGHFFMRVVFNAAAKVIP-------LASLRTGFGVIAAKFT-------MGW
D3P1G1_AZOS1          AHQY-DDVETGRFFMRLVFNQVNETCL-------FPAIREGFAAIAATYG-------MDW
Q9A2D5_CAUVC          AQQF-DDQETGQFFMRVVFDADGADR---------EALRGDFGALADGFK-------MKW
Q2G4C5_NOVAD          AQQF-DDPLSGRFFMRVVFDPAEGSV---------EHYRAAFAAVADHYA-------MEW
B6A334_RHILW          SSQF-DDLDTGKFFMRVSFISEEGLS--------GSEIGADFSPVAAPFS-------MDY
Q1MMT0_RHIL3          SSQF-DDLDTGKFFTRVSFISEEGVP--------LAELKEGFEPICKRFA-------MDA
A9CG96_AGRFC          SSQF-DDLGTGRFFMRVGFISEEGAT--------REALMAGLAPISKTFG-------MEV
Q3IZA8_CERS4          SAQF-DDQETGRFFMRVGFQSETGAT--------LDGLTADFAAVGETLE-------ADW
Q47WX7_COLP3          IHSF-DDTAVNRFFIRIEFRAQTATD------FSAETFSQEFEQRASEFE-------MQW
Q47Y32_COLP3          IHSF-DDTDQDRFFIRIEFRADTATN------FNRDDFCQQFGERASEFE-------MKW
B1YZQ7_BURA4          LNVF-DDDLSNHFFVRCVFHPTDET-------LQIDALRQEFGPIAAELGGRD--GDTQW
A2RYN4_BURM9          LTVF-DDDLSARFFVRCVFHATDDADA-----LRVDALRREFEPIAERFR-------MQW
Q8PDM5_XANCP          AQQF-GDDESGRFFLRVHFDKP-PRT-------DIAQLEQQFSQLAAGFE-------MTW
Q87CM9_XYLFT          AQQF-VDKESHQFFLRVHFDVA-DSS-------SLAELQNQISILAKAYA-------MQW
G4QCF9_TAYAM          SQQF-GDYDSKTFFLRVHFSL--ENF-------DLETLREKFGGIATQYD-------MNW
Q72BU4_DESVH          SAQF-GDPDTRRFFLRIHFEMPDDGP-------GRPELERLFAGVAATFD-------MQW
C5ADI4_BURGB          SAQF-GDSRTGEFFMRVHFDQASAADAG----TALDTLRDAFAPLAERFA-------MRW
C6BJB1_RALP1          SDQF-GDEFTGRFFMRVHF---VPQGLP----LDLATLRDRFAPIGERFS-------MQW
Q21I43_SACD2          SSQF-EDVSTRRFFMRTLLESVEGPK-------SLADVMSAFQSVADRYK-------MTW
Q6A6Z6_CUTAK          CQQF-TSTDTGNFFIRLQVESASSRA----------DLESAVSELAGKCN-------ATV
G0FKX9_AMYMS          AAYH-TDPDTGWFFTRQVVRADSLPF-------DAAELRARFGEVAAELSAE-----SSW
Q5YP34_NOCFA          AGYH-SDEDTGWFFTRQAIKAATVPF-------ELDELRERFAEVAAELSPE-----TEW
A4QB23_CORGB          AGYF-TDPDSNWFFTRQAIRAESIDT-------TIEQLREEFAPLAEEFGPR-----AKW
C1DSM7_AZOVD          ASHH-SDTQSGWFFMRHEIRADSLPF-------DLEEFRRAFAPIAREFS-------MKW
A0A1G3DDG3_9GAMM      ANHH-SDHQSGWFFMRHEIRADSLPF-------DLDGFRQAFAPIAREFS-------MEW
A6VAY3_PSEA7          ASHH-SDNDNGWFFMRHEIRADSLPF-------DLDGFRQAFAPIAREFS-------MVW
Q3K7T1_PSEPF          ASHH-SDNQVGWFFMRHEIRADSLPF-------GIEVLREKFAPIAEEFS-------MDW
F2JWM9_MARM1          ASHH-TDPEQKWFFMRHVIDAESLNI-------SVEEFREQFAPIADQFD-------MTW
PURU_ECOL6            NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
A0A0H3MKN8_ECO7I      NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
PURU_SHIFL            NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
PURU_ECOLI            NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
B2TZX6_SHIB3          NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
A8AG34_CITK8          NNEF-VDHRTGRFFMRTELEGIF----------NDVTLLADLDSALPE---------GSV
A0A0H3BS69_SALNS      NNEF-VDHRTGRFFMRTELEGIF----------NDSTLLADLDSALPE---------GSV
A4WBA0_ENT38          NNEF-VDHRTGRFFMRTELEGIF----------NDTTLLADLDGALPE---------GSV
E0SBD2_DICD3          NSEY-VDHRTGRFFMRTELEGIF----------NDTTLQADLDSALPE---------GSV
C7BIH6_PHOAA          NNEF-VDHCTGRFFMRTELEGIF----------NDETFLADLDDALPA---------GSQ
Q7N450_PHOLL          NNEF-VDHRTGRFFMRTELEGIF----------NDETLLADLDDALPV---------GSQ
PURU_HAEIN            NNEF-VDFETKHFFMRTELEGIF----------NEATLLEDLKYSLPE---------ETN
C3LNU3_VIBCM          NNEF-VDNASGHFFMRTELEGYF----------NDATLLADLDHALPQ---------GTR
A3D2K0_SHEB5          NSEF-VDNAQGRFFMRTELEGIF----------NSEQLLQDLRDVLPA---------KNH
Q085E7_SHEFN          NTEF-VDHTQGRFFMRAELEGVF----------DDERLLNELREVLPA---------QNH
A0A1I7D8L8_9GAMM      NNEF-VDKDAQRFFMRTELTGEP----------HTE-FLAQLREVLPA---------GAK
A6Q2Y4_NITSB          NDEF-VDVENNKFFMRSVVKGHI----------EREELLQLLLEALPK---------DAN
A0Q5K7_FRATN          NSEF-VDKQHNKFFMRTVFSGEV----------NIQQMLSDLTETLPT---------KSQ
A0A649PT53_CAMJU      NDEF-VGE--GMFFFRALLEGEF----------DKEAFIGTLEAMLGQ---------EAL
Q0PAA0_CAMJE          NDEF-VGE--GMFFFRALLEGEF----------DKEAFIGTLEAMLGQ---------EAL
F0SBM4_PSESL          MREF-VDINEGAFFARLVVEPYN----------DIAVLQNALQKGLPS---------DAM
O25975_HELPY          NDEF-VDPLKQRFFMRLKIQKEIKPLNTEIKEQEEQSLKTALFKALENFN-------ELL
D6XRW0_HELPV          NDEF-VDPLKQRFFMRLKIQKEIKPLNTGIKEQEERSLKTALFKALENFN-------ELL
E8QJY9_HELP4          NDEF-VDPLKQRFFMRLKIQKEMKPLNIEIKEQEERSLKTALFKALENFS-------ELL
                         .        *: *                                            

K9ZLA2_ANACC          ELHFSDTVPRLAIWVSRQDHCLFDLIWRQRSKEFHAEIPLIISNHPHLQDVAEKF-GIDY
B2J869_NOSP7          EIRFSDTVPRIAIWVSRQDHCLFDLIWRQRAKEFVAEIPLIISNHANLKVVAEQF-NIDF
Q8YWJ0_NOSS1          ELHFSDTIPRIAIWVSRQDHCLYDLIWRQRAKEIAVEIPLIISNHPHLKVVADQF-GIDF
K9RT10_SYNP3          QLHFSDVRPRLAIWVSKQDHCLLDLIWRYQAGELPADIVCIISNHSTCQALATQF-EIDY
K9Z549_CYAAP          KLHFSDTVPKVAIWVSKQDHCLYDLLWRIKSKELKAEVGLIISNHPDLDPIAQQF-NIEY
PURU_SYNY3            QIHFSDQLPRLALWVSKQDHCLLDILWRWRSGELRCEIPLIISNHPDLKSIADQF-GIDF
Q3AVM7_SYNS9          QLHFSDDLPKVAIFASKQSHCLFDLLWRVQSGELAMQVPLVIANHPDLEELCKGF-GVPF
O67681_AQUAE          QISFSDYVKKVAIFVSKQEHCFYDLMHRFYSGELKGEVKLVISNHEKARKTAEFF-GVPF
Q1GYI8_METFK          ELKGSQRRARMAIMVSQYDHCLVDLLHRHQSGELDCDIPLIISNHRDTEHLARFY-GIPF
PURU_BACSU            SLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNHEEARELVERL-NIPF
G8U094_SULAD          RLTPTAYRPRLAIWVSRESHCLTELVGQVESGDIAADIALILGNHEDLKPIADRH-DIPF
PURU_MYCBO            RFAEAAKPKRVAIMASTEDHCLLDLLWRNRRGELEMSVVMVIANHPDLAAHVRPF-GVPF
PURU_MYCTU            RFAEAAKPKRVAIMASTEDHCLLDLLWRNRRGELEMSVVMVIANHPDLAAHVRPF-GVPF
Q6N2L8_RHOPA          HMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPF
D3P1G1_AZOS1          TMRPAGEHRRVMLLVSKFDHCLADLLYRRRIGEIPMDITAIVSNHPRETYADHDFGDIPF
Q9A2D5_CAUVC          TLRNRADRYRVLLLASKFDHCLADLVYRWRIGELPMDITGVVSNHPAQTYAHVDLSGLDF
Q2G4C5_NOVAD          NLRDTTVKRKVILMVSKFDHCLGDLLYRTRIGELPMDVVAILGNHPKEALNISLIGDIPY
B6A334_RHILW          EFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNHFDYQKVVVNH-DIPF
Q1MMT0_RHIL3          EIHDGNARMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNHFDYQKVVVNH-DIPF
A9CG96_AGRFC          ALHDQAERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIVGVVSNHFDYQKVVVNH-DIPF
Q3IZA8_CERS4          QIFDSASKIKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVSNHLTYQKVVVNH-DIPF
Q47WX7_COLP3          QLASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLDIEIPAIISNHPDLEELAKWH-GIPY
Q47Y32_COLP3          ELASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLNIEIPAIISNHPDLEDLAKWH-DIPY
B1YZQ7_BURA4          AIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIVSNHPDFEPLAAQH-GLPF
A2RYN4_BURM9          AIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPDFAPLAAQH-GLPF
Q8PDM5_XANCP          QLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIVAVVSNHTDFAPLAASY-GIAF
Q87CM9_XYLFT          QLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSNHNEFAPLTASY-GVPF
G4QCF9_TAYAM          KIWDLEQKSNVLILVSKQGHCLNDLLFRTKSGNLPINIVGVVSNHRVFEKLSKSY-GIPF
Q72BU4_DESVH          ELHDAGRKSRLMIMVSRFGHCLNDLLFRCSTGTLQAEITAIVSNHADFERIAEMH-GIPF
C5ADI4_BURGB          ELHDASIKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIAAIVSNHKDFYQLAASY-DVPF
C6BJB1_RALP1          GMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVSNHRDFYQLAASY-DVPF
Q21I43_SACD2          ELTDAAEKTKVLIAVSQWGHCLDNLLNGWKRGYLPVDIVGVVSNHEVMKPLCEWY-GVPF
Q6A6Z6_CUTAK          HVDELGRPVRTLILASKASHCLSHLLFNRDAGRLPIDVVQVMANHPDLADLTAFH-KVPF
G0FKX9_AMYMS          QVSDTGERRRAVILVSKAGHCLYDLLGRVASGELDVDVAAVIGNHDSLADITRAH-GIPF
Q5YP34_NOCFA          QVHDSGARRRAVLLVSRDGHCLHDLLGRAASGELPATIEAVIGNHPDLAAMTEAH-GVKF
A4QB23_CORGB          SFTDTAQVKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAVVGNHENLRYIAENH-NVPF
C1DSM7_AZOVD          RVSDSSELKRVVLMASRESHCLADLLHRWHSGELPCEIPCVISNHDELRSMVEWH-GIPY
A0A1G3DDG3_9GAMM      RITDSERRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVISNHDDLRSMVEWH-GIPY
A6VAY3_PSEA7          RITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVIANHDDLRSMVEWH-GIPY
Q3K7T1_PSEPF          RITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEISCVISNHDDLRSMVEWH-GIPY
F2JWM9_MARM1          YVNDSADRPKVMLLATKESHCLNDILHRWHTGELSCDIVGVIANHEELRSMVEWY-KVPY
PURU_ECOL6            RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERF-DIPF
A0A0H3MKN8_ECO7I      RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERF-DIPF
PURU_SHIFL            RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERF-DIPF
PURU_ECOLI            RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERF-DIPF
B2TZX6_SHIB3          RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERF-DIPF
A8AG34_CITK8          RELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHETLRPLVERF-DIPF
A0A0H3BS69_SALNS      RELNPAGRRRVVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHETLRSLVERF-EIPF
A4WBA0_ENT38          RELTPSGRRRVVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRTLVERF-DIPF
E0SBD2_DICD3          RELTSAGRRRVVILVTKEAHCLGDLLMKSAYGGLDVEIAAVIGNHETLRTLVERF-DIPF
C7BIH6_PHOAA          RELNPAGRRRIVIMVTKEAHCLGDLLMKSAYDGLDVEIAAVIGNHATLQSLVEQF-GIPF
Q7N450_PHOLL          RELNSAGRRRIVIMVTKEAHCLGDLLMKSAYDGLDVEIAAVIGNHATLQSLVEQF-GIPF
PURU_HAEIN            CRLIGTQRKRIVILVTKEAHCLGDILMKNYYGALDVEIAAVIGNHDNLRELVERF-NIPF
C3LNU3_VIBCM          RKLISSSRKRIVILVTKEAHCLGDILMKNYDGSLDVDIAAVVGNYDTLQRLTERF-DIPY
A3D2K0_SHEB5          MTLVSAGKKRIVVLVTKEAHCLGDLLMKAYYGGLSVEIAAVVGNHDALRELAEKF-NIPF
Q085E7_SHEFN          MKLVDMGKKRIVVMVTKEAHCLGDILMKSYYGGLDVEIAAVVGNYDVLQALTEKF-DIPF
A0A1I7D8L8_9GAMM      VALHGEEKTKVVLLATKEAHCLGGMLLKQFEQTLNIEILAVIANYPTLEPLVKGF-DIPF
A6Q2Y4_NITSB          IKVITPRKKKVVLMATKESHVLGDILIRHFDGELPIDIIAVISNYDLLRPLVEKF-GIDY
A0Q5K7_FRATN          IKLVDSSKKNIVILATKEMHCLGDLLIKHAEGKLDANITAVISNYDNLRGLVEKF-DIPF
A0A649PT53_CAMJU      IELCEKRKKDIVVFATKESHCLGDLLIKHYSNELEANIKAVISNHNSLKDLVEKF-EIPY
Q0PAA0_CAMJE          IELCEKRKKDIVVFATKESHCLGDLLIKHYSNELEANIKAVISNHNSLKDLVEKF-EIPY
F0SBM4_PSESL          VKVNPEPEKKIVVLVTKEYHCLSDILIRNHFKTLGASVEAVIGNYSYLSNICERF-GVPF
O25975_HELPY          IEVILTHKKNIILLATKESHCLGDLLLRVYGGELNAQILGVISNHEILRPLVEKF-DIPY
D6XRW0_HELPV          IEVILTHKKNIILLATKESHCLGDLLLRVYGGELNAQILGVISNHEILRPLVEKF-DIPY
E8QJY9_HELP4          IEVILTHKKNIILLATKESHCLGDLLLRVYGGELNAQILGVISNHEILRPLVEKF-DIPY
                                  : .:   * :  ::              ::.*:            : :

K9ZLA2_ANACC          HYIPITKENKKE----QEIKQLELLQQYKI------DLVVLAKYMQIVSADFIRQFPQ-I
B2J869_NOSP7          QHVPITKDNKSE----QEAQQLELLRQYKI------DLVVLAKYMQIVSADFINQFSQ-I
Q8YWJ0_NOSS1          RHIPINKDNKAE----QEAQQLELLQQYEI------DLVVLAKYMQIVSADFITKFPQ-I
K9RT10_SYNP3          HYLPITPKNKAE----QEERELELLAGYRI------DLVVLAKYMQVLSADFLAQFKP-V
K9Z549_CYAAP          HHLPITKENKKE----QELKQLELLKNAEI------DLVILAKYMQVLSSDFIKEFPA-V
PURU_SYNY3            HCLPITKENKLA----QETAELALLKQYQI------DLVVLAKYLQILTTDFVVQFPN-I
Q3AVM7_SYNS9          FCVPVTPASKSE----AELTILRLLEEHGI------ELVVLAKYMQVLSSGFLERFPN-V
O67681_AQUAE          YHIPKTKENKLE----AEKRELELLKEYGV------ELVVLARYMQILSPKFVKEYENKI
Q1GYI8_METFK          FHIEVSRDNKAE----AEARQFALFDEHQV------DLIVLARYMQILSPDFVKRYPHRI
PURU_BACSU            HYMKANKDIRAE----VEKKQLELLEQYDV------DVIVLARYMQILTPDFVSAHPNRI
G8U094_SULAD          YTVPVDPQNKEA----SEAIADELMARYAV------DTIVLARYMQILTPEFVARYPQRI
PURU_MYCBO            IHIPATRDTRTE----AEQRQLQLLSG-NV------DLVVLARYMQILSPGFLEAIGCPL
PURU_MYCTU            IHIPATRDTRTE----AEQRQLQLLSG-NV------DLVVLARYMQILSPGFLEAIGCPL
Q6N2L8_RHOPA          YHFPVNKDTRRQ----QEAAITALIAQTHT------DLVVLARYMQILSDEMSARLAGRC
D3P1G1_AZOS1          HHLPVTKDSKLE----QEAQIWRLVRETGT------ELIVLARYMQVLSDDLSAKLAGHC
Q9A2D5_CAUVC          HHLPVTKETKFE----QEAELWKLIQETKT------DIVVLARYMQVLSDGLSAKLQGRC
Q2G4C5_NOVAD          HHLPITKDTKPQ----QEAEVKRIVTETGA------ELVVLARYMQILSDDLAAFLSGRC
B6A334_RHILW          HHIPVTKANKVQ----AEARIMEVAEQTGT------ELIVLARYMQILSDEMCQKMSGKI
Q1MMT0_RHIL3          HHIKVTKENKLQ----AEGQIMDIVEQTGT------ELIVLARYMQVLSDAMCQKMSGKI
A9CG96_AGRFC          HHIPVTKENKPQ----AEARIMEIAESTGT------ELVVLARYMQVLSDRMCEAMSGKI
Q3IZA8_CERS4          HLIKVTKDNKPE----AEARLMALVDETGA------ELVVLARYMQVLSDAFCARMSGRI
Q47WX7_COLP3          YHLPITKDTKPE----QEAKVWQIIQESDA------DLVVLARYMQVLSSDLCQKLSGKA
Q47Y32_COLP3          YHLPITKETKPE----QEAKVFQIIQDSEA------DLVVLARYMQVLSSDMCKKLSGKA
B1YZQ7_BURA4          RHFPITPDTKAQ----QEAQWLDFLESSGA------ELVILARYMQVLSQETSAKLANRA
A2RYN4_BURM9          RHFPITADTKAQ----QEAQWLDVFETSGA------ELVILARYMQVLSPEASARLANRA
Q8PDM5_XANCP          HHLPVSADTRAE----QETQLLALVERLQV------DLVVLARYMQILSPALCRALAGRA
Q87CM9_XYLFT          QHLPVNADNRTE----QEARIIQMVEREQI------DLVILARYMQILSPALCEALLGRA
G4QCF9_TAYAM          YHLPVSKENRKE----QEAEILRLVDELEV------DLVVLARYMQILSNEMCEALSGKA
Q72BU4_DESVH          HHLPVTKDTKRE----QEAAVAQVIEDTRS------DVVVLARYMQVLSAEFCSRYPGRI
C5ADI4_BURGB          HHFPLVAGASAQAKAAQEARVLEVIDEHSA------DLVVLARYMQILSQDMCRRLAGRA
C6BJB1_RALP1          MHLPLLQATDAQ-KAQQEARIWEIAQEQQI------DLVVLARYMQILSDDLCRKLEGRA
Q21I43_SACD2          HYLPVTADTKPQ----QEQQILDVMDSSEA------DLLVLARYMQILSDDLCKKLEGRA
Q6A6Z6_CUTAK          RWQKVDRESKTS----FEQEVLRTVGDLDV------ELVVLARYMQILSPELCEQLSGRC
G0FKX9_AMYMS          HHVPFP--PGDKA--GAFAQVRKLVGEHDP------HAVVLARFMQILPADLCREWAGRA
Q5YP34_NOCFA          HHVPFPKDPAERG--PAFEQVRELVDAHDP------HAVVLARFMQVLPPQLCEHWAGRA
A4QB23_CORGB          FHVPFPKDAVGKR--KAFDQVAEIVNGYDP------DAIVLARFMQILPPDLCEMWAGRV
C1DSM7_AZOVD          CHVPVD--PQDKE--PAFAEVSRLIREHAA------DTVVLARYMQILPPQLCREFAMQV
A0A1G3DDG3_9GAMM      FHVPVD--PANKQ--EAFAEVTRLVREQRA------DVIVLARYMQILPAELCDEFAQRV
A6VAY3_PSEA7          FHVPVD--PQDKQ--PAFDEVSRLIDEHGA------DCIVLARYMQILPPDLCRKYAHQV
Q3K7T1_PSEPF          YHVPVN--PQDKQ--PAFDEVSRLVKQHDA------EVVVLARYMQILPPDMCREYAHKV
F2JWM9_MARM1          HCIQVP--KEDKM--PAFQAIEKCIDDSEA------DTIVLARYMQIFPEYLCEKYRHRV
PURU_ECOL6            ELVSHEGLSRNEH----DQKMADAIDAYQP------DYVVLAKYMRVLTPEFVARFPNKI
A0A0H3MKN8_ECO7I      ELVSHEGLSRNEH----DQKMADAIDAYQP------DYVVLAKYMRVLTPEFVARFPNKI
PURU_SHIFL            ELVSHEGLSRNEH----DQKMADAIDAYQP------DYVVLAKYMRVLTPEFVARFPNKI
PURU_ECOLI            ELVSHEGLTRNEH----DQKMADAIDAYQP------DYVVLAKYMRVLTPEFVARFPNKI
B2TZX6_SHIB3          ELVNHEGLSRNEH----DQKMADAIDAYKP------DYVVLAKYMRVLTPEFVARFPNKI
A8AG34_CITK8          ELVSHEGLTRDEH----DKQMADAIDAHQP------DYVVLAKYMRVLTPEFVSRFPNKI
A0A0H3BS69_SALNS      ELVSHEGLTREEH----DTKMADAIDAHQP------DYVVLAKYMRVLTPGFVARFPNKI
A4WBA0_ENT38          ELVSHEGHTREEH----DDLMAQAIEAHDP------DYVVLAKYMRVLTPSFVSRFPNKI
E0SBD2_DICD3          HLVSHEGLTREEH----DLKMIAQIDQYKP------DYVVLAKYMRVLTPAFVQNYPNRV
C7BIH6_PHOAA          HLVSHEGLTREQH----DEKLIAQIDQYKP------DYVVLAKYMRVLTPEFVQHYPNQI
Q7N450_PHOLL          HLISHEGLTREQH----DEKLIAQIDQYKP------DYVVLAKYMRVLTPEFVQHYPNQI
PURU_HAEIN            HLVSHENLTRVEH----DKLLAEKIDEYTP------DYIVLAKYMRVLNPEFVARYPNRV
C3LNU3_VIBCM          HCVSHEGLSREAH----EQALLDVIDQYQP------DYLVLAKYMRVLTPAFVERFHHKI
A3D2K0_SHEB5          HLVSHEGLDRIQH----EQALLAAVSQYEP------DYLVLAKYMRVLTPDFVAQYPNRI
Q085E7_SHEFN          HYVSHEGLNRQEH----EQAMLKVIKSYDP------DFVVLAKYMRVLTPEFVTAFADKI
A0A1I7D8L8_9GAMM      HVVSHEGLTRSEH----DEKVGDLIASYNP------DIIGLAKYMRILSPEFVGRFEGKI
A6Q2Y4_NITSB          FHVPHGDLSRSEH----EEKILSLLEMFEQI-----DYIVLAKYMRILTPDFVKKYENRI
A0Q5K7_FRATN          EHVSHEGITREEH----ESRVCDIIKTYQH------DVIVLAKYMRILSPNFVKQFQGKL
A0A649PT53_CAMJU      HFISAENLDRKEQ----ENQILKCLEQYKF------DYLVLAKYMRILSPDFVRHFEGKI
Q0PAA0_CAMJE          HFISAENLDRKEQ----ENQILKCLEQYKF------DYLVLAKYMRILSPDFVRHFEGKI
F0SBM4_PSESL          YEISHEEKDKVAF----ENEIKAQLAQYKF------DYLVLAKFMRILSPEFVASYPNQI
O25975_HELPY          FYAPCD--NQVLH----EKEVLEIIKNLELKHKVSADLLVLAKYMRILSHDFTKRYENQI
D6XRW0_HELPV          FYAPCD--NQALH----EKEVLAIIKNLELKHKVSADLLVLAKYMRILSHDFTKRYENQI
E8QJY9_HELP4          FHAPCV--DQNLH----EKEVLAIIKDLELQHKASADLLVLAKYMRILSHDFTKHYENQI
                                                          . : **:::::.            

K9ZLA2_ANACC          INIHHSFLPAFIGANPYHRAFERGVKIIGATAHYATADLDAGPIIEQDVVRVSHRDEVDD
B2J869_NOSP7          INIHHSFLPAFIGANPYHRAFERGVKIIGATAHYATADLDAGPIIEQDVVRVSHRDEVDD
Q8YWJ0_NOSS1          INIHHSFLPAFVGANPYHRAFERGVKVIGATAHYATPELDAGPIIEQDVVRVSHRDEVED
K9RT10_SYNP3          INIHHSFLPAFAGANPYQRAHERGVKIIGATAHYVTPELDQGPIIEQDVVRVSHRDDVPD
K9Z549_CYAAP          INIHHSFLPAFIGAKPYHQAYSRGVKIIGATAHYVTQDLDAGPIIEQDVVRISHRDTVQD
PURU_SYNY3            INIHHSFLPAFPGANPYHRAHERGVKIIGATAHYATAQLDEGPIIEQDVVRVSHRDNVDD
Q3AVM7_SYNS9          INIHHSFLPAFKGAQPYHRAWERGVKLIGATAHYVTEDLDDGPIIEQTTVHVSHRDEVSD
O67681_AQUAE          INIHHSFLPAFPGAKPYERAFGKGVKIIGATAHYVTEELDEGPIIEQDVVRVSHKDSLED
Q1GYI8_METFK          INIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDITRISHRDQVED
PURU_BACSU            INIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRDNAEA
G8U094_SULAD          INIHHSFLPAFIGPRPYHQAYARGVKLIGATAHYVTADLDAGPIIEQDVHRVDHRYGLED
PURU_MYCBO            INIHHSFLPAFTGAAPYQRARERGVKLIGATAHYVTEVLDEGPIIEQDVVRVDHTHTVDD
PURU_MYCTU            INIHHSFLPAFTGAAPYQRARERGVKLIGATAHYVTEVLDEGPIIEQDVVRVDHTHTVDD
Q6N2L8_RHOPA          INIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPAD
D3P1G1_AZOS1          INIHHSFLPGFKGAKPYHQAHKRGVKLIGATAHYVTADLDEGPIIEQDVERISHHDSAED
Q9A2D5_CAUVC          INIHHSFLPGFKGAKPYHQAHARGVKLIGASAHYVTGDLDEGPIIEQDVERISHRDTPED
Q2G4C5_NOVAD          INIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTADLDEGPIIHQDVETVTHADSPDD
B6A334_RHILW          INIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITHAQSPDD
Q1MMT0_RHIL3          INIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITHAQSPDD
A9CG96_AGRFC          INIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDIVRITHAQSAED
Q3IZA8_CERS4          INIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITHAQSPDD
Q47WX7_COLP3          INIHHSLLPGFKGARPYFQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVDHGYYPKD
Q47Y32_COLP3          INIHHSLLPGFKGARPYYQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVDHSYYPQD
B1YZQ7_BURA4          INIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHALRPEQ
A2RYN4_BURM9          INIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHSYRPEQ
Q8PDM5_XANCP          INIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMTPRD
Q87CM9_XYLFT          INIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHSMTAHD
G4QCF9_TAYAM          INIHHSFLPSFKGAKPYHQAYARGVKIIGATAHYVTSDLDEGPIIEQEIEHVDHRHTAED
Q72BU4_DESVH          INIHHSFLPSFKGASPYHQAYARGVKLIGATAHYVTENLDEGPIIEQEVSRVDHAHLPDA
C5ADI4_BURGB          INIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERVDHSMTPEQ
C6BJB1_RALP1          INIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQEIERVDHSMDPEQ
Q21I43_SACD2          INIHHSFLPGFKGARPYHQAYERGVKLIGATAHYVTAELDEGPIIEQAVERVSHANTPEE
Q6A6Z6_CUTAK          INIHHSFLPGFKGANPYRQAHSRGVKLIGATAHFVTVDLDEGPIIEQRVQRVNHSQTVAQ
G0FKX9_AMYMS          INIHHSFLPSFIGAKPYHQAHTRGVKLVGATCHYVTADLDAGPIIEQDVIRVDHGDSVED
Q5YP34_NOCFA          INIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTPELDAGPIIEQDVIRIDHADQVRD
A4QB23_CORGB          LNIHHSFLPSFMGARPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVIRVTHKDTPTE
C1DSM7_AZOVD          INIHHSFLPSFVGARPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRISHRDSVED
A0A1G3DDG3_9GAMM      INIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIED
A6VAY3_PSEA7          INIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIIEQDVVRVTHRDNVED
Q3K7T1_PSEPF          INIHHSFLPSFVGAKPYHQASMRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHSDSIED
F2JWM9_MARM1          INIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRHSHTAAD
PURU_ECOL6            INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
A0A0H3MKN8_ECO7I      INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
PURU_SHIFL            INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
PURU_ECOLI            INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
B2TZX6_SHIB3          INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
A8AG34_CITK8          INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
A0A0H3BS69_SALNS      INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
A4WBA0_ENT38          INIHHSFLPAFIGARPYHQAYERGVKIVGATAHYVNDNLDEGPIIMQDVIHVDHTYTAED
E0SBD2_DICD3          INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTADD
C7BIH6_PHOAA          INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIITQNVINIDHTYTAED
Q7N450_PHOLL          INIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIITQKVINIDHTYTAED
PURU_HAEIN            INIHHSFLPAFIGAKPYQQAYKRGVKIIGATAHFINNELDQGPIIMQNVINVDHTYNAEA
C3LNU3_VIBCM          INIHHSFLPAFIGAKPYQQAYERGVKIIGATAHFVTNDLDEGPIIKQDVIPVDHTFSAQD
A3D2K0_SHEB5          INIHHSFLPAFIGAAPYRQAWERGVKIIGATAHFVNNCLDEGPIIKQDVIPVDHSYSALE
Q085E7_SHEFN          INIHHSFLPAFIGASPYKQAWDRGVKIIGATAHFVNNHLDEGPIIKQDVISVDHSYSAEE
A0A1I7D8L8_9GAMM      INIHHSFLPAFIGAKPYHQAFERGVKIIGATAHFVNNELDEGPIILQDVSSVTHANTAEM
A6Q2Y4_NITSB          INIHHSFLPAFIGANPYKQAYDRGVKIIGATAHFVNDNLDEGPIIAQDVLPVDHTFSWQE
A0Q5K7_FRATN          LNIHHSFLPAFIGANPYKQAYERGVKIIGATSHFVTDDLDEGPIIAQDIIRVDHSYSWQA
A0A649PT53_CAMJU      INIHHSFLPAFIGANPYKQAFERGVKIIGATAHFVNNNLDEGPIITQAVSPVNHEFTWQD
Q0PAA0_CAMJE          INIHHSFLPAFIGANPYKQAFERGVKIIGATAHFVNNNLDEGPIITQAVSPVNHEFTWQD
F0SBM4_PSESL          INIHHSFLPAFIGANPYKRAFHRGVKLIGATAHFVTNDLDEGPIIVQQTIPVNHNYSLSD
O25975_HELPY          LNIHHSFLPAFIGANPYQQAFERGVKVIGATAHFVNESLDAGPIIIQDTLPINHNYSVEK
D6XRW0_HELPV          LNIHHSFLPAFIGANPYQQAFERGVKVIGATAHFVNESLDAGPIIIQDTLPINHNYSVEK
E8QJY9_HELP4          LNIHHSFLPAFIGANPYQQAFERGVKVIGATAHFVNESLDAGPIIIQDTLPINHNYSVEK
                      :*****:**.* *. ** :*  :*:*::**: *: .  ** **** *    : *      

K9ZLA2_ANACC          LVRKGKDLERVVLARSVRLHLQNRVLVYGNRTVVFE------------
B2J869_NOSP7          LVRKGKDLERVVLARAVRSHLQNRVLVYGNRTVVFE------------
Q8YWJ0_NOSS1          LIRKGKDLERVVLARAVRLHLQNRVLVYGNRTVVFE------------
K9RT10_SYNP3          LIRKGKDLERIVLARAVHLHLQQRVLAYGNRTAVFA------------
K9Z549_CYAAP          LIRKGKDLEKIVLARGVRLHLQNRVLVYGNRTVVFG------------
PURU_SYNY3            LIRKGRDLERVVLARAVRLHLQHRILVYDNRTVVFA------------
Q3AVM7_SYNS9          LIRKGRDTERLALARALRLHLRRQVMVYRGRTAVFA------------
O67681_AQUAE          FIRKGKDIEKVVLARAVKWHLEDKILVYNGKTVVFE------------
Q1GYI8_METFK          LIQKGRDLERVVLSRAVRWHIENRILLYANKTVIFD------------
PURU_BACSU            LKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN------------
G8U094_SULAD          FKRIGRYVERMVLARAVAWHVEERVLVYQNRTVVFPW-----------
PURU_MYCBO            LVRVGADVERAVLSRAVLWHCQDRVIVHHNQTIVF-------------
PURU_MYCTU            LVRVGADVERAVLSRAVLWHCQDRVIVHHNQTIVF-------------
Q6N2L8_RHOPA          LVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD-----------
D3P1G1_AZOS1          LVRKGRDIERRVLARAIAWHLQDRVIPNGHKTVVFRD-----------
Q9A2D5_CAUVC          LVRKGRDIERRVLARALRYRLEDRVLLNGRKTVVFTD-----------
Q2G4C5_NOVAD          LVRKGRDVERRVLAEAVRLHLEDRALVNGNKTVVFKS-----------
B6A334_RHILW          YVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSYASERMG
Q1MMT0_RHIL3          YVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVFPASPGGYASERMG
A9CG96_AGRFC          YVSLGRDVEAQVLARAIHAHIHRRVFLNGSRTVVFPPSPGSYASERMG
Q3IZA8_CERS4          YVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGAHASERMG
Q47WX7_COLP3          LAAKGRDIECLTLSRAVRCHIEHRIFMYGKKTVVFSK-----------
Q47Y32_COLP3          LAAKGRDIECLTLARAVRCHIEHRIFLHGKKSVVFAK-----------
B1YZQ7_BURA4          LLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFP------------
A2RYN4_BURM9          LLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFQ------------
Q8PDM5_XANCP          LVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVFR------------
Q87CM9_XYLFT          LVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVFR------------
G4QCF9_TAYAM          LVNVGSDIESLVLSRAVRSHIEHRILINGSKTVVFD------------
Q72BU4_DESVH          LVNVGRDVESLVLSRAVRYHVEHRVLLNGHRTVVFR------------
C5ADI4_BURGB          LTAIGRDVECVTLARAVKWHVEHRILQNGTKTVVFR------------
C6BJB1_RALP1          LTAVGRDVECVALARAVKWHAEHRILLNGHKTVVFK------------
Q21I43_SACD2          LVEIGRDSEAVVLQRAVRWHAERRVLLNGKKTVVFNR-----------
Q6A6Z6_CUTAK          LTAVGQDTESATLNEAVRLFAEHRTFLDGMRTVILQ------------
G0FKX9_AMYMS          MVRKGRDIEKVTLARGLRWHLENRVLVHGNRTVVF-------------
Q5YP34_NOCFA          MVRQGRDIERVVLARGLRWHLEGRVLVHGRRTVVFS------------
A4QB23_CORGB          MQRLGRDAEKQVLARGLRFHLEDRVLVYGNRTVVFD------------
C1DSM7_AZOVD          MVRLGKDVEKMVLSRGLRYHLEDRVLVHDNRTVVFA------------
A0A1G3DDG3_9GAMM      MVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTLVFN------------
A6VAY3_PSEA7          MVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVFD------------
Q3K7T1_PSEPF          MVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF-------------
F2JWM9_MARM1          MVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVFSE-----------
PURU_ECOL6            MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
A0A0H3MKN8_ECO7I      MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
PURU_SHIFL            MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
PURU_ECOLI            MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
B2TZX6_SHIB3          MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
A8AG34_CITK8          MMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL-------------
A0A0H3BS69_SALNS      MMRAGRDVEKNVLSRALYQVLAQRVFVYGNRTIIL-------------
A4WBA0_ENT38          MMRAGRDVEKNVLSRALYQVLAQRVFVYGNRTIIL-------------
E0SBD2_DICD3          MMRAGRDVEKNVLSRALYHVLAQRVFVYGNRTIILR------------
C7BIH6_PHOAA          MMRAGRDVEKNVLSHALYWVLAQRVFVYGNRTIIL-------------
Q7N450_PHOLL          MMRAGRDVEKNVLSHALFWVLAQRVFVYGNRTVIL-------------
PURU_HAEIN            MMRAGRDVEKTVLSRALDLALHDRIFVYKNKTVVL-------------
C3LNU3_VIBCM          MAQAGRDVEKNVLSKALNKVLNDHVFVYGNKTVIL-------------
A3D2K0_SHEB5          MARAGRDVEKSVLSKALQLVLNEQVVVYGNKTIVF-------------
Q085E7_SHEFN          LAHNGRDVEKSVLSKALQLVLNEQVVVYGNKTVVF-------------
A0A1I7D8L8_9GAMM      MAKMGKDVEKTVFCKALQLASEHKLFINGNKTVVFS------------
A6Q2Y4_NITSB          MRKAGRDIEKIVLARALKLAVEDRIFVYANKTVIF-------------
A0Q5K7_FRATN          MRDAGHDVEKNVLSTALNLVLKDKVFVYNNKTVIL-------------
A0A649PT53_CAMJU      MQQAGRNIEKDVLSKALDLAFEDRIFIYNNKTIIF-------------
Q0PAA0_CAMJE          MQQAGRNIEKDVLSKALDLAFEDRIFIHNNKTIIF-------------
F0SBM4_PSESL          MIRAGKEIETSVLAKALHFVFEDRVFVFNNKTIVFE------------
O25975_HELPY          MRLAGKDIEKLVLARALKLVLEDRVFVHENKTVVF-------------
D6XRW0_HELPV          MRLAGKDIEKLVLARALKLVLEDRVFVHENKTVVF-------------
E8QJY9_HELP4          MRLAGKDIEKLVLARALKLVLEDRVFVHENKTVVF-------------
                          *   *  .:  .:      : .    :: ::