CLUSTAL format seed alignment for MF_01928

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0F7RI76_BACAN      ----------------------MTRIILPGKTIGIIGGGQLGRMMALAAKEMG---YKIA
Q81IQ8_BACCR          ----------------------MTRIILPGKTIGIIGGGQLGRMMALAAKEMG---YKIA
A0A0E0T7S3_GEOS2      ---------------------MTKQRIVPGQTIGIIGGGQLGRMMALAAREMG---FRIA
PURK_BACSU            ---------------------MSKQIIYPGAVIGIIGGGQLGKMMAVSAKQMG---YKVA
C7VAB9_ENTFL          -------------------MMNLDKPLLPGQVIGIIGGGHLAKMMALSAREMG---FRVG
Q8Y6B7_LISMO          ---------------------MDKKFLLTNSTIGIIGGGQLGRMLALAAKAMG---YRII
Q8DRL8_STRR6          ------MRMHLPTLLKNKEKSQRSRQMSSSKTIGIIGGGQLGQMMAISAIYMG---HKVI
Q48VY5_STRPM          --------------MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMG---YKVI
A0A0H3MSS3_STRS4      --------------------------MTSSKTIGIIGGGQLGQMMAISAIYMG---HKVI
Q9CFG5_LACLA          -------------------------------------------MMAIAAQYMG---HKVI
F0K3F8_LACD2          ------------MQTLSIKIK-------PGQTIGIIGGGQLGQMLAFDAKASG---MKVI
Q8G588_BIFLO          ------------MPSLSEETGGRVSMLMPGSTIGIIGGGQLGRMMALSARYMG---FRVG
Q833Y5_ENTFA          ---------------MNKPLK-------VGATIGIIGGGQLGRMLVMSGKKMG---FQMI
K0DAQ9_LEUCJ          ----------------------MTNIVLPPATIGIIGGGQLGQMMVLSAKAMG---YKVG
D5T0S2_LEUKI          ----------------------MTNVVLPPATIGIIGGGQLGQMMALSAKSMG---YKVG
F9URK4_LACPL          ------------------MNANFKEALLPPATIGIVGGGQLGQMMTLSAKAMG---YRVG
A0A0R1F635_LACCA      ----------------------MIDVVTSPATIGIIGGGQLGRMLTQSAKSMG---YRVG
PURK_STAAW            ---------------------MSFNKLKFGATIGIIGGGQLGKMMAQSAQKMG---YKVV
PURK_STAAN            ---------------------MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMG---YKVV
PURK_STAAR            ---------------------MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMG---YKVA
PURK_MYCTU            -------------MMAVASSRTPAVTSFIAPLVAMVGGGQLARMTHQAAIALG---QNLR
G0TI11_MYCCP          -------------MMAVASSRTPAVTSFVAPLVAMVGGGQLARMTHQAAIALG---QNLR
PURK_MYCLE            -------------MMAVPSRCSLGV----APLVAMVGGGQLARMTHQAAIALG---QTLR
F5Z233_MYCSD          ----------------------------------MVGGGQLARMTHQAAIALG---QRLR
R4UHE1_9MYCO          --------------------------MSATPVVTMIGGGQLARMTHQASIALG---QTLR
A0QTF2_MYCS2          ------------------MPRASQTNSSAVPVVAMIGGGQLARMTHQAAIALG---QTLR
A8M3L7_SALAI          -----------------------MDSHTGLPLVGMVGGGQLARMTHQAAIALG---QSLR
H2JRI9_STRHJ          ----------------------------------MVGGGQLARMTHEAGIPLG---IRFK
Q8CJX8_STRCO          MRPATGGGRGRKRPVNRWAPRGRYARGVTFPVVGMVGGGQLARMTHEAGIPLG---IRFK
Q47LU2_THEFY          ----------------------MSETNRTVPVVGMVGGGQLARMTHQAAIALG---VDFR
PURK_CORAM            --------MKRVSEQAGNPDGNPQAHVPGMPVIAVIGDGQLARMMQTAAIELG---QSLR
Q8NSG4_CORGL          -----------------------------MPIVAVIGDGQLARMMQTSAIELG---QSLR
A0LRX0_ACIC1          ---------------MSAPPLAAPQLPPGVPVVGMVGAGQLARMTQQAAIALG---VHLR
Q7NL74_GLOVI          --------------------MRPAAGRTGLPTVGIVGGGQLGRMMALAGHALG---LRLV
A9WGJ1_CHLAA          -------------------------MLNNYMRIGIFGGGQLAQMLTQAAISLG---IEIV
Q2S241_SALRD          -------------------------MSSTFPTIGILGGGQLGKMMAAEAVRMS---VDAR
PURK_SYNY3            ------------------METKLTT-------VGVIGGGQLAWMMAQEAPRLG---LKLA
Q8DJG7_THEEB          -------------------MDKITR-------IGVIGGGQLAWMLALAAKEMG---LSLW
K9Z498_CYAAP          ---------------------MTKN-------VGVIGGGQLAWMMALVAPQEN---IKIY
Q2JM58_SYNJB          -----------METQVSSKDQRSQP-------VGVIGGGQLAQMLALAARQMG---IPLV
Q2JQI9_SYNJA          --------------------------------MGVIGGGQLAQMLALAARPLG---IPLI
A2C9Y9_PROM3          --------------MQDCVIDSLCMSSVTSPMIGVVGGGQLAQMLAQAAKRRA---VDVV
Q7VBT4_PROMA          --------------MENNDHQNFC--------IGVVGGGQLAQMLAKAGKKLG---VDLI
Q31BK1_PROM9          ---------MSLKRNINDIKKNYS--------LGIIGGGQLALMLTEAAQKRD---LEVC
B0KC86_THEP3          --------------------MTKRIFGYPIMKIGIIGGGQLGKMFAQKAKQMG---FYVI
Q9WYS8_THEMA          -----------------------------MKKIGIIGGGQLGKMMTLEAKKMG---FYVI
Q8U3N1_PYRFU          ------------------------------MIVGILGGGQLAKMMAQEAKKMG---FKVA
Q5JDF6_THEKO          --------------------------MRDGFRIGILGGGQLAKMSAQEARRMG---FDVL
A6GZC2_FLAPJ          -----------------------MNYFSSNFKLGILGGGQLGKMMLFDTRKFD---IQTY
D4GVF3_HALVD          -----------------------MTVTVPGPTLGVVGGGQLGRMLGEAAAPLG---VDIV
Q9HRM3_HALSA          -------------------------------------------MLADAASPLG---VDVI
A0RVW3_CENSY          ----------------------------MASTLGIIGGGQLGMMLTEAARGMPEHISEVI
A9A5N1_NITMS          ----------------------------MTKILGIIGGGQLGMMIAEAAKKMPENVSKII
D9SVN7_CLOC7          ------------------MNKREIVRLNPPSNIGIIGGGQLGRMLTVEAKRMG---YNVI
Q9JZJ9_NEIMB          ---------MKNIS------------LSPPAMLGILGGGQLGRMFTVAAKTMG---YKVT
Q9XAY8_NEIME          ---------MKNIS------------LSPPAMLGILGGGQLGRMFTVAAKTMG---YKVT
Q5F8B1_NEIG1          ---------MNTPP------------ILPPAMLGILGGGQLGRMFAVAAKTMG---YKVT
Q7VY36_BORPE          ---------MTQSSTFDP--------IASGDWLGLLGGGQLGRMFCHAAQSLG---YKVA
C6BCS8_RALP1          -MADDLNPRLAQAHTAESRALNVPNAILPDAWLGMLGGGQLGRMFTHAAQAMG---YKVC
Q8F650_LEPIN          -------------------------MLLPGSRLGVMGSGQLARMFCLEAIPFG---YEIS
Q7UQS2_RHOBA          -MSDNQIPKTEQTSASTQ-------VILPGATIGMVGGGQLGRMFAMAAARMG---YRVG
Q2GFG3_EHRCR          --------------------MLHDSYIGPGSTIGIIGGGQLGKMISIAAANLG---YKTH
C7JGI8_ACEP3          -------------------MTSSHSPLKPNAVIGIVGGGQLGRMSAIAAARLG---FRTH
Q2RVJ3_RHORT          --------------MAMVGRLAALGPVGPGARLGILGGGQLGRMTALAAARLG---ISCH
Q3J672_RHOS4          ----------------------MTDRLPPGSTIGILGGGQLGRMLSVAAARLG---FRTH
A4WX21_RHOS5          ----------------------MTDRLHPGATIGILGGGQLGRMLSVAASRLG---FRTH
C7CHX9_METED          -----------------MASPTSSPQIRPGGTLGIVGGGQLGRMIALAAANYG---LKVH
B2IE68_BEII9          ----------------------MSLTLTPNATIGILGGGQLGRMLALAAARLG---LKSR
Q89EH0_BRADU          ------------------MTDAKQVKLKPGDTIGILGGGQLGRMLAMAAARLG---LRCQ
A0A4Y9UJP4_9BRAD      ------------------MTDAKQVKLKPGDTIGILGGGQLGRMLAMAAARLG---LRCQ
Q13B79_RHOPS          ------------------MTAPVQLVLKPGDTIGILGGGQLGRMLAMAAARLG---LRCH
B6JC22_OLICO          ------------------MTSSKQVALKPGDTVGILGGGQLGRMLALAAARLG---LKCH
Q9A3C1_CAUVC          ---------------------MASFPLVPGSTIGVLGGGQLGRMLALAAARLG---FDVV
Q7CT83_AGRFC          ------------------------MAKTNNLTIGIIGGGQLGRMLAMAAARLN---HRTI
B9J9P1_AGRRK          ---------------------------MTAKTIGIIGGGQLGRMLAMAAARLN---FQTL
D0RG26_9RHIZ          ---------------------MDKTSLKPGSTIGIIGGGQLGRMLAMAAARFG---YETI
Q9RYC6_DEIRA          ------------------------MSDQPAATLGILGGGQLAQMLALAALPLG---VQVR
PURK_PSEAE            ------------------------------MKIGVIGGGQLGRMLALAGTPLG---MNFA
C3K4E1_PSEFS          ------------------------------MKIGVIGGGQLGRMLALAGTPLG---MNFA
Q5SKY0_THET8          -------------------------------MIGILGGGQLGRMLALAGYPLG---LSFR
G7TK78_XANOB          -----------------------------MTTVGILGGGQLARMLVLAGAPLG---IRFA
Q8P7V6_XANCP          -----------------------------MTTVGILGGGQLARMLVLAGAPLG---LRFA
B2FJA6_STRMK          ----------------------------MSLTVGILGGGQLARMMVLAGAPLG---LRFQ
Q5ZYZ4_LEGPH          ------------------------------MKLGILGGGQLARMLALAAYPLG---INTV
E4PGK3_MARAH          ------------------------------MRIGVLGAGQLGRMLALAGYPLA---KTFV
Q5NGE8_FRATT          ------------------------------MKIGIIGAGQLARMLSLAGTPLG---LEFH
B0U004_FRAP2          ------------------------------MKIGIIGAGQLARMLSIAGTPLG---LEFH
PURK_VIBVY            ------------------------------MHVLVLGAGQLARMMSLAGAPLN---IQIS
PURK_VIBVU            ------------------------------MHVLVLGAGQLARMMSLAGAPLN---IQIS
PURK_VIBPA            ------------------------------MHVLVLGSGQLARMMSLAGAPLN---IQIS
PURK_VIBCH            ------------------------------MRVLVLGAGQLARMMSLAGAPLN---IETI
A0A0H3AKH5_VIBC3      ------------------------------MRVLVLGAGQLARMMSLAGAPLN---IETI
PURK_ALIF1            ------------------------------MNVLILGSGQLARMMSLASAPLN---IDVI
Q5QZV5_IDILO          ------------------------------MKILILGNGQLGQMLGKAVIQQG---HECV
A0A3D8XFP4_9ENTR      -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
Q32JL4_SHIDS          -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
PURK_ECOLI            -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
B7ME44_ECO45          -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
Q8ZR71_SALTY          -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
A0A0D6H8H0_SALTM      -----------------------------MKQVCVLGNGQLGRMLRQAGEPLG---IAVW
E5B3B2_ERWAM          -----------------------------MKPVCVLGNGQLGRMLRQAGEPLG---IAVY
A0A0H2W378_YERPE      -----------------------------MKPVCVLGNGQLGRMLRQAGEPLG---IAVY
D0ZCX4_EDWTE          -----------------------------MKPVCVLGDGQLGRMLRQAGEPLG---IPVY
E7A526_HAEIF          -----------------------MQNSTLYPTVYVLGNGQLGRMLGYAGAPLD---IYVE
A4NZE7_HAEIF          -----------------------MQNSTLYPTVYVLGNGQLGRMLGYAGTPLD---IYVE
PURK_HAEIN            -----------------------MQNSTLYPTVYVLGNGQLGRMLRYAGAPLD---IYVE
Q8EBG3_SHEON          -----------------------MTQTSTKPKVWVLGNGQLGAMLTHAGEPLA---IDVR
Q8D2V6_WIGBR          -----------------------MRTQFYKKIVYVIGNGQLSKMLFQAGYFLG---IKII
PURK_SACS2            ----------------------MFSVLDWKPKIGILGGGQLGWMIVLEGRKYP---FTFY
Q973U0_SULTO          ----------------------MKSLTQNSIKIGILGGGQLGWMMILEGRKYP---FAFY
Q9HJ65_THEAC          ----------------------------MRMNIGIIGTGQLGFMMINEGRRLG---NRYL
PURK_AQUAE            -----------------------------MLTVGILGGGQLGWMTILEGRKLG---FKFH
A8MCK4_CALMQ          ----------------------------MMRSIGVLGGGQLGLMMVLEGRRMG---IRFN
Q8ZZJ2_PYRAE          ------------------------------MRLFVLGGGQLALMMCWESQRIP---VDFS
                                                                 *                

A0A0F7RI76_BACAN      VLDPTKNSP-CAQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEK----
Q81IQ8_BACCR          VLDPTKHSP-CAQVADIEIVAPYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEK----
A0A0E0T7S3_GEOS2      VLDPTPDSP-CGQVADVEITAPYHDLDAIAELACVSDVITYEFENIDARALEWLEA----
PURK_BACSU            VVDPVKDSP-CGQVADVEITAHYNDREAIRKLAEISDIITYEFENIDYDALHWLKD----
C7VAB9_ENTFL          VLDPQIDCP-AAQVADWQLLGAYNDPEALEKLAKRAQVITYEFEHADVDALTAIQH----
Q8Y6B7_LISMO          VLDPTADCP-AAQVSDEQIIADYDDKVALRELSEKADVVTYEFENIDYDALKMTQN----
Q8DRL8_STRR6          ALDPAADCP-ASRVA-EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIK----
Q48VY5_STRPM          TLDPASDCP-ASRVS-EVIVAPYDDVEALGQLAARCDVLTYEFENIDADGLDAVVS----
A0A0H3MSS3_STRS4      TLDPAADCP-ASKVS-EVIVAPYHDVAALKQLAERCDVLTYEFENVDADGLDAVIK----
Q9CFG5_LACLA          TLDPNPNCS-AAKVSDELIVAPYDDVENLLRLAYACDVITYEFENVSAKALHEIEG----
F0K3F8_LACD2          ILDPTPACP-AGQAADDQIVAEYSDIDAIHELASRSDVLTYEFENVDLDALESVKD----
Q8G588_BIFLO          VLDPTPNCP-TGQVADFQITAEYDDKTAIHDLAVQSDVLTYEFENVDAGAIDEVRG----
Q833Y5_ENTFA          VLDPTLNSP-AGQVADRQIVAAFDQISALTELAELSDVITYEFENIEVASLEKAIP----
K0DAQ9_LEUCJ          VLDPTPQSP-AGQVSDFQIVAHYDDANALESLSQRSDILTYEFENVDMTAL--AQH----
D5T0S2_LEUKI          ILDPTADSP-AGQVSDFQIVANYDDQVALKELSSHSDILTYEFENVDVTAL--SQQ----
F9URK4_LACPL          VLDPTPKAP-AAQVADFQIVAAYDDQAALLDLARRSDVLTYEFENVDENALIAAQA----
A0A0R1F635_LACCA      ILEPTPNSP-AGQVADFQITAPYNDQAALKQLADASDVLTYEFENVDLAALEAVRS----
PURK_STAAW            VLDPSEDCP-CRYVAHEFIQAKYDDEKALNQLGQKCDVITYEFENISAQQLKLLCE----
PURK_STAAN            VLDPSEDCP-CRYVAHEFIQAKYDDEKALNQLGQKCDVITYEFENISAQQLKLLCE----
PURK_STAAR            VLDPAEDCP-CRYVAHEFIQAKYDDEKALNQLGQKCDVITYEFENISAQQLKLLCE----
PURK_MYCTU            VLVTSADDP-AAQVTPNVVIGSHTDLAALRRVAAGADVLTFDHEHVPNELLEKLVA----
G0TI11_MYCCP          VLVTSADDP-AAQVTPNVVIGSHTDLAALRRVAAGADVLTFDHEHVPNELLEKLVA----
PURK_MYCLE            VLATAADEP-AAQVTPDVVIGSHTDLEDLRRVALGADALTFDHEHVPTELLDKLVA----
F5Z233_MYCSD          VLATATDEP-AAQVTSDVVIGSHTDLDDLRRVATGATVLTFDHEHVPGELLDKLVA----
R4UHE1_9MYCO          VLAHAADEP-AAQVTPDIVLGSHTELDDLRRAAKDATVVTFDHEHVPTAFLETLQG----
A0QTF2_MYCS2          VLAVDPNDP-AAQVSPDIVLGSHTDYDALVKVAQGATVVTFDHEHVPTEHLDRLVA----
A8M3L7_SALAI          VLALAPDDS-AALVAADVQYGDHTDLAALRTFAKGCDVVTFDHEHVPTEHIDALAD----
H2JRI9_STRHJ          LLSDTPQDS-AAQVVSDVVIGDYRDLDTLREFARGCDVITFDHEHVPTEHLRALEA----
Q8CJX8_STRCO          LLSDTPQDS-AAQVVNEVVVGDYRDLDTLREFARGCDVITFDHEHVPTEHLKALEA----
Q47LU2_THEFY          VLAARPTDS-AARVVADVHLGDDRGRDDLLAFAKDSDVVTFDHEHVPQPVLRELHD----
PURK_CORAM            LLAGARDAS-AAQVCADVVLGDYTNYDDLLKAVDGATAVTFDHEHVPNEHLTALID----
Q8NSG4_CORGL          VLAGAPDSS-AAQVAADVVLGDYTNIDDLRVAIEGADVMTFDHEHVPNEHLHQLIA----
A0LRX0_ACIC1          VLAVGAADC-AAGVCSDVRLGGPRDLAAVQDFARGVDVLTFDHEHVPAALVADLER----
Q7NL74_GLOVI          VLDPDPASP-ASQVVPVSLEGAFDDIESLRSLARITDIVTFENEWVEPLLVAQLEA----
A9WGJ1_CHLAA          ICERVADSP-AARYTQHAIVGPWEDETVLTTFAHQCDIVTLENEFIDAGLLERVVA----
Q2S241_SALRD          LLSPKEAGP-MQPYTG-ARVGDWTDPDVLRPFTADCDVVTVESEWAPADAAAEVLP----
PURK_SYNY3            VQTPGESDP-AVALADKVVLTAIADGEGTRELAEHCGVITFENEFVDLPSLEKLAQ----
Q8DJG7_THEEB          VQTPAATDP-AVAVADGVCYGAIADGATTAQLAEHVDVITFENEFVDLERLQHLEQ----
K9Z498_CYAAP          IQTPHETDS-AVCLGERTIFAPVDDVSATAELAKYCDVITFENEFVDLEGLQSLVT----
Q2JM58_SYNJB          VQAAAPTDP-AVAVADGVVWGSTADSQATAQLLERCPVVTFENEFIPLPELKKLDP----
Q2JQI9_SYNJA          VQAAAPTDP-AVAVADGVVWGAVTDTQATAQLLQRCPVVTFENEFIPLAELQKLDP----
A2C9Y9_PROM3          VQSGSAIDP-AAVEATRLVLADPVDVEATSKLVQGCCGVTFENEWVDIEALIPLEQ----
Q7VBT4_PROMA          VQTRSENDP-AVQNANGLVLSDTNDINGTRQLAQKTSCITFENEWVDIEGLSLLED----
Q31BK1_PROM9          VQTKSCDDP-AGLKADHVIEADPLKIRGNKSLINECEKIIFENEWIKIDKLNLIDN----
B0KC86_THEP3          ILDPNPECP-ATQVADEQIIGDYYNENKLKELVEKSDVTTYEIEHINTAILKELFD----
Q9WYS8_THEMA          VLDPTPRSP-AGQVADEQIVAGFFDSERIEDLVKGSDVTTYDLEHIDVQTLKKLYN----
Q8U3N1_PYRFU          ILDPQEEPP-AKGVSDYHILGSFKDEKAIRKLAEISDVLTYDIEHINVQALKELEK----
Q5JDF6_THEKO          VLDPTPGCP-ASMVA-EQIVGSFQDGEMVIELAERADVVTYDIESVNVEALKKVAK----
A6GZC2_FLAPJ          ILDPSDEAP-CKIACNHFFQGSLMDFDTVYNFGKLVDVLTFEIELVNLEALEKLEN----
D4GVF3_HALVD          VLDPTPDCP-ASAVA-DQIVGGFDDPEAMAELAARADALTFEIELADPDLLDELAAE---
Q9HRM3_HALSA          VLDPTPDCP-ASQPATDHIRADFDDPDGVRELAARADVLTYEIELADPDVLADAAEA---
A0RVW3_CENSY          VLDPSPGCP-ASQAGAKQIAAGYADGSAIRELASRADVITYEIESGDADALESVLDI---
A9A5N1_NITMS          VLDPTENCP-AAQVGAEQIVADFKDKNAIIELSEKSDIITYEIESGDSEVLKSVEKN---
D9SVN7_CLOC7          ILDPKPNSP-AAQVADKQITAEFTDINALRKLAEKTDVLTYEFEHIDVGLLNEIES----
Q9JZJ9_NEIMB          VLDPDPDAP-AAEFADRHLCAPFNDQAALDELA-KCAAVTTEFENVNADAMRFLAK----
Q9XAY8_NEIME          VLDPNPNAP-AAEFADRHLCAPFDNQTALEELA-KCAAVTTEFENVNADAMRFLAK----
Q5F8B1_NEIG1          VLDPDPNAP-AAEFADRHLCAPFDDRAALDELA-KCAAVTTEFENVNADAMRSLAK----
Q7VY36_BORPE          VLDPADECP-AGMVADLHIQAAYDDADGLARLAGRCRAVTTEFENVPADSLRALAA----
C6BCS8_RALP1          VLDPDPNSP-AGTIAERHLCAGYTDEAALAEMAALCPAVTTEFENVPAQALDRLEQL---
Q8F650_LEPIN          VYSPEKNSP-AAGAGAKEYISTYEDEKALTFFLENIDGLTFEFENIPEIALTTIENFSK-
Q7UQS2_RHOBA          VFCGSSDEP-AAEVAAFTVCGPLTDHSAIEAFAKRCDVITLEFENIPADTIAACSK----
Q2GFG3_EHRCR          LLTNNPDDPSVYITNSATISHNYQNTESLLEFASNVDIATLEFENIPTTTIDILSQ----
C7JGI8_ACEP3          ILTTEANGP-AAQVSHAVTCGKYDDPTALDAFASAVDVVTFEFENISADALDLLAKHCP-
Q2RVJ3_RHORT          IFTPEDNGP-ASQVCPMVTLAAYDDLDALSRFAASVDVITFEFENIPAASVAHLAALRP-
Q3J672_RHOS4          IFEPSANPP-AADVAHAVTTAPYEDEAALRAFATSVDVITYEFENIPTSALDLLEALKP-
A4WX21_RHOS5          VFEPGANPP-AADVAHAVTTAPYEDEAALRAFAAAVDVITYEFENIPTSALDLLEALKP-
C7CHX9_METED          IYAPDADSP-AFDVAHAHTLAPYDDAAALAAFADACDVVTYEFENIPHATAAVLAEHAT-
B2IE68_BEII9          IYAPEADSP-AFVVAAGHMLAAYEDEEALAQFAAQVDVITYEFENVPARTAAVLAKIAP-
Q89EH0_BRADU          VFSPDPDSP-AFDVVLNATCAEYADVEALELFANDVDVITYEFENVPAAAAMVLDARRP-
A0A4Y9UJP4_9BRAD      VFSPDPDSP-AFDVVLNATCAEYADVEALELFANDVDVITYEFENVPSAAAMVLDARRP-
Q13B79_RHOPS          VFSPDPDSP-AFDVVQNATCAEYADVEALEMFASDVDVITYEFENVPASAALVLAARKP-
B6JC22_OLICO          VYAPDPDSP-AFDVVQRATCAEYADIEALELFASDVDVITYEFENIPTATAMALQARRP-
Q9A3C1_CAUVC          IQDPEEGSP-AGRVAARQIVAAYDDRWALKRLAEACDVVTYEFENVPADTVSELTALGAM
Q7CT83_AGRFC          VLEPQADCP-AAQVCNDQIVAEYDDEKALAELASRCDVVTYEFENVPVAAAEKLSASVP-
B9J9P1_AGRRK          ILEPQADCP-AAQVANEQIIAAYDDPAALAELAKRCDVVTYEFENVPVVAAERLAKDVA-
D0RG26_9RHIZ          ILEPQAGCP-AAQVANRQIVAAYDDPKALAELAAASDVITYEFENVPVSAADKLAETAL-
Q9RYC6_DEIRA          VLEPDAEAP--ARLCAEHVHAPYTDPAGLDALA-ACDAVTLEFENVPVESLDALRG----
PURK_PSEAE            FLDPAPDAC--AASLGEHIRADYGDQEHLRQLADEVDLVTFEFESVPAETVAFLSQF---
C3K4E1_PSEFS          FLDPAPDAC--AAALGEHLRADYSDPDHLRQLADEVDLVTFEFESVPAETVAFLSQF---
Q5SKY0_THET8          FLDPSPEAC--AGQVGELVVGEFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGR---
G7TK78_XANOB          VFDPSADAC--AGQVAPLQVGAFDDVATLAAFAEQVDVITFDFENVPATSAQQLAAQ---
Q8P7V6_XANCP          VFDPAADAC--AGQVAPLQVGAFDDAAALAGFAAQVDVLTFDFENVPAASAQQLATQ---
B2FJA6_STRMK          LYDPAADAC--SGPLAPLTVGAFDDRHALADFAAKVDVVTFDFENVPADSAQFLADR---
Q5ZYZ4_LEGPH          CLDPSPDAC--AGQLTRLIVSDFNDELALKQFLSEVDCVTIETENIPFSCAELIAQI---
E4PGK3_MARAH          FYDMSGSPS--AG-LGEVIIDR--EGQYLDDFLSRVDRVTYEFEHLPVDVAEKIAAH---
Q5NGE8_FRATT          CLGKNGDCA--EEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHE---
B0U004_FRAP2          CLGKTGDCA--EEVVKSVTDIDLEQINDVVTWAKQFDVITFENENISHELIKAINHD---
PURK_VIBVY            AYDVTTG-------DVVHPLTLHLLGHGLEQAIEHVDVITAEFEHIPHDILAICQAS---
PURK_VIBVU            AYDVTTG-------DVVHPLTLHLLGHGLEQAIEYVDVITAEFEHIPHDVLAICQAS---
PURK_VIBPA            AYDVGSG-------NVVHPLTQQVLGHGLENAIEQVDAITAEFEHIPHDVLDICELS---
PURK_VIBCH            AFDVGSE-------NIVHPLTQTVLGHGLEQAIEQVDVITAEFEHIPHPILDLCARS---
A0A0H3AKH5_VIBC3      AFDVGSE-------NIVHPLTQTVLGHGLEQAIEQVDVITAEFEHIPHPILDLCARS---
PURK_ALIF1            AYDVNSQ-------QIVHPLTQQPIDLSLEQAIKQVDVITAEFEHIPHHILDICSVS---
Q5QZV5_IDILO          LYSDRQD-------QVMALGSQQPLSMTLAEANEWADVTTWEHEHLGEELVAKAA-----
A0A3D8XFP4_9ENTR      PVGLDAE-------PAAVPF--------------QQSVITAEIERWPETALTRELAR---
Q32JL4_SHIDS          PVGLDAE-------PAAVPF--------------QQSVITAEIERWPETALTRELAR---
PURK_ECOLI            PVGLDAE-------PAAVPF--------------QQSVITAEIERWPETALTRELAR---
B7ME44_ECO45          PVGLDAE-------PAAVPF--------------QQSVITAEIERWPETALTRELAR---
Q8ZR71_SALTY          PVGLDAE-------PTAVPV--------------QQSVITAEIERWPETALTRELAR---
A0A0D6H8H0_SALTM      PVGLDAE-------PTAVPV--------------QQSVITAEIERWPETALTRELAR---
E5B3B2_ERWAM          PVGLDAE-------PQALPI--------------AQSVITAEIERWPETALTRELAD---
A0A0H2W378_YERPE      PVGLDAE-------PEAVPY--------------QHSVITAEIERWPETALTRELAT---
D0ZCX4_EDWTE          PVGIEAD-------PYSVPW--------------QQAVITAEIERWPDTPLTRELAS---
E7A526_HAEIF          PLAFNAP-------VFDLP---------------ENAIITAEIERWEKTPLTELLGN---
A4NZE7_HAEIF          PLAFNAP-------VFDLP---------------ENAIITAEIERWEKTPLTELLGN---
PURK_HAEIN            PLAFNAP-------VFDLP---------------ENAIITAEIERWEKTPLTELLGN---
Q8EBG3_SHEON          AVDIMTP-------TDDILPL------------APNDIITAEREQWPESALSLQLST---
Q8D2V6_WIGBR          SISEKDK-------LKNFNYI------------SNNNIITAEIENWKETKLINYLHK---
PURK_SACS2            VLENDKNAP--ACRIADRCFSPQDYKEFVD----SSDVITFEFEHVYEKALEYAEYS---
Q973U0_SULTO          VMD-EPEAP--ACKVADKCFTPDDYKKMID----EVDVVTFEFEHVKEEALQYAEDQ---
Q9HJ65_THEAC          VLDSNGVGP--ASLIADAHFSPEEYRKFVD----QSDVVTFEFEHVMEEALEYAQSQ---
PURK_AQUAE            VLEDKENAP--ACRVADRCFRTGQISEFVD----SCDIITYEFEHIKDEVLEKCES----
A8MCK4_CALMQ          VYDEKPDAP--ALRIADAVYSGDDWVKLIN----DSDVITVEFEHVNPRALELAHEA---
Q8ZZJ2_PYRAE          VYDPDSSAP--AYRCARRPA---DPLEEVE----RADAVTFEFENVDISLAERAERL---
                                                               : *                

A0A0F7RI76_BACAN      --HAYLPQGSQLLSKTQNRFTEK---NAI----EKAGLPVATYRLVQNQE---------Q
Q81IQ8_BACCR          --HAYLPQGSQLLNTTQNRFTEK---NAI----EKAGLPVATYRLVQNQD---------Q
A0A0E0T7S3_GEOS2      --NAYVPQGSRLLAVTQDRALEK---AAI----VDASLPVAPYVEVNGAE---------E
PURK_BACSU            --HAYLPQGSELLLITQNRETEK---KAI----QSAGCEVAPYSIVKTKN---------E
C7VAB9_ENTFL          --LANIPQGTDILAITQDRLMEK---SFL----EDNNIVIAPYATIVSPT---------D
Q8Y6B7_LISMO          --LVSVPQGSELLSITQDRILEK---AYL----ESANINIAPYAVIVEQD---------E
Q8DRL8_STRR6          --DGQLPQGTDLLRISQNRIFEK---DFLS---NKSQVTVAPYKVVTSSL---------D
Q48VY5_STRPM          --ACQLPQGTDLLRISQNRIFEK---DFLA---NKAGVTVAPYKVVTSSL---------D
A0A0H3MSS3_STRS4      --DGQLPQGTDLLRISQNRIFEK---DFLA---KKAGVQVAPYKVVTSSL---------D
Q9CFG5_LACLA          --CVRIPQGIRLLEITQNRRFEK---EFLT---NEAKVNVAPWQLVDSAE---------K
F0K3F8_LACD2          --QVFIPQGTKLLYTTNNRIREK---TFI----QSAGCEVAKFRAVKNRA---------D
Q8G588_BIFLO          --ITATPQGTDLLRVTQHRVREK---QFI----NDHGTATAPWRAVNNFD---------E
Q833Y5_ENTFA          --LEKLPQGTELLKITQNRLLEK---TFL----QSIGCKIAPFAEVKSQK---------E
K0DAQ9_LEUCJ          --KTILPQGTDLLRITSNRLIEK---TFIR---DRAAVPVAEFMAVNSPE---------D
D5T0S2_LEUKI          --TTDVPQGTKLLEITSNRLTEK---AFIR---DVAKVPVTQFMAIESLD---------D
F9URK4_LACPL          --YAKLPQGTALLHITGDRLNEK---QFLH---DHG-IPVTSFAPVTDLQ---------S
A0A0R1F635_LACCA      --ETRIPQGTAILAITRDRIKEK---TFLK---THG-VPVTPFAAVNRAA---------E
PURK_STAAW            --KYNIPQGYQAIQLLQDRLTEK---ETL----KSAGTKVVPFISVKEST---------D
PURK_STAAN            --KYNIPQGYQAIQLLQDRLTEK---ETL----KSAGTKVVPFISVKEST---------D
PURK_STAAR            --KYNIPQGYQAIQLLQDRLTEK---ETL----KSAGTKVVPFISVKESK---------D
PURK_MYCTU            -DGVNVAPSPQALVHAQDKLVMR---QRL----AAAGVAVPRYAGIKDPD---EIDVFAA
G0TI11_MYCCP          -DGVNVAPSPQALVHAQDKLVMR---QRL----AAAGVSMPRYAGIKDPD---EIDVFAA
PURK_MYCLE            -EGINVAPSPQALVHAQDKLVMR---RRL----AALGAAMPRFMALDSVDDLAEIDAFAQ
F5Z233_MYCSD          -EGVNVAPPPAALRHAQDKLVMR---RKL----AALGAPVPRFAAIETAAGMPALDEFGA
R4UHE1_9MYCO          -EGVNVQPPPSALIYAQDKTLMR---RKL----RDIGAPVPGFADIRAVS---DVERFAA
A0QTF2_MYCS2          -DGVTVAPPPEALVHAQDKLVMR---RRL----ADLGAPIPQFAEVTAAD---EAQEFSR
A8M3L7_SALAI          -EGVKLFPPAEALVHAQDKQVMR---ERL----AGLGMPNPAWRPVDTPA---DVESFGD
H2JRI9_STRHJ          -DGIPVRPGPDALVHAQDKGVMR---AKL----DAIGIPCPRHRIVSDPE---DVVRFAE
Q8CJX8_STRCO          -DGIPVRPGPEALVHAQDKGVMR---AKL----DAIGVPCPRHRIVRDPA---DVAAFAA
Q47LU2_THEFY          -AGIVLRPGPEALHHAQDKLVMR---TRL----SELGAPCPRWRGITSLD---EVTEFAG
PURK_CORAM            -AGYNDQPQPAALINAQDKLVMR---ERL----AELGAPVPRFAPIESAQ---DAYDFWT
Q8NSG4_CORGL          -EGVNVQPRPEALVNAQDKLVMR---KRL----RELGAPVPPFAAIESVE---DAVGFFE
A0LRX0_ACIC1          -GGVVARPGSHALPYVQDKLQMR---QRL----AASGFPVPHWAVPRPGHELEDLRAFAA
Q7NL74_GLOVI          -DGCRVWPASRTLARIQDKLHQR---THL----AAAGLPVPRFAAAPSLE---AVRAWGG
A9WGJ1_CHLAA          -QGVPVWPAPATVAVVQDKLWQK---ERL----AAAGLAVPPFRSVATPD---DVLTAAQ
Q2S241_SALRD          -DGAALWPSTQTLSLIKDKGVQK---QHL----ADAGCPVPAFACCETLD---EALDAAE
PURK_SYNY3            -QGITFHPRLDALAPLLDKWEQR---HFL----QNLGLPVPDFWALE---------SLPA
Q8DJG7_THEEB          -QGVCFYPRLATLAPLLNKYQQR---RFL----QALGIPVPAFTYLG---------DRP-
K9Z498_CYAAP          -EGVCFYPRLTSLSPLLDKFDQR---SFF----QSQGFPVPRFSLYES--------DSDF
Q2JM58_SYNJB          -EGSRFRPSLSTLEPLLDKLHQR---QFL----ARLGLPVPTFFPLEAVL---D--SADL
Q2JQI9_SYNJA          -QGSRFRPRLSTLEPLLDKLHQR---QFL----AELGLPVPAFWPAE---------TADL
A2C9Y9_PROM3          -QGVCFSPSLTALAPLVDKISQR---QLL----RELDLPSPDWTLLSSIS---FDQPELP
Q7VBT4_PROMA          -SGVTFIPKLSAMSPLINKLSQR---KLL----KKLNIPGPEWLSLSSFK---ISDLKLE
Q31BK1_PROM9          -N-DIFVPSLNAIKPLVDRFSQK---KLI----DRMNIPCPKWISIEDFK---NLPYEEI
B0KC86_THEP3          -KGYKIYPSPYSLEIIQDKLKQK---QVL----KGANLPVPRFEKVENFEV---------
Q9WYS8_THEMA          -EGYKIHPSPYTLEIIQDKFVQK---EFL----KKNGIPVPEYKLVKDLE----------
Q8U3N1_PYRFU          -EGVQIYPSPRVLEIIQDKLVQM---QVM----KEAGIPVPRFIKADKDELV--------
Q5JDF6_THEKO          -E-KPVIPEPHVLEVIRDKYVQK---KVL----RRAGVPVPWFRELKSLDE---------
A6GZC2_FLAPJ          -EGLKIYPSPKTLKLIQNKGIQK---EFY----AQNNIPTAPFEKYADVQNL-----KSA
D4GVF3_HALVD          -EGIAVHPSPDALRTIEDKLVQK---DTF----GEAGIPIPPFHRVDDAA---------D
Q9HRM3_HALSA          -HEVAVHPSPETLRTIQDKLVQN---RAL----ADAGIPVPAFRAVDDAA---------D
A0RVW3_CENSY          -TEVR--PPPETLRMIQDKYVQK---SFL----KENKIPVGDFAPAGTID---------E
A9A5N1_NITMS          -AEIN--PSPETLHTIQDKFLQK---TFL----KEHGIPVPEFIEISNID---------D
D9SVN7_CLOC7          -KGYKIYPSSKTLKVIQNKYVQK---SIL----KEAGIKVPAFYLVNSLE---------E
Q9JZJ9_NEIMB          --HTNVSPSGDCVAIAQNRIQEK---AWIR----KAGLQTAPYQVVCKAE---------D
Q9XAY8_NEIME          --HTNVSPSGDCVAIAQNRIQEK---AWIR----KAGLQTAPYQAICKAE---------D
Q5F8B1_NEIG1          --HTNVSPSGDCVSIAQNRIQEK---AWIR----KAGLQTAPYQAVCKAE---------D
Q7VY36_BORPE          --RCRVSPAADAVAVVQDRIAEK---TFIA----GQGIEVAPHAAICARD---------D
C6BCS8_RALP1          --GAFVAPRANCVSIAQNRIAEK---KFFALCAARTGIHPAPSWVIEHEA---------D
Q8F650_LEPIN          RTGLIVRPSPNCVRISQNRWKEK---TSFQ----KAGIPTVKFYPVLTEE---------D
Q7UQS2_RHOBA          --HAPTYPDASVLAMAQDRWIEK---TTLR----EAGIPVAGFEPVHDRE---------T
Q2GFG3_EHRCR          --KIKVYPGKEALYISQNRIREK---QHI----RNLGIKTSDFRVIDNYN---------S
C7JGI8_ACEP3          -----VHPSGHILRISQDRLAEKTFFA-------SAGIPLAPWHAVTD---------EKT
Q2RVJ3_RHORT          -----VRPGWKALETAQDRILEKRFFN-------DLGIATAPWAPVTDG--------PQS
Q3J672_RHOS4          -----LHPNRRALAVSQDRLEEKGFLT-------GLGLAVAPYRPVGS---------RED
A4WX21_RHOS5          -----IHPNRRALAVSQDRLEEKGFLT-------GLGLSVAPFRPVAT---------RED
C7CHX9_METED          -----LRPSATALLTTQDRLSEKDFVT-------SLGIPTAPYRAVDT---------VED
B2IE68_BEII9          -----VLPGEAALAASQDRLVEKDFMA-------SLGIATAPYRQVDD---------VDT
Q89EH0_BRADU          -----VLPNRKILETTQDRLAEKDFVT-------RLGIGTAAYADVTS---------VPS
A0A4Y9UJP4_9BRAD      -----VLPNRKILETTQDRLAEKDFVT-------RLGIGTAAYADVTS---------VSS
Q13B79_RHOPS          -----VLPDYRILETTQDRLGEKDFVT-------KLGIGTAAYADVTS---------PQM
B6JC22_OLICO          -----VLPDTSVLGTTQDRLTEKDFVN-------SLSIGTAGYADIGS---------VED
Q9A3C1_CAUVC          -----VSPGAKALAAAQDRVAEKTFMA-------EIGVPTVAFAAVHD---------SQS
Q7CT83_AGRFC          -----VYPPAQALSASQDRLTEKRFLN-------GCGIPTADFRAVDS---------QDE
B9J9P1_AGRRK          -----VYPPPKALEMAQDRLTEKRFIN-------DCGIPTARFHAVDS---------QAD
D0RG26_9RHIZ          -----VLPPPAALEISQDRFTEKQFLN-------ESGIETAPWRLVDD---------EET
Q9RYC6_DEIRA          --RVPVRPGAGLLARSKHRAREKAA-------LQEAGARTAPFVVIQREA---------D
PURK_PSEAE            ---VPVYPNAESLRIARDRWFEKS-------MFKDLGIPTPDFADVQSQAD--------L
C3K4E1_PSEFS          ---VPVYPSAEALRIARDRWFEKS-------MFKDLGIPTPAFADIQSQAD--------L
Q5SKY0_THET8          ---LPLYPPAKALEVAQDRLREKT-------FFQGLGVPTPPFHPVDGPED--------L
G7TK78_XANOB          ---VPVFPSPAALAVAQDRLSEKT-------LFRELGIPVPEFAAIDDRAG--------L
Q8P7V6_XANCP          ---VPVFPNPAALAIAQDRLSEKT-------LFRELGIPVPEFAAIDDRAG--------L
B2FJA6_STRMK          ---VPVYPPPAALAVAQDRLSEKT-------LFQQLGIPLPAFADIRSRDE--------L
Q5ZYZ4_LEGPH          ---KPFYPSTQALKITQDRLYEKN-------FFRSLNIPTPEFLPVESEGE--------L
E4PGK3_MARAH          ---KPVHPCPRALQVCQNREAEKT-------LFGELGIPTPEWKIADSAAS--------L
Q5NGE8_FRATT          ---VSVYPSAKAIAISQDRLLEKS-------FMQDHGIATAKFVNIDSLAK--------L
B0U004_FRAP2          ---VNVYPSAKAIAISQDRLLEKS-------FMQDHGIATAKFVNIDSLDK--------L
PURK_VIBVY            ---GKFLPSSEAIKAGGDRRLEKT-------LLDHAGVRNANYYVIETRED--------F
PURK_VIBVU            ---GKFLPSSEAIKAGGDRRLEKA-------LLDHAGVRNANYYVIETRED--------F
PURK_VIBPA            ---GKFLPSTAAIKAGGDRRVEKA-------LLDNAGVRNAKHYVIETRED--------F
PURK_VIBCH            ---GKLYPSAEAIKAGGDRRLEKA-------LLDRAQVANARYTMIRSRDD--------L
A0A0H3AKH5_VIBC3      ---GKLYPSAEAIKAGGDRRLEKA-------LLDRAQVANARYTMIRSRDD--------L
PURK_ALIF1            ---GKFQPTPDAIKAGGDRRLEKK-------LLDNAHVANAKYHNINTKQD--------F
Q5QZV5_IDILO          ---DKFLLQPERFNLLVDRRSQKA-------LCDELDIPTSAWKAYENAAE--------L
A0A3D8XFP4_9ENTR      ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLHLPTAPWQLLADRSE--------W
Q32JL4_SHIDS          ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLHLPTAPWQLLAERSE--------W
PURK_ECOLI            ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLHLPTAPWQLLAERSE--------W
B7ME44_ECO45          ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLHLPTAPWQLLSEHSE--------W
Q8ZR71_SALTY          ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLGLATAPWQLLTSTDE--------W
A0A0D6H8H0_SALTM      ---HPAFVNRDVFPIIADRLTQKQ-------LFDKLGLATAPWQLLTSTDE--------W
E5B3B2_ERWAM          ---HYAFVNRDIFPLLADRLTQKQ-------LLDRLGLATAPWQLLSAADQ--------W
A0A0H2W378_YERPE      ---HTAFVNRDIFPRLADRLPQKQ-------LLDSLGLATAPWQLLSSASE--------W
D0ZCX4_EDWTE          ---HPAFINRDIFPLLADRYSQKQ-------LLDELALPTAPWALLAAPEQ--------W
E7A526_HAEIF          ---HKNFVNQHVFGLLADRFTQKS-------LLDELNLSTSPWCLLKDKTQ--------W
A4NZE7_HAEIF          ---HKNFVNQHIFGLLADRFTQKS-------LLDELNLSTSPWCLLKDKTQ--------W
PURK_HAEIN            ---HKNFVNQHIFGLLADRFTQKS-------LLDELNLSTSPWCLLKDKNQ--------W
Q8EBG3_SHEON          ---HPHFVNGPVFSRLADRYSQKS-------LLDQLNVPTAPWSLVDDHTK--------V
Q8D2V6_WIGBR          ---NNKFINYNILISLRDRLNQKK-------LFDKLKLPTATWKLLKSPLN--------W
PURK_SACS2            ---GKLLPRLNSVELKRERYKEKL-------FYRQHNLPTPRFYVAEDGEE--------A
Q973U0_SULTO          ---GKLLPRLNTVELKRERWKEKT-------YYKEHNLPTPRFYIANDGEE--------A
Q9HJ65_THEAC          ---GKLFPGIQSVELKKDRSKEKD-------FLTDNGLPVAEYHVASSFDE--------A
PURK_AQUAE            ----KLIPNPQALYVKKSRIREKL-------FLKKHGFPVPEFLVIKR-DE--------I
A8MCK4_CALMQ          ---GKLRPSLNSIIPKQDKIKERL-------MLSNLGLPTPRFMIAHGPED--------I
Q8ZZJ2_PYRAE          ---GKLRPPLAYLRLKKSRLEERA-------FFDSIGVPTVPWRRAAGWEE--------A
                                  .     :                                         

A0A0F7RI76_BACAN      LTEAIAELSYPSVLKTTTGGYDGKGQVVLRS------EADVDEARKLANAAE----CILE
Q81IQ8_BACCR          LTEAIAGLSFPSVLKTTTGGYDGKGQVVLRS------EADVEAARNLVDKAE----CILE
A0A0E0T7S3_GEOS2      LEQAVQTIGFPCVLKTRRGGYDGKGQYVLRG------EGDLAKAADLLGLGP----CILE
PURK_BACSU            LKQAVQELRLPAVLKTCRGGYDGKGQFVIKE------EAQMEQAAALLEHGT----CILE
C7VAB9_ENTFL          IQEAIDGIGYPCILKNTRG----EGRYVLHS------TSDLAPSMNLLREGT----CVLE
Q8Y6B7_LISMO          IENEIKSIGYPAVLKTAQGGYDGKGQVVIHD------ARDIETAARLLRYGS----CVLE
Q8DRL8_STRR6          LADI--DLSKNYVLKTATGGYDGHGQKVIRS------EADLEAAYALADSAD----CVLE
Q48VY5_STRPM          LGGL--DFTKTYVLKTATGGYDGHGQKVIRS------AEDLPEAQQLANSAQ----CVLE
A0A0H3MSS3_STRS4      LEGL--DLSKNYVLKTATGGYDGHGQKVIRE------EADLVEASQLANSAE----CVLE
Q9CFG5_LACLA          LPE---TVTRKQVLKTTTGGYDGHGQVVLNT------DEKLSAAKSLTELSE----CVLE
F0K3F8_LACD2          LEEAVSDLGLPAVLKTCEGGYDGKGQVVLKA------AADLDKTADVLACGD----CILE
Q8G588_BIFLO          LDAALGDIHYPAVLKTVSGGYDGHGQLVLRS------DADLEKIRSRSDRGGGFPPSILE
Q833Y5_ENTFA          LPQAIEKIGFPCVLKTIQGGYDGKGQVVLKC------EEDFSQATKLLANAT----CELE
K0DAQ9_LEUCJ          FRIAVKKITLPAILKTVNGGYDGHGQWEVNQ------LADIDSILTDFPTQ----PLILE
D5T0S2_LEUKI          FKSAIQRITLPAILKTVSGGYDGHGQWPVES------ESDIAQLKADFPNV----PLILE
F9URK4_LACPL          LNYALNRVGTPAILKTAAGGYDGHGQTDLDT------AVVTKAASALLTQ-----PCILE
A0A0R1F635_LACCA      LAQAVATIGLPSILKTTTGGYDGHGQQDINT------PDDFPAARELLTHG----PCILE
PURK_STAAW            IDKAIETLGYPFIVKTRFGGYDGKGQVLINN------EKDLQEGFKLIETSE----CVAE
PURK_STAAN            IDKAIETLGYPFIVKTRFGGYDGKGQVLINN------EKDLQEGFKLIETSE----CVAE
PURK_STAAR            IDKAIETLGYPFIVKTRFGGYDGKGQVLINN------EKDLQEGIKLIETSE----CVAE
PURK_MYCTU            RV------DAPIVVKAVRGGYDGRGVRMARD------VADARDFARECLA-D-GVAVLVE
G0TI11_MYCCP          RV------DAPIVVKAVRGGYDGRGVRMARD------LADARDFARECLA-D-GVAVLVE
PURK_MYCLE            RLT--GSKDAPMVVKAVRGGYDGRGVQMVRD------SAHAREVASGYLV-D-GMPVLVE
F5Z233_MYCSD          QT------GGAMVVKAARGGYDGRGVSIVDD------VAGARAAVADYLA-S-GVPVLVE
R4UHE1_9MYCO          ET------GSHVVLKAVRGGYDGRGVWITDT------LDEARTVAAEQLA-A-GVDLLAE
A0QTF2_MYCS2          EV------GGAAVIKTIRGGYDGRGVVLLDT------PEQAREVAAKYLT-D-GVPILIE
A8M3L7_SALAI          AV------GWPVVLKAARGGYDGRGVWLVDD------AAGAVERTATLLA-A-GTRLIVE
H2JRI9_STRHJ          EG-----DGFPVVLKTVRGGYDGKGVWVVDS------AEEAAE----PFR-A-GVPVLAE
Q8CJX8_STRCO          EGAVEGGDGFPVVLKTVRGGYDGKGVWVVDS------VAEAAE----PFR-A-GVPVLAE
Q47LU2_THEFY          QT------GWPVVLKAARGGYDGKGVWVVGD------AAEAAAVVERAAR-E-QVPLLVE
PURK_CORAM            LT------SGQVCLKARRGGYDGKGVWFPNN------ESELTALVSDLSR-R-GVALMAE
Q8NSG4_CORGL          AV------DGQVCLKARRGGYDGKGVWFPAD------VAELQSLVAELLD-G-GTPLMAE
A0LRX0_ACIC1          DH------HWPVVVKAVSGGYDGRGVWVVED------ETAAARLVD--AL-A-DLRWFVE
Q7NL74_GLOVI          S--------RPLVLKTRLQGYDGHGVRIVEN------PAHLEDAWEALA----GQPLMVE
A9WGJ1_CHLAA          AF------GWPLVLKTRRNGYDGYGNATLRT------AEDVLPAWERLTR-G-GSPLLVE
Q2S241_SALRD          EF------GYPVVLKQYRGAYDGYGNATAAA------EDELREAWPDLAT---EDGAMVE
PURK_SYNY3            QL-----PDFPWVLKARRHGYDGQGTQIINS------PADLPDLSKA----P-PGSWMVE
Q8DJG7_THEEB          -------PSFPCVIKACRHGYDGQGTFVITD------EQAWQQFQQRWPEIP-PQGFLVE
K9Z498_CYAAP          QS-----FSFPLVLKARRHGYDGQGTVIVKS------PLELQSALEKF---K-QTPLLIE
Q2JM58_SYNJB          AG-----LGFPVVLKRRRQGYDGQGTRILHE------RAALQQALSQS---E-GIPLLLE
Q2JQI9_SYNJA          SS-----LSFPLVLKRRRQGYDGQGTRILPD------PATLQQALAEY---A-GIPLLVE
A2C9Y9_PROM3          TE-----WNFPVMAKSSRWGYDGKGTKVLKS------VEDLSQLQRSV---D-PTQWLLE
Q7VBT4_PROMA          AN-----WKFPLMAKSSFGGYDGKGTMVIND------FSDLKTLLQQV---N-PKQWFLE
Q31BK1_PROM9          SN-----WSFPLMAKSNKGGYDGKGNRKIMT------KEDLDSFLKEN---N-SDEWLIE
B0KC86_THEP3          --SFFEKFGFPFIQKATKGGYDGRGVVVIKD------KNDLDKMLRVDSL--------IE
Q9WYS8_THEMA          --SDVREFGFPVVQKARKGGYDGRGVFIIKN------EKDLENAIKGETY--------LE
Q8U3N1_PYRFU          --DKALEFGFPLVQKTRREGYDGKGVAVIRD------KSELAKLIPADSM--------LQ
Q5JDF6_THEKO          -----LENLIPVVQKARSGGYDGRGVVVIRD------EKDLQKALNVPSY--------VE
A6GZC2_FLAPJ          ILNQNSSIKIPFVWKCTQFGYDGNGVKVVRA------IEDLENLPNVECI--------AE
D4GVF3_HALVD          LRDALDEFGS-VMLKARTGGYDGRGNVPVSG------PDEAEAAIEEV-----GGPAMAE
Q9HRM3_HALSA          LRAAFEELGAPLMLKRRTGGYDGSGNAPVDS------VADARAEFGGD-----LGGFVAE
A0RVW3_CENSY          LKEGLERFGRPALLKARRGAYDGRGNRVIQK------GDDAAAALEQM-----GAPAYLE
A9A5N1_NITMS          VKEGLKKFGYPALLKARRDAYDGRGNFKVDS------EDMVQTAYDYFK----DQKLMLE
D9SVN7_CLOC7          LRNIFYNLGEKIILKTCKGGYDGKGNIVVKN------IKKLEDAYKEFS----DKELMVE
Q9JZJ9_NEIMB          I-TEASAQFLPGILKTATLGYDGKGQIRVKT------LDELKAAFAEHGGVD----CVLE
Q9XAY8_NEIME          I-TEESIQFLPGILKTATLGYDGKGQIRVKT------VDELKAAFAEHRGVD----CVLE
Q5F8B1_NEIG1          I-TEASAQFLPGILKTATLGYDGKGQIRVKT------LDELKAAFAEHGGVD----CVLE
Q7VY36_BORPE          L-LAAPQALFPGILKVARLGYDGKGQARIAS------REEALAAFDEFGGVP----CVLE
C6BCS8_RALP1          I-EQLPADLLPGILKIARMGYDGKGQARVST------IEELRAAWGAMQHVP----CVLE
Q8F650_LEPIN          KKSVLSKTNFPCILKTNTMGYDGRGQIRCIT------EQELSLVFSNLNKPD----HIVE
Q7UQS2_RHOBA          VVAAGEKLGWPIIVKTCRSGYDGKGQHRLNSPDDAASVEWAGAESGGDGQPP----WVAE
Q2GFG3_EHRCR          LVKNTIELGYPTLLKTTELGYDGKGQYIIKQ------QDDLSALSTLNWDQS----YILE
C7JGI8_ACEP3          LHEAAEKVGLPLILKTTRNGYDGKGQRRVHHI------HDLEEAFNALAPHP----LVAE
Q2RVJ3_RHORT          LAEAVAKIGCPAILKTTRLGYDGKGQVRLNAP------GDSAAAWAALGNRP----AVLE
Q3J672_RHOS4          LEAAIHGIGTPAILKTTRLGYDGKGQARLMEP------DDAAEAFAAMGGQP----AVLE
A4WX21_RHOS5          LEAAIHGIGTPAILKTTRLGYDGKGQARIMEP------DDAAEAFAAMGGQP----AVLE
C7CHX9_METED          LVRALEALGRPAVLKTRRFGYDGKGQRMIREG------DDPAALLAEFKGAP----CILE
B2IE68_BEII9          LKRALAEFGRPAILKTRRFGYDGKGQVLIGDD------ADPAAAFHALGGQP----AILE
Q89EH0_BRADU          LREAILRIGLPAVLKTRRFGYDGKGQAIIRAG------DDIAKVWTSLATKS----AILE
A0A4Y9UJP4_9BRAD      LREAIARIGLPAVLKTRRFGYDGKGQAIIREG------DDIAKVWTSLATKS----AILE
Q13B79_RHOPS          LRAAIARLGLPAVLKTRRFGYDGKGQIILREG------DDPDAAWAKLETRA----AILE
B6JC22_OLICO          LRCAAAALGLPAVLKTRRFGYDGKGQIMIRDG------DDLEAVWARLSTRS----AILE
Q9A3C1_CAUVC          LADAVARIGAPSLLKTRREGYDGKGQAWIQKV------SDAEAAFDKIGRQP----AILE
Q7CT83_AGRFC          LEAALTAFGGKGVLKTRRMGYDGKGQ-RLFRG-----GENLTGAFAALGGVP----LILE
B9J9P1_AGRRK          LEAALADFGGQGVLKTRRLGYDGKGQ-RVYRSS----ADSAEGGYTALGNVP----LILE
D0RG26_9RHIZ          LIAALGALGGRGILKTRRLGYDGKGQVRLASLD----ETQACNAFAAINKAP----AILE
Q9RYC6_DEIRA          LDGALDRVGGQGILKTSELGYDGKGQVRVAS------DTDLRQGWAELGQVA----CILE
PURK_PSEAE            DAAAAAI-GLPAVLKTRTLGYDGKGQKVLRQPAD------VQGAFAELGS----VPCILE
C3K4E1_PSEFS          DAAVASI-GLPAVLKTRTLGYDGKGQKVLRTAAD------VVGTFAELGS----VACLLE
Q5SKY0_THET8          EEGLKRV-GLPALLKTRRGGYDGKGQALVRTEEE------ALEALKALGG----RGLILE
G7TK78_XANOB          DAALAQI-GTPCVLKTRRFGYDGKGQFRIKTPAD------ADAAWDALGAQAAHVGLIVE
Q8P7V6_XANCP          DAALARI-GAPCVLKTRRFGYDGKGQFRIKTLAD------ADAAWDALGAQAATAGLIVE
B2FJA6_STRMK          AAKAAEF-GLPCILKTRRLGYDGKGQFRLRSEAD------IDAAWDALGAQVERTGLILE
Q5ZYZ4_LEGPH          MQAITDI-GMPAVLKTRRFGYDGKGQFVLRAQSD------ISKSWGLLGS----QPLILE
E4PGK3_MARAH          KAAAEEL-GCPVVAKSNTEGYDGKGQAVLKSPED------AEAAWTSIGH----PRLIVE
Q5NGE8_FRATT          QSAVDDH-GLPAILKTRRFGYDGKGQFVIRSQED------ITKAWDVLKD--APDGLIYE
B0U004_FRAP2          EKAVLDY-GLPAIVKTRRFGYDGKGQFVMKSQDD------VSKAWDALKN--APDGLIYE
PURK_VIBVY            NKAIEHV-GIPMVLKSALGGYDGRGQWRLKDAAQI---ETLWQEMAACIAATPTQAIVAE
PURK_VIBVU            NKAIEHV-GIPMVLKSALGGYDGKGQWRLKDAAQI---ETLWQEMAACIAATPTQAIVAE
PURK_VIBPA            ERAIEHV-GIPMVLKSALGGYDGKGQWRLKEAAQI---ETIWAEMAECIAATPTQAIVAE
PURK_VIBCH            TSAIAEI-GLPMVLKSALGGYDGKGQWRLKEPTQI---ESVWQELAQYLAANPEQAIVAE
A0A0H3AKH5_VIBC3      TSAIAEI-GLPMVLKSALGGYDGKGQWRLKEPTQI---ESVWQELAQYLAANPEQAIVAE
PURK_ALIF1            LNAIDTV-GIPMVLKSALGGYDGKGQWRLKDVSQV---DSIWEEMDELIKSSPNQAIVAE
Q5QZV5_IDILO          SAILNGC-DHAVVIKSAKGGYDGKGQWRWRPGDDI---AAVAEDAGQRPG-------IVE
A0A3D8XFP4_9ENTR      PAVFERL-GELAIVKRRTGGYDGRGQWRLR------------ANETEQLPAECYGECIVE
Q32JL4_SHIDS          PAVFDRL-GELAIVKRRTGGYDGRGQWCLR------------ADETEQLPAECYGECIVE
PURK_ECOLI            PAVFDRL-GELAIVKRRTGGYDGRGQWRLR------------ANETEQLPAECYGECIVE
B7ME44_ECO45          PAVFDRL-GELAIVKRRTGGYDGRGQWRLR------------ADETEQLPAECYGECIVE
Q8ZR71_SALTY          SGIFDRL-GELAIIKRRVGGYDGRGQWRLR------------ADETGQLPDDCYGECIVE
A0A0D6H8H0_SALTM      SGIFDRL-GELAIIKRRVGGYDGRGQWRLR------------ADETGQLPDDCYGECIVE
E5B3B2_ERWAM          AQVFTTL-GELAIVKRRTGGYDGRGQWRLR------------ASETATLPDACYGECIVE
A0A0H2W378_YERPE      PEVFATL-GELAIVKRRVGGYDGRGQWRLR------------PGEQGTLPPDAYGECIVE
D0ZCX4_EDWTE          PALFERL-GPLAIVKRRTGGYDGRGQWRIR------------PGHEPQLDAEIYGQCIVE
E7A526_HAEIF          NDVFQTV-GEKVVVKRRTGGYDGRGQWIIS------------DENKADITDDLFNKVIAE
A4NZE7_HAEIF          NDVFQIV-GEKVVVKRRTGGYDGRGQWIIS------------DENKADITDDLFGEVIAE
PURK_HAEIN            NDLFQTV-GEKVVVKRRTGGYDGRGQWIIR------------DENRADITDDLFGEVIAE
Q8EBG3_SHEON          ETLYQAF-GPRVLMKRRTGGYDGKGQHWLK------------QAEAGDIPHDWRNLAIAE
Q8D2V6_WIGBR          KKTFEKL-GDTIIMKSRIGGYDGKNQYIIN------------KDKEIELDNNYYNNFILE
PURK_SACS2            LKILREEFNNVGVIKESKGGYDGKGQYFIFND---------VEKYQFLREKKEK--MVVE
Q973U0_SULTO          LRILKDEFNNVGVLKQSRGGYDGKGQYFIKGD---------VEKYGFIKDMKCK--FVVE
Q9HJ65_THEAC          VRYARDM--GKAVIKNAYGGYDGKGQIVYDGG---------VSE----RLQGDR--FVVE
PURK_AQUAE            IDALKSF-KLPVVIKAEKLGYDGKGQYRIKKL---------EDANQVVKNHDKEESFIIE
A8MCK4_CALMQ          EKAYRTL--GKLVVKVPNGAYDGKGQFYVTNE---------EDL----PAIPVQYPLLVD
Q8ZZJ2_PYRAE          LKIAESM--RRAVVKVPTGGYDGKGQ-YVYPR---------EAG----AISRLEGELLVE
                                    *         .                                  :

A0A0F7RI76_BACAN      KWVPFEKEVSVIVIRSVSGETKVFPVAENIHVN--NILHESIVPA-R---ITEELSQKAI
Q81IQ8_BACCR          KWVPFEKEVSVIVIRSVSGETKVFPVAENIHVN--NILHESIVPA-R---ITEELSQKAI
A0A0E0T7S3_GEOS2      GWVPFVKEMSVIVARNLDGETAVFPVAENVHVE--NILHQTIVPA-R---IPESVQERAI
PURK_BACSU            SWVSFKMELSVIVVRSVNGEISTFPTAENIHHN--NILFQSIVPA-R---VEKGIQQKAA
C7VAB9_ENTFL          AWIPYEKELSVLISGNGRGEFATFPVVETIKKE--RKLHETIAPA-R---IDDEVSGELQ
Q8Y6B7_LISMO          AWIPFEKEISVVVARNLDGQIETFPVAENVHVN--NILHTTMVPA-D---VAADVYEEAE
Q8DRL8_STRR6          EFVNFDLEISVIVSGNGK-EVTFFPVQENIHRN--NILSKTIVPA-R---ISESLVDKAK
Q48VY5_STRPM          EFVNFDLEISVIVSGNGE-DVTVFPVQENIHCN--NILSKTIVPA-R---ISDQLADKAK
A0A0H3MSS3_STRS4      EFVNFDLEISVLVSGNGS-DYTVFPVQENIHRN--NILYKTIVPA-R---IFDELAEKAK
Q9CFG5_LACLA          DFISFEREISVIISGNGH-EYVVFPLAENEHRE--NILHQTISPA-R---ISAEITENAY
F0K3F8_LACD2          KFVDFRMEASVMIGRNSDGQVTVFPVSENINQG--EILHESIVPA-R---ISPDLAQKAQ
Q8G588_BIFLO          GFVDFAFEASILVSGNGK-DFVTFPIVRNEHRN--NILHMTIAPA-E---VSEHVAREAH
Q833Y5_ENTFA          KWVPFTKELSIIVAGNKH-GYQSFPVSENIHRK--NILHESIVPA-R---ISENVQQKAA
K0DAQ9_LEUCJ          QRVQFNQEVSIMVTRDAQGKITKWPVSENVHVN--HILKTSLVPA-N---VTDTVSEKIG
D5T0S2_LEUKI          QRVAFKKELSIMVTRDVGNHVSLWPIAENVHVN--HILKTSFAPA-K---ISEVEAEKIR
F9URK4_LACPL          ARQKFRTEVSMMVTRSAAGVVTTFPLVENQHQH--HILHTTIAPA-N---VQPSVHSAAR
A0A0R1F635_LACCA      KRQQFDREVSVMMTRDGRDQVRVFPIVENRHQH--HVLHLTLAPAPN---ISPVLAKKID
PURK_STAAW            KYLNIKKEVSLTVTRGNNNQITFFPLQENEHRN--QILFKTIVPA------RIDKTAEAK
PURK_STAAN            KYLNIKKEVSLTVTRGNNNQITFFPLQENEHRN--QILFKTIVPA------RIDKTAEAK
PURK_STAAR            KYLNIKKEVSLTVTRGNNNQITYFPLQENEHRN--QILFKTIVPA------RIDKIAEAK
PURK_MYCTU            ERVDLRRELSALVARSPFGQGAAWPVVQTVQRD--GTCVLVIAPAPA---LPDDLATAAQ
G0TI11_MYCCP          ERVDLRRELSALVARSPFGQGAAWPVVQTVQRD--GTCVLVIAPAPA---LPDDLATAAQ
PURK_MYCLE            ERVELRRELSALVARSPFGQGAAWPVVETVQRD--GICVLVVAPALA---LADDLASAAQ
F5Z233_MYCSD          ERVAMRRELSALVARSPFGQGAAWPVVETVQQD--GICVAVIAPAPE---LSDESAAAAQ
R4UHE1_9MYCO          ERVDMRRELSAMVARSPFGQGAAWPVVETVQRE--GICAVVIAPAPQ---LPEELALQAE
A0QTF2_MYCS2          ERVAMRRELSALVARSAFGQGSAWPVVQTVQRD--GICVEVIAPAPD---LPDDLAASAQ
A8M3L7_SALAI          ERVALRRELAVQVARSPFGQVAVYPVVETVQRD--GVCVEVLAPAPD---LPEELAVGAQ
H2JRI9_STRHJ          EKVDYVRELAANVVRSPHGQAVAYPVVESQQVN--GVCDTVIAPAPD---LEEDLALHAE
Q8CJX8_STRCO          EKVDFVRELAANVVRSPHGQAVAYPVVESQQVK--GVCDTVIAPAPD---LDEALALRAE
Q47LU2_THEFY          EKIAFRRELAVQVARSPYGQVAAYPVVETVQRG--GICHEVIAPAPH---LSEDRAVAAQ
PURK_CORAM            EKVGWSRELSVLVARTPSGEVATWPLTESVQRN--GVCAEAVAPAPG---VDPQLQQRAE
Q8NSG4_CORGL          KKVALNRELSAMVARTPSGETKAWPVVESVQKN--GVCAEAIAPAPE---LSAELQESTR
A0LRX0_ACIC1          THVAFRREVAVQVARSATGEIRAWPLVQTVQEN--GICTLVIAPAPQ---TDPEHAAHAR
Q7NL74_GLOVI          AFVTFERELAVMVARSSTGEVRSYPVVETRQRR--HVCHTVIAPAP----VDEVIRERAG
A9WGJ1_CHLAA          AWVPFTCELAVMVVRGRDGTIASYPVVETVQQN--HICHIVRAPAP----IEAKLAAQAT
Q2S241_SALRD          TFADFARELAVQVARRPGGNQVVYPVAYTEQRD--HRCHAVEVPAD----IDDAIADKAR
PURK_SYNY3            SFVPYERELAVIGVRNARGEMEIYPVVETKQID--QVCRWVVAPAP----IDAAIAATAQ
Q8DJG7_THEEB          AFVPYVKELAIMAARSPQGEIALYPVVETQQVA--AICRWVMAPAP----IAPQVSEQIQ
K9Z498_CYAAP          EFVPFEKELAIMAARSATGEIKVYPVAETYQEN--QVCRWVIAPAL----INQDITEKIS
Q2JM58_SYNJB          EWIPFERELAVMVARGLKGEIRVYPVVETVQIE--QICRHVLVPAR----IPPTTEAEIR
Q2JQI9_SYNJA          EWIPFERELAVMVARGLTGEIQIYPVVETVQVN--QVCRHVLVPAR----IPSSVEAEIR
A2C9Y9_PROM3          SWVPFEKELAIVVSRDAQGRVRSLPLAETHQFQ--QVCDWVIAPAS----VDHAVEMMAY
Q7VBT4_PROMA          KWINYDKELSLVVSRDLFGEVRTFPLVETFQTN--QICNWVLAPAD----VIHPVIAMAN
Q31BK1_PROM9          EWIEYEKELALVGSRDRTGKIRFFPIVETFQSN--HVCDWVLAPAT----TEYDLNLFAI
B0KC86_THEP3          EFVDMGKELAVMVARNLQGEIKCYPVVEMVFDESANILDLLIAPAR----IEKEIEENVK
Q9WYS8_THEMA          EFVEIEKELAVMVARNEKGEIACYPVVEMYFDEDANICDTVIAPAR----IEEKYSKIAR
Q8U3N1_PYRFU          EFVNIEKEIAVMVARDQEGNTVAYPVVEMTFNE-ANILDMLIAPAR----IEEEIAEEAK
Q5JDF6_THEKO          ELVPIEKELSVIVVRN-DDETLAYPTTEMVFNNEGNILDFLVAPGR----VEKDVEKEAE
A6GZC2_FLAPJ          EMVAFKNELAVIVVRNPSGEVKTYPVVEMEFHPEANQVEYVICPAR----IEDKVAQKAK
D4GVF3_HALVD          AFVDFERELSVIGVRGD-DEIRTFPAGENVHEE--EILRETVVPAR----TTDEVREEAD
Q9HRM3_HALSA          ELVDFERELSVIAARGD-AETATFPVAENLHEA--EILRESVVPAR----TSPAVREDAT
A0RVW3_CENSY          KMINYTMEVSVMAARSTSGEIRTYHPVENKHKD--GILHMSIAPAR----IDENTARAAG
A9A5N1_NITMS          KFVPFKMEVSVIAARNTKGEIKTFPLVENIHEE--NILRETIAPAR----VSEEITKNAE
D9SVN7_CLOC7          EFINYTKEVSIIVAKNH-EDITFYPIAENNHKD--SILINSIIPAK----ISKDTEEKII
Q9JZJ9_NEIMB          KMVDLRSEISVIVCRLNNDNVQTFDPAENIHEN--GILAYSIVPARL----SADVQQQAR
Q9XAY8_NEIME          KMVDLRGEISVIVCRLNNDNVQTFDPAENIHEN--GILAYSIVPARL----SADIQQQAR
Q5F8B1_NEIG1          KMVDLRGEISVIVCRLNDENVQTFDPAENIHEN--GILAYSIVPARL----SADVQQQAR
Q7VY36_BORPE          ALLPLDYEISVVIARGFDGASMVFPIARNVHRD--GILAVSSVTPGAADASHAARQVQAT
C6BCS8_RALP1          KMLPLAYEVSVLAARGADGSTATWPLAENVHRD--GIL-FSTIMPSRSVSDDIATRTRA-
Q8F650_LEPIN          EFFQFTSEASVIMARFEDGKILNFRPSKNVHKN--HILDLTFYPGNF----PDSIETKLV
Q7UQS2_RHOBA          ALVPFEREASVIVARTLDQRVETFPVFENDHQN--HILDETKLPADV----SPEMETQAR
Q2GFG3_EHRCR          KFVKIYKEISVIITKSISGSIEFFPTAENCHTD--GILTTSSVPALI----SQEINVQAQ
C7JGI8_ACEP3          GMVDFACEISVMVVRSADGTVRCFDPALNRHWN--GILDLTLAPA----PIDPSIAAQAV
Q2RVJ3_RHORT          GLVPFVSEISVIIARAPDGATACFEPTLNHHRE--GILHTSSVPA----PIRPQTAIAAR
Q3J672_RHOS4          GFVRFTHEVSVIAARGRDGSVAVYEPGENVHLS--GILHTTTVPA----RLTASQRTDAV
A4WX21_RHOS5          GFVRFTHEVSVIAARGRDGSVAVYEPGENVHLS--GILHTTTVPA----RLTASQRTDAV
C7CHX9_METED          GFVPFEREISVVAARGPDGTFAAYDPCANEHRD--HILALTRVPAP---GLTRTTGDAAV
B2IE68_BEII9          GFVPFSKEISVVAARGVQGEFAAFDVCENIHRH--HILQSTHVPA----RVDAITATKAV
Q89EH0_BRADU          AFVPYEREISVIAARSVAGQVECFDVTENEHRD--HILKISRAPA----PIPDALAEEAR
A0A4Y9UJP4_9BRAD      AFIPYEREISVIAARSATGQVECFDVTENEHRD--HILKISRAPA----QIPDALAEEAR
Q13B79_RHOPS          AFVPFEREVSVIAARGSDGQVVCYDVTENEHRD--HILKVSRVPA----PVTDAVADEAR
B6JC22_OLICO          TFVPFEREVSVIAARSATGEVVCYDVTENEHQN--HILKISHAPA----AIPPALAAQAR
Q9A3C1_CAUVC          APADFGRELSVIAARGRDGEIACYPVSENHHEG--GVLRRTVAPA----KITPATRDQAE
Q7CT83_AGRFC          SFVAFEREISIIAARFQDGTVTCYDPAENVHLN--GILHTSTVPA----ALSDAAKAVAV
B9J9P1_AGRRK          SFVSFEREISIIAARGLDGAIACYDPAENIHRN--GILHTSTLPA----SISAETAAAAR
D0RG26_9RHIZ          GFVEFEREVSVIAARDRSGNVAIFDLAENVHKD--GILATSTVPA----AISVQTAEAAR
Q9RYC6_DEIRA          GFVTFEREVSLAVARTADGRLAFGPLVENVHRD--GILRTSVYPAAV----PDGTEARAR
PURK_PSEAE            GFVPFTGEVSLVAVRARDGETRFYPLVHNTHDS--GILKLSV--ASS----GHPLQALAE
C3K4E1_PSEFS          GFVPFTGEVSLIAVRARDGETRFYPLVHNTHDS--GILKLSV--AST----DHPLQALAE
Q5SKY0_THET8          GFVPFDREVSLLAVRGRTGEVAFYPLVENRHWG--GILRLSL--APAP-GASEALQKKAE
G7TK78_XANOB          AFVPFQREVSVVAVRGRDGAFRAWPLTENWHVD--GVLSASL--APAC--VDAALQASAE
Q8P7V6_XANCP          AFVPFEREVSVVAVRGRDGGFRAWPLTENWHVD--GVLSASL--APAS--VDAGLQEAAE
B2FJA6_STRMK          GFVAFQREVSVVAVRGRDGSFEAWPVTGNWHVD--GVLSASV--APAV--LSDAEQQAAI
Q5ZYZ4_LEGPH          ELISFESEFSLIAVRNKSGETSFYPLIKNHHRK--GILHFSE--APVH---QDTLQQEAQ
E4PGK3_MARAH          KFVDFHREVSIIAVRAEDGELAFYPMAENTHHE--GILRYSI--APAP-KLEKHVQEDAE
Q5NGE8_FRATT          AFVDFDYEVSQICTADLKGNIAFYPLARNTHKQ--GIIVESE--APFE---NVVLAEKAQ
B0U004_FRAP2          AFVDFDYEVSQICTADIKGNIAFYPLAKNTHKQ--GIIVESE--APFE---NPVLAEKAQ
PURK_VIBVY            EFVPFQREVSLIGARGKEGQIEVYPLAENIHVN--GVLSLST--AID----SPDLQEQAK
PURK_VIBVU            EFVPFQREVSLIGARGKEGQIEVYPLAENIHVN--GVLSLST--AID----SPDLQEQAK
PURK_VIBPA            EFVPFNREVSLVGARGKDGSVEVYPLAENVHTN--GVLSLST--AID----APELQAQAK
PURK_VIBCH            EFVAFDREVSLVGARNLVGDVVVYPLAENVHTQ--GVLSLST--AID----APALQTQAK
A0A0H3AKH5_VIBC3      EFVAFDREVSLVGARNLVGDVVVYPLAENVHTQ--GVLSLST--AID----APALQTQAK
PURK_ALIF1            QFIPFNREVSLIGARNKNGQMVTYPLTENVHVD--GVLALST--ALEG---TSNLQQQAD
Q5QZV5_IDILO          DMIDFTDEVSVVGARSHKGEQRCFPLTLNVHTQ--GILSYSL--AGAE-HFSKKLETLAK
A0A3D8XFP4_9ENTR      QGINFSGEVSLVGARGFDGSTVFYPLTHNLHQD--GILRTSV---AFP-QANAQQQAQAE
Q32JL4_SHIDS          QGINFSGEVSLVGARGFDGSTVFYPLTHNLHQD--GILRTSV---AFP-QANAQQQAQAE
PURK_ECOLI            QGINFSGEVSLVGARGFDGSTVFYPLTHNLHQD--GILRTSV---AFP-QANAQQQAQAE
B7ME44_ECO45          QGINFSGEVSLVGARGFDGSTVFYPLTHNLHQN--GILRTSV---AFP-QANAQQQAQAE
Q8ZR71_SALTY          RGIHFSGEVSLVGARAHDGSTVFYPLTHNLHQD--GILRTSV---AFP-QANAEQQEQAE
A0A0D6H8H0_SALTM      RGIHFSGEVSLVGARAHDGSTVFYPLTHNLHQD--GILRTSV---AFP-QANAEQQEQAE
E5B3B2_ERWAM          QGINFLGEMSLVGARGDDGSTVFYPLTHNLHQN--GILRTSV---MLP-DVDAQHQQQAE
A0A0H2W378_YERPE      QGINFSGEVSLIGARSHQGESVFYPLTHNLHED--GILRMSV---ALP-QPNSKLQQQAE
D0ZCX4_EDWTE          QGINFIGEVSLIGARAQDGRCVFYPLTHNLHQD--GILRASL---VFP-QPESFLQEKAQ
E7A526_HAEIF          KFIPFDYEVSIVGARFKNGEKRFYPVTHNLQQN--GILRYSVVDSAFP-QQSAQ-QKQAE
A4NZE7_HAEIF          KFIPFDYEISIVGARFKNGEKRFYPVTHNLQQN--GILRYSVVDSAFP-QQSAQ-QKQAE
PURK_HAEIN            KFIPFDYEVSIVGARFKNGEKRFYPVTHNLQQN--GILRYSVVDCAFP-QQSVQ-QKQAE
Q8EBG3_SHEON          QAINFDEEVSLVGVRTREGQCVFYPLTLNLHQD--GILMASI---APL-ARLDHLQAQAE
Q8D2V6_WIGBR          KKIKFAEELSIIGARNNKGRKVFYPITFNLHDS--GILRCSI---PYI-HKRHNLQKQAE
PURK_SACS2            EYVKFDFEASIIIARDKRGVFISYPPTYNYNEK--GILVYNY---GPY-NNQN-----IV
Q973U0_SULTO          EFVNFNYEASIIAVRDRNGNFKAYPPTFNYNEK--GILVYNY---GPL-KDNR-----FA
Q9HJ65_THEAC          EFIDFDYEASIIAVRDRDGNFTYFDPTYNYNRE--AIFIYNV---APT-DELT-----MP
PURK_AQUAE            EFVKFEAEISCIGVRDREGKTYFYPQPFNKHEE--GILIYNY---VPY-AKLKE----AE
A8MCK4_CALMQ          EFINIEKEVSVILARAVNGEVAVYPITENHNHN--GMLLYSR---APA-NINEDLSGKAT
Q8ZZJ2_PYRAE          EYVDIKREFSIVAVRAENGNVYFYPPAQNYYVH--GILVWNI---APV-KAPEE----AY
                             * :                                                  

A0A0F7RI76_BACAN      AYAKVLADELELVGTLAVEMFATADG--------EIYINELAPRPHNSGHYTQDACETSQ
Q81IQ8_BACCR          AYAKVLADELELVGTLAVEMFATDNV--------EIYINELAPRPHNSGHYTQDACETSQ
A0A0E0T7S3_GEOS2      RYAEVLAASFSLVGTLAVEMFLTADG--------DIYINELAPRPHNSGHYTINACATSQ
PURK_BACSU            DLAVKLADELNLVGPLAVEMFLTEDG--------ELLVNELAPRPHNSGHYTLDLCETSQ
C7VAB9_ENTFL          RIAKVIAKAVGLVGTLSIEMFYTETG--------GIYVNKILPRPEDAGNFSIDACSFSQ
Q8Y6B7_LISMO          EIARKLAEVLQLCGVLAVEMFVTKSG--------AIYVNELAPRPHNSGHFTIEACSISQ
Q8DRL8_STRR6          AMAVRIAEQLNLSGTLCVEMFATDD---------DVIVNEIAPRPHNSGHYSIEACDFSQ
Q48VY5_STRPM          KMAVQIAKKLQLSGTLCVEMFATAD---------DIIVNEIAPRPHNSGHYSIEACDFSQ
A0A0H3MSS3_STRS4      TMALQIADKLHLVGTLCVEMFVAGQ---------EILVNEIAPRPHNSGHYSIEACDFSQ
Q9CFG5_LACLA          KIATSIAEKLELSGVLCVEMFLTADG--------QIYVNELAPRPHNSGHFTIEACDFNQ
F0K3F8_LACD2          EAAVKIAEAIDLKGILGVEMFVTKDD--------KIVINELAPRPHNSGHYSIEACNFSQ
Q8G588_BIFLO          ELAIRLAKGFELAGTLAIELFITKDD--------QVIVNELAPRPHNSGHYTIEACSMDQ
Q833Y5_ENTFA          ELAQYIAEELNLSGVLAIEMFLTDSE--------ELYVNELAPRPHNSGHYSIEACSFSQ
K0DAQ9_LEUCJ          VIATNIATALSLRGVLGIELFVN-GE--------DIWVNELAPRPHNSGHYSIEATNVSQ
D5T0S2_LEUKI          HIATRIADSLNLRGVLGIELFVS-ED--------HIWVNELAPRPHNSGHYTIEGTNISQ
F9URK4_LACPL          KIAVSIAESLELRGVLGIEFFVLPDD--------TLLVNELAPRPHNSGHYTIEACNISQ
A0A0R1F635_LACCA      DLATKIALGLDLRGVLGVELFIE-GD--------NVVANELAPRPHNSGHYSIEACNFSQ
PURK_STAAW            EQVNKIIQSIHFIGTFTVEFFIDSNN--------QLYVNEIAPRPHNSGHYSIEACDYSQ
PURK_STAAN            EQVNKIIQSIHFIGTFTVEFFIDSNN--------QLYVNEIAPRPHNSGHYSIEACDYSQ
PURK_STAAR            EQVNKIIQSIHFIGTFTVEFFIDSNN--------QLYVNEIAPRPHNSGHYSIEACDYSQ
PURK_MYCTU            RLALQLADELGVVGVLAVELFETTD--------GALLVNELAMRPHNSGHWTIDGARTSQ
G0TI11_MYCCP          RLALQLADELGVVGVLAVELFETTD--------GALLVNELAMRPHNSGHWTIDGARTSQ
PURK_MYCLE            QLALRLAAELGVVGVFAVELFETAD--------GALLVNELAMRPHNSGHWTMDGARTSQ
F5Z233_MYCSD          QLALRLADELGVVGVLAVELFETVD--------GELLVNELAMRPHNSGHWTMDGAATSQ
R4UHE1_9MYCO          QLALRIANELGVTGCLAVELFETND--------GRLLVNELAMRPHNSGHWSMDGARTGQ
A0QTF2_MYCS2          QLGLRLAAELGVIGVLAVELFETVD--------GRILVNELAMRPHNSGHWTMDGAVTSQ
A8M3L7_SALAI          QLAIDLATALGVVGLLAVELFEVADPA--EVTGSRLVVNELAMRPHNSGHWTIEGARTSQ
H2JRI9_STRHJ          QMALTIAKELGVVGHLAVELFQTRD--------GRILVNELAMRPHNSGHWSMDGAITSQ
Q8CJX8_STRCO          EMALGIAKELGVVGHLAVELFQTRD--------GRVLVNELAMRPHNSGHWTMDGAITSQ
Q47LU2_THEFY          ELAIELAAALDVVGLLAVELFETDT--------G-VVVNELAMRPHNSGHWTIDGACTSQ
PURK_CORAM            TLGEKIATELGVTGVLAVELFAFAN----ESGAEDIAVNELAMRPHNTGHWTLVGSVTSQ
Q8NSG4_CORGL          GLAQKIATELGVTGVLAVELFETLD----QNGQPEIFVNELAMRPHNTGHWTQDGCVTSQ
A0LRX0_ACIC1          TLAENIAKELDVVGLLAVEMFDTGG-------DEPFVVNELAMRPHNSGHWTMDGSVTSQ
Q7NL74_GLOVI          AVARAAVEAVEGVGIFGVELFVDAR--------GEVSINELAPRPHNSGHYTLDACTTSQ
A9WGJ1_CHLAA          DLAVAAIQAVDGVGIFGVELFALAD--------GQVLINELAPRPHNSGHYTIEACVTSQ
Q2S241_SALRD          HIAQKSVDAVEGVGLIAVELFEMPD--------GRVLVNELAPRPHNTGHYSIEGAATSQ
PURK_SYNY3            DYCRRILNHLDYVGILAIEFFLLPASTQTPTPEQRLLVNELAPRTHNSGHFSLDACHTSQ
Q8DJG7_THEEB          QMARQILTALDGVGIFGIEFFL--------TATGEVLVNEIAPRTHNSGHYTIDACVTSQ
K9Z498_CYAAP          AIASKLLVSLDYVGILGIELFM--------KNNGEVLINEVAPRTHNSGHYTLDACETSQ
Q2JM58_SYNJB          RLAADLMEKLGAVGVFGIELFWVPP----PHPKAGIWINEISPRVHNSGHYTLEACRTSQ
Q2JQI9_SYNJA          DLAVKVMEKLDAVGVFAIELFWVPP----PHPKAGIWINEISPRVHNSGHYTLEACHTSQ
A2C9Y9_PROM3          NMAASLLTELNYVGVLAVEFFYG---------PEGLQVNEVAPRTHNSAHFSIEACSSSQ
Q7VBT4_PROMA          NIAISLVRELNYTGVLAIEFFYG---------NDGLLVNEIAPRTHNSAHLSIEACASSQ
Q31BK1_PROM9          NIFSSIVNELNYVGVLAIEFFYG---------DNGLLINEIAPRTHNSAHFSIEACTSSQ
B0KC86_THEP3          EIAIKAVEALDGIGIFGIEMFLTKD--------KKILINEIAPRPHNSGHYTIEACVTSQ
Q9WYS8_THEMA          EIATSVVEALEGVGIFGIEMFLTKQ--------GEILVNEIAPRPHNSGHYTIEACVTSQ
Q8U3N1_PYRFU          RIAIKAVKALDGVGIFGVEMFLTKD--------GEVYLNEIAPRPHNSGHYTIEACLTSQ
Q5JDF6_THEKO          EIAIRAVEALDGRGVFGVEMFLARD--------GRVLVNEIAPRPHNSGHWTIEAAVSSQ
A6GZC2_FLAPJ          KIALNVSEKFNHVGLLAVEMFQTQN--------DEILVNEVAPRPHNSGHHTIEASYTSQ
D4GVF3_HALVD          RVAREVLSHLPGRGVFGIELFETAAGD--------VLVNEVAPRPHNSGHWTIEGALTSQ
Q9HRM3_HALSA          GVAADVLDALDGRGVFGVELF-AVDGR--------VLVNEIAPRPHNSGHYTIEGCRTSQ
A0RVW3_CENSY          QAARDVLDRIGGAGVFGIEMFVEKRGG--------ILVNEVAPRVHNSGHHTLQSCITSQ
A9A5N1_NITMS          KIASQTMDVLKGAGVFGIEMFVTRDDQ--------IVINEIAPRVHNSGHHTLESSETSQ
D9SVN7_CLOC7          EVAKKVVETLDDFGVFCIEFFIDTDLD--------VLVNEIAPRPHNSGHYSIEGCTTSQ
Q9JZJ9_NEIMB          QMAQRLADELDYVGVLAVEMFVVGDTHE-------LVVNEIAPRPHNSGHHTIDACAADQ
Q9XAY8_NEIME          QMAQRLADELNYVGVLAVEMFVVGDTHE-------LVVNEIAPRPHNSGHHTVDACAADQ
Q5F8B1_NEIG1          QTAQRLADELDYVGVLAVEMFVVGDTHE-------LLVNETAPRTHNSGHHTIDACAADQ
Q7VY36_BORPE          QAAQAIAQGLGYHGVLCVEFFVLGDGR--------LVVNEIAPRPHNSGHYTIDACVTSQ
C6BCS8_RALP1          -AAAMIAEEMGYVGVLCIEFFVLQDGS--------LVANEMAPRPHNSGHITMDVCETSQ
Q8F650_LEPIN          NYAKKLAETIDYVGVFGIEFFIR--GDE-------ILCNEFAPRPHNSGHFSQNSGTISQ
Q7UQS2_RHOBA          EIARRVAEHLGLVGLLCVELFVT--KDE-------LIVNEVAPRPHNSGHVTIEACATSQ
Q2GFG3_EHRCR          KIALQIAESINLVGLLAVEFFITDTQ--------ELIVNEIAPRPHNSGHWSLDACNISQ
C7JGI8_ACEP3          KLATTIAEKLELVGILGVEMFVDRTGN--------LLVNEMAPRPHNSGHWTMNACPQDQ
Q2RVJ3_RHORT          AIAESAALALDLVGLLAVELFVLADGS--------LLVNEMAPRPHNSGHWTMDACHTDQ
Q3J672_RHOS4          LLAGRILNALDYVGVMGVELFVTPEA---------LLVNEIAPRVHNSGHWTQNGCAVDQ
A4WX21_RHOS5          LLAGRILNALDYVGVMGVELFVTPEA---------LLVNEIAPRVHNSGHWTQNGCAVDQ
C7CHX9_METED          AIARAIAEALDYVGVLAVEMFEIAGPEG----AARLVVNEIAPRVHNSGHWTIEGALTSQ
B2IE68_BEII9          NMAKTIADALDYVGILAVELFLVEDPAS----ETQLLVNEIAPRVHNSGHWTEGGAVTSQ
Q89EH0_BRADU          SIASKIASALDYVGVLAVEMFVLAN-GT----GPKVLVNEIAPRVHNSGHWTLDGASVSQ
A0A4Y9UJP4_9BRAD      SIAGKIAGALDYVGVLAVEMFVLAN-GT----GPKVLVNEIAPRVHNSGHWTLDGASVSQ
Q13B79_RHOPS          RIAKTIADALNYVGVLGVEMFVVPG-DG----GARVLVNEIAPRVHNSGHWTLDGASVSQ
B6JC22_OLICO          EVATRIATELKYVGVLGVEMFVVPG-EN----GPSVLVNEIAPRVHNSGHWTLDGASVSQ
Q9A3C1_CAUVC          SIVAKILTALDYVGVIGVELFELSGGK--------LLVNEFAPRVHNTGHWTQDGCEVDQ
Q7CT83_AGRFC          QSAEKLLAALEYVGVIGIEFFVLPDGS--------LVANEMAPRVHNTGHWTEAACAISQ
B9J9P1_AGRRK          EAAEKILTALGYVGVIGIEFFALADGS--------LIANEMAPRVHNSGHWTEAACVVSQ
D0RG26_9RHIZ          TAAEKLLHALDYVGVLGLEFFVLKDGT--------LLANEFAPRVHNSGHWTEAACAISQ
Q9RYC6_DEIRA          EMARAVAEGWGLEGLLTLEFFQVPDGD--------LLVNEVAPRVHNSGHLTQDGGGASQ
PURK_PSEAE            DYVGRVLARLDYVGVLAFEFFEVDGG---------LKANEIAPRVHNSGHWTIEGAECSQ
C3K4E1_PSEFS          DYSSRVLKQLDYVGVMAFEFFEVDGG---------LKANEIAPRVHNSGHWTTEGAECSQ
Q5SKY0_THET8          AYALRAMEALDYVGVLALEFFQVGEE---------LLFNEMAPRVHNSGHWTIEGAETSQ
G7TK78_XANOB          SHARAVAEKLDYVGVFALELFVRDGE---------LLANEMAPRVHNSGHWTIEGAETSQ
Q8P7V6_XANCP          AHARALAERLDYVGVFALELFVREGT---------LLANEMAPRVHNSGHWTIEGAETSQ
B2FJA6_STRMK          GYARRVAEHLQYVGVFALELFCRDGE---------LLANEMAPRVHNSGHWTIEGSETSQ
Q5ZYZ4_LEGPH          THAFKILEALNYVGVLTIEFFYQGNQ---------LIANEIAPRVHNSGHWTIEGAHTSQ
E4PGK3_MARAH          RYIKALLNELDYVGVLTLELFETTDG---------LVANEMAPRVHNSGHWTIEGAMTSQ
Q5NGE8_FRATT          QIAKILVKEFAYVGTLAIEFFVKGDE---------LIVNEIAPRVHNSGHWSIDGAVTSQ
B0U004_FRAP2          QIAKTLVKEFAYVGTLAIEFFVKGDE---------LIVNEIAPRVHNSGHWSIDGSITSQ
PURK_VIBVY            HMFTAVAETLNYVGVLALEFFDV----DGQ-----LLVNEIAPRVHNSGHWTQQGAETCQ
PURK_VIBVU            HMFTAVAETLNYVGVLALEFFDV----DGQ-----LLVNEIAPRVHNSGHWTQQGAETCQ
PURK_VIBPA            QMFTAVADSLNYVGVLALEFFDV----EGT-----LLVNEIAPRVHNSGHWTQQGAETCQ
PURK_VIBCH            AMFKAVAEQLNYVGVLALEFFEV----QGQ-----LLVNEIAPRVHNSGHWTQQGAETCQ
A0A0H3AKH5_VIBC3      AMFKAVAEQLNYVGVLALEFFEV----QGQ-----LLVNEIAPRVHNSGHWTQQGAETCQ
PURK_ALIF1            EMFTAIADELNYIGVLAIEFFDV----DGT-----LLVNEIAPRVHNSGHWTQQGTDICQ
Q5QZV5_IDILO          EHHQKLTNALDYVGVLAIEFFVVGEGDNQH-----LLVNEVAPRVHNSGHWTMSGANCDQ
A0A3D8XFP4_9ENTR      EMLSAIMQELGYVGVMAMECFVTPQG---------LLINELAPRVHNSGHWTQNGASISQ
Q32JL4_SHIDS          EMLSAIMQELGYVGVMAMECFVTPQG---------LLINELAPRVHNSGHWTQNGASISQ
PURK_ECOLI            EMLSAIMQELGYVGVMAMECFVTPQG---------LLINELAPRVHNSGHWTQNGASISQ
B7ME44_ECO45          EMLSAIMQELSYVGVMAMECFVTPQG---------LLINELAPRVHNSGHWTQNGASISQ
Q8ZR71_SALTY          SMLSAIMQALNYVGVMAMECFITPEG---------LLINELAPRVHNSGHWTQNGASISQ
A0A0D6H8H0_SALTM      SMLSAIMQALNYVGVMAMECFITPEG---------LLINELAPRVHNSGHWTQNGASISQ
E5B3B2_ERWAM          RMLSAIMHDLNYVGVMAMECFVVPEG---------LLINELAPRVHNSGHWTQNGASISQ
A0A0H2W378_YERPE      KMLSAIMDKLNYVGVMAMECFIVGDR---------LLINELAPRVHNSGHWTQNGASISQ
D0ZCX4_EDWTE          AMLQRIMQRLEYVGVMAMECFVVDDD----T----LLINELAPRVHNSGHWTQNGASISQ
E7A526_HAEIF          TMLGKIMDKLGYVGVMAMECFVVGDK---------LLINELAPRVHNSGHWTQLGCAISQ
A4NZE7_HAEIF          TMLGKIMDKLGYVGVMAMECFVVGDK---------LLINELAPRVHNSGHWTQLGCAISQ
PURK_HAEIN            TMLGKIMDKLGYVGVMAMECFVVGDK---------LLINELAPRVHNSGHWTQLGCSISQ
Q8EBG3_SHEON          TMLSAIMHELEYAGVMAMECFRVGDN---------LLVNELAPRVHNSGHWTQAGTHMDQ
Q8D2V6_WIGBR          QMLGSLMKFTNYIGVMAMEFFLFENN---------LIVNEIAPRVHNSGHWTQNGSSISQ
PURK_SACS2            EIARRLSEELDYVGIMGVEVFVV-NGK--------VLINEFAPRVHNTGHYTLDGALISQ
Q973U0_SULTO          EIAKRLMDSLEYVGTIGIEFFVR-DGE--------ILINEFAPRVHNTGHYTLDAAFVSQ
Q9HJ65_THEAC          AIAKKLMEALDYHGVMGIEFYVR-KRK--------VIINEYAPRVHNSGHHTLLGSSVSQ
PURK_AQUAE            EITKRLMELLDIVGVFTVEFFLLKDGR--------VLINEFAPRVHNTGHWTLDGAYTSQ
A8MCK4_CALMQ          ELAVKLANSLNYVGVLAVEFFLTKDQE--------LLINEYAPRVHNTGHWTLSGAVTSQ
Q8ZZJ2_PYRAE          EYVHRILDRWKYVGVLAVEFFETSDGR--------ILANEIAPRVHNTAHWTLETD-ASQ
                                   * : .* :              .  *:   * .::.: :       *

A0A0F7RI76_BACAN      FGQHIRAICNLPLG-ETNLLKP-VVMVNILGEHIEGVLRQ---------VNRLTG-CYLH
Q81IQ8_BACCR          FGQHIRAICNLPLG-ETNLLKP-VVMVNILGEHIEGVLRQ---------VNRLTG-CYLH
A0A0E0T7S3_GEOS2      FAQHIRAVCNWPLG-STELLKP-AVMVNILGEHVEPVIRH---------IGAFDGGTYVH
PURK_BACSU            FEQHIRAVCGLPLG-KTDLLKP-GMMVNLLGDEVKLVEED---------PELLKE-AKLY
C7VAB9_ENTFL          YDTHIRGLCNWPMP-TIQLLSE-AVTVNVLGNEAYETMDI---------INEHPD-WHFH
Q8Y6B7_LISMO          FTQHIRAIVGLPLV-KPELLKP-AVMINILGQHVDAVNKQ---------MVNYPH-WFVH
Q8DRL8_STRR6          FDTHILGVLGAPLP-VIKLHAP-AVMLNVLGQHVEAAEQY---------VTENSS-AHLH
Q48VY5_STRPM          FDTHILGVLGAPLP-TIHLHAP-AVMLNVLGQHVQQAIDY---------VAQNPS-AHLH
A0A0H3MSS3_STRS4      FDTHIRGILGEPLP-PIRLLSP-AVMINVLGQDMETVQTF---------LQENPT-AHPH
Q9CFG5_LACLA          FDLHIKGILGEDLP-EPKLLKP-AIMLNVLGQHVEAVKKL---------NHEHAD-WHQH
F0K3F8_LACD2          FAVHNRAICNWPLP-KIKLLSP-VVMVNVLGQHVAGTEKL---------IAEKPQ-WSFH
Q8G588_BIFLO          FDAHIRGIAGWPLP-KPKLLSP-AVMVNVLGQHVEPTRAL---------IATHPE-WNVH
Q833Y5_ENTFA          FDAHIRGISNWGIG-LPQLLQS-VVMVNLLGEHLEKSYQL---------CTSKPT-WQVH
K0DAQ9_LEUCJ          FEGHIRSITGLPLP-AISLYQP-TLMVNLLGDELEQARHD---------FAEHPE-WHFH
D5T0S2_LEUKI          FEGHIRSIMGLPLP-EIVSEKP-ALMLNLLGNELQQARED---------LVNHPE-WHFH
F9URK4_LACPL          FEAHIRSICGLPIP-AITQTSP-AVMRNLLGDDLTVARQQ---------LVEHPE-WHFH
A0A0R1F635_LACCA      FDAHILSICGLPIP-PITLKQP-AVMRNLLGDDLTIAKQK---------WPQHPE-WHMH
PURK_STAAW            FDTHILAVTGQSLPNSIELLKP-AVMMNLLGKDLDLLENE---------FNEHPE-WHLH
PURK_STAAN            FDTHILAVTGQSLPNSIELLKP-AVMMNLLGKDLDLLENE---------FNEHPE-WHLH
PURK_STAAR            FDTHILAVTGQSLPNSIELLKP-AVMMNLLGKDLDLLENE---------FNEHPE-WHLH
PURK_MYCTU            FEQHLRAVLDYPLGDSDAVVPV-TVMANVLGAAQPPAMSV---DERLHHLFARMPDARVH
G0TI11_MYCCP          FEQHLRAVLDYPLGDSDAVVPV-TVMANVLGAAQPPAMSV---DERLHHLFARMPDARVH
PURK_MYCLE            FEQHLRAVLDYPLGETDAVAPV-TVMVNVLGAPQPPTLSVVTMDERLHHLFARMPDARVH
F5Z233_MYCSD          FEQHLRAVLDYPLGATDPVVPV-TVMANVLGAPEPPAMTI---DERLHHLFARYPDARVH
R4UHE1_9MYCO          FEQHLRAVLDYPLGSTEPLAPV-TVMANVLGAPQTPAMSL---DERMHHLMGRIPEAKVH
A0QTF2_MYCS2          FEQHLRAVLDYPLGETSARAEI-VVMSNVLGAPETPAMSL---DERIHHLFARMPDAKVH
A8M3L7_SALAI          FEQHLRAVLDYPMGDTSLAAPI-VVMANVLGG-EPGGMSF---DERLHHLFAAEPGAQVH
H2JRI9_STRHJ          FANHVRAVLDLPLGDPRPRATW-TVMVNVLGGDFPDMYSA------YLHCMARDPKLKIH
Q8CJX8_STRCO          FANHVRAVLDLPLGDPRPRAKW-TVMVNVLGGDYPDMYSA------YLHCMARDPQLKIH
Q47LU2_THEFY          FEQHLRAVLDLPLGSPRTVAPF-TVMANLLGGHDPHVFNR------YIHVMARDPELKVH
PURK_CORAM            FEQHLRAVMDEPLGDTSTLAPV-TVMANVLGADEDQRCQW---ASVP-RSGAPVPATKVH
Q8NSG4_CORGL          FEQHLRAVLDYPLGATDTLADY-TVMANVLGADTDPEMPM---ATRMVEVGRKYPDAKIH
A0LRX0_ACIC1          FEQHLRAVLGWPLGDTSLRAPV-TVMANLLGGSGVEAAAV----HSRIPAALADPGVRLH
Q7NL74_GLOVI          FEQHLRAVLGWPLADPSMHSPA-AVMVNILAEGD-APEAE-----PDLAAALAFAGVKVH
A9WGJ1_CHLAA          FENHLRAVAGWPLGATALRSPA-AVMVNLLGRRN-GPITP-----TAITAALAVPGAHMH
Q2S241_SALRD          FENHVRAVLDWPLGDPSLRTPV-AVMVNVLGRREGTPPQT-----TGLPRALDTEGVTPH
PURK_SYNY3            FALQLQAVTGQTLGSSALRCGQ-AVMVNLLGYEVSTGDYQ----QQL-DKLAALPHSHVH
Q8DJG7_THEEB          FQQHLRAISGQPLGSPDMRVSA-AVMVNLLGLAEPQVDYG----AKC-QALAALPHANLH
K9Z498_CYAAP          FAMQLQTITGKKLGNTRLKSSG-AVMINLLGYESAQSEYL----PQR-KEIEQL-GAFVH
Q2JM58_SYNJB          FEQHLRAILGLPLGDPSLKCGG-AVMVNLLGYEHSTGDYP----EKR-QRLAQLPNATVH
Q2JQI9_SYNJA          FEQHLRAILGLPLGDPSLKCGG-AVMVNLLGYEHSTSDYA----EKR-QRLAQLPNATVH
A2C9Y9_PROM3          FDQQLCIAAGLPVPATDLHAPG-ALMVNLLGLQKGVEPSL----DERLAKLRSCDRFHLH
Q7VBT4_PROMA          FEHQIAIAARKPVKSTELIAPG-AIMVNLLGFKDS-ENIV----ERRLQLLKKINGVNLH
Q31BK1_PROM9          FDQYVCISSGIMPPEIKMHSEG-AIMINLLGLKKNFPISI----ETRVKMLSEIEGSNIH
B0KC86_THEP3          FEQHLRAICGFALGSTE-LLSP-AVMINLLGEKGYRGVPL----IEGLEEVLSIEGVSFH
Q9WYS8_THEMA          FEQHIRAIMNLPLGSTE-LLIP-AVMVNLLGEEGYYGKPA----LIGLEEALAIEGLSLH
Q8U3N1_PYRFU          FEQHIRAITGLPLGSSE-LLIP-AVMFNLLGEG--NGKPK----VIGMKEALKFPGVYVH
Q5JDF6_THEKO          FEQHVRVVADLPLGSTE-VVLN-AAMVNLLGEKGYYGKPV----YDGVSEALRIPGVFVH
A6GZC2_FLAPJ          FENHIRAILDLPLGNTN-SKVA-GIMVNLVGAEGFSGDVI----YENIEKILAINGVTPH
D4GVF3_HALVD          FEQHVRAVLGWPLGATTRRSP--TVMANVLGTVD-ESQPARLG---GLDDALAESGVSLH
Q9HRM3_HALSA          FEQCIRAVLGLPLGDTTLREP--TVMANLIGDPDVDPHPATIA---GVPAAFRDAGVALH
A0RVW3_CENSY          FEQHLRAVLGLELGDTKLLRP--AVMCNILGPPGFEGRYKPV--------AAPE-GIHLK
A9A5N1_NITMS          FEQHLRAILGLDLGSTKLLRP--TIMYNILGTKTFEGEYKPL--------EIPEENLFLK
D9SVN7_CLOC7          YEQLIRIVTGMPLGSTKLRLP--CVMYNILGSDEVQGKYCIN----GVEEILDMEDCYFH
Q9JZJ9_NEIMB          FQQQVRIMCNLPPADTKLLSSC--CMANILGDVWQEDGGE-----PDWLPLQSHPNAHLH
Q9XAY8_NEIME          FQQQVRLMCNLPPADTKLLSSC--CMANILGDVWQEDGGE-----PDWFPLQSRPDAHLH
Q5F8B1_NEIG1          FQQQVRIMCNLPPADTKLLSPC--CMANILGDVWQEDGGE-----PDWLPLQSRPNAHLH
Q7VY36_BORPE          FEQQARVMAGLPLGSADLLAPA--VMLNILGDVWFEPGAHAP-REPDWSAALAVPSAKLH
C6BCS8_RALP1          FEQQVRAMARLPLGSTRQHSPG--RMLNVLGDVWFEYGLE---RTPAWHEVMGHSGAKVH
Q8F650_LEPIN          FSLQLRTLCNLPSPKTILANPV--SMKNILGEDYKPGSTL-------WNKTLENPYYHLH
Q7UQS2_RHOBA          FEQHVRAICGLPLGDTSMVVPA-ASMLNLLGDIWVAAESHG--ASPNWESCLETPGVALH
Q2GFG3_EHRCR          FEQLIRAICGLPLKPVKLLFP--CIMNNILGDNIHNYYKH-----------ETKVNENLY
C7JGI8_ACEP3          FDMHIRAVAGLPLPHAVRHSD--AIMKNLVGPEDMALLPQ----------IMASQGFIPH
Q2RVJ3_RHORT          FEQFVRAVCGLPLGDPSRFRA--MRMTNLIG-DEVHDWPL----------LMATPGARLH
Q3J672_RHOS4          FEQHIRAITGWPLGDGSRFAD--VEMENLIG-HDVARVPA----------LALEKHTAIH
A4WX21_RHOS5          FEQHIRAVAGWPLGDGSRFAD--VEMENLIG-HDVARVPA----------LALERNTAIH
C7CHX9_METED          FAQTVRAVCGWPLGDTARTGGMAVEMENLIG-AEADAWAD----------LLAEPGAHLH
B2IE68_BEII9          FEQHIRAIAGWPLGSTKRHGS-AVTMQNLIG-DDVENYLH----------ILAEPGACLT
Q89EH0_BRADU          FEQHIRAIAGWPLGKPVRHGE-IVTMTNLIG-DEINDYEK----------WLSVPGATIH
A0A4Y9UJP4_9BRAD      FEQHIRAIAGWPLGKAVRHGE-IVTMTNLIG-DEINDYEK----------WLSVPGATVH
Q13B79_RHOPS          FEQHIRAIAGWPLAEPLRHGR--VTMTNLIG-HDVDDYAR----------WLTVPGATVH
B6JC22_OLICO          FEQHIRAIAGWPLAQPIRHGD--VTMMNLIG-DEVLDYGK----------YLAEPGVTLH
Q9A3C1_CAUVC          FEQHIRAVAGWPLGPTAPHHH--VEMTNLLG-ADVDAWKK----------LAAEPETRVH
Q7CT83_AGRFC          FEQHIRAVSDLAPGSTDRHSD--CVMTNLIG-DDINDVPA----------WLSKKDCLVH
B9J9P1_AGRRK          FEQHIRAVAGLPLGNPVRHSD--CVMQNLIG-DDILSVPD----------WLRRDDVLVH
D0RG26_9RHIZ          FEQHIRAVAGLPLGNTDRHSD--CVMENLIG-DDIEKVPA----------ILCEKNAVLH
Q9RYC6_DEIRA          FEAQVRAVLGLPLSDWSPLLPC--AMVNYVGVEGAAPDWA---------AIDALPGTRVH
PURK_PSEAE            FENHLRAVAGLPLGSTAKVGES--AMLNFIGAVP---PVA---------QVVAVADCHLH
C3K4E1_PSEFS          FENHLRAVAGLPLGSTAKVGES--AMLNFIGVVP---PVE---------KVIAIDDCHLH
Q5SKY0_THET8          FENHLRAVLGLPLGSTAPRGQS--AMVNLIGEKP---PFA---------EVLKVEGAHLH
G7TK78_XANOB          FENHVRAVLGLPLGSTAMRGHA--CMLNWLGAMP---DAT---------AFLAVPGGHWH
Q8P7V6_XANCP          FENHVRAVLGLPLGSTAMRGHA--CMLNWLGAMP---DAA---------AFLAVPGGHWH
B2FJA6_STRMK          FENHLRAVLGLPLGSTRMLGHA--CMLNWLGAMP---DPA---------PVLGQASGHWH
Q5ZYZ4_LEGPH          FENHLRALFDLPLGSTEVSGSC--FLLNCIGNLL---PLE---------PCLSIPGVHYH
E4PGK3_MARAH          FENHIRAVSGHPLGNVAPRGLS--CMINIIGEHG---DIE---------RILELPYAHVH
Q5NGE8_FRATT          FENHVRAIAGLILGDTTSR-KT--VMLNCIGGMP---ATK---------DLAALDRVKIH
B0U004_FRAP2          FENHVRAIAGLILGDTTSR-KT--VMLNCIGGMP---ATK---------DLAALDRVKIH
PURK_VIBVY            FENHLRAVCGLPLGSTKLVRET--SMINILGEDT---LPA---------SVMAMDGCHIH
PURK_VIBVU            FENHLRAVCGLPLGSTKLVRET--SMINILGEDT---LPA---------SVMAMDGCHIH
PURK_VIBPA            FENHLRAVCGLPLGSTKLIRET--SMVNILGEDT---LPE---------ALLAMDGCHIH
PURK_VIBCH            FENHLRAVCGLPLGSTKLVRET--AMINILGEDQ---LPA---------EVLALEGCHVH
A0A0H3AKH5_VIBC3      FENHLRAVCGLPLGSTKLVRET--AMINILGEDQ---LPA---------EVLALEGCHVH
PURK_ALIF1            FEMHIRAVCNLPLTGNQLLRST--AMINILGEDS---LPD---------EILTMPNCHIH
Q5QZV5_IDILO          FNLHIRAITGLPL-PDLLIAPT--LMVNVIGVAG---IPE---------ALWEAAAADCH
A0A3D8XFP4_9ENTR      FELHLRAITDLPLPQPVVNSPS--VMINLIGSD----VNY---------DWLKLPLVHLH
Q32JL4_SHIDS          FELHLRAITDLPLPQPVVNSPS--VMINLIGSD----VNY---------DWLKLPLVHLH
PURK_ECOLI            FELHLRAITDLPLPQPVVNNPS--VMINLIGSD----VNY---------DWLKLPLVHLH
B7ME44_ECO45          FELHLRAITDLPLPQPVVNNPS--VMINLIGSD----LNY---------DWLKLPLVHLH
Q8ZR71_SALTY          FELHLRAITGLPLPAPVINAPS--VMINLIGSE----LNY---------DWLKLPLVHLH
A0A0D6H8H0_SALTM      FELHLRAITGLPLPAPVINAPS--VMINLIGSE----LNY---------DWLKLPLVHLH
E5B3B2_ERWAM          FELHLRAILNLPLPTPVVNTPA--VMVNLIGTD----LNT---------AWLSEPLVHLH
A0A0H2W378_YERPE      FELHLRAILDLPLPQPVVNTPS--AMVNLIGTP----VNI---------QWLSLPLVHLH
D0ZCX4_EDWTE          FELHLRALLGLPLPHPDVSTPS--VMINLIGTA----LDT---------AWLSGPLVHLH
E7A526_HAEIF          FELHLRTLLDLPTPELQTFAPS--VMINLISTN----HNP---------KWLNTPFAQLH
A4NZE7_HAEIF          FELHLRALLDLPTPELQTFASS--VMVNLIGTN----HNP---------KWLNIPFAQLH
PURK_HAEIN            FELHLRALLNLPTPELQTFAPS--VMINLIGTN----HNP---------KWLNIPFAQLH
Q8EBG3_SHEON          FQLHLRALCGIAIPQPQVNFQC--VMVNLIGID----NDP---------RWLSLPNAELY
Q8D2V6_WIGBR          FELHLRSILNLPIHTPKIYFSS--IMINIIGHK----IDI---------IFLKDPLLHIY
PURK_SACS2            FEQHLRAIIGMELGPSTILSPS--GMVNILGTDKIPVEV--------------LKYGKVY
Q973U0_SULTO          FEQHLRAITGLEIGATELLSYG--GMVNILGTDNVPLEV--------------LKYGKVY
Q9HJ65_THEAC          FEEHVRAISGLPVPKPVLYRPS--SSVNILGQDLDQEKVK---------RILELGEAEIY
PURK_AQUAE            FENLLRAITEMPLGSTELKLPS--GMVNILGKSYEEIPLK---------EILSVEGAKLY
A8MCK4_CALMQ          FENHLRAILGLPLGNTRLLKPT--AIVNMIGVQYSEELIN---------SILKIPGTRVW
Q8ZZJ2_PYRAE          FENHVKAVLGLPVREPKAIAPT--AMVNILGVPIEKLPVA---------ELERI--GKIY
                      :                          * :.                             

A0A0F7RI76_BACAN      LYGKEEAKAQRKMGHVNILNDNI---------------EVALEKAKSLHIWDHQEQLLEG
Q81IQ8_BACCR          LYGKEEAKAQRKMGHVNILNDNI---------------EVALEKAKSLHIWDHQEQLLEG
A0A0E0T7S3_GEOS2      LYGKHEAKPKRKMGHVTVLADDV---------------EAALARIESWQIW-HDRRLERG
PURK_BACSU            IYGKHEIKKGRKMGHITFMKQPE---------------DEWIQEITNKWMNRDGGQAE--
C7VAB9_ENTFL          YYGHSEAKAQRAMGHITILTKEI---------------DETLEEIKETKIWS--------
Q8Y6B7_LISMO          YYGKKEAKINRKMGHVTVLADEP---------------KAVIQDLEETQIWK--------
Q8DRL8_STRR6          MYGKIEAKHNRKMGHVTLFS-DV---------------PDSVDELGEGIDF---------
Q48VY5_STRPM          MYGKLEAKHNRKMGHVTVFS-DL---------------PDEVEEF---------------
A0A0H3MSS3_STRS4      FYGKLEAKHNRKMGHVTVLG-ED---------------AESVEEFEN-------------
Q9CFG5_LACLA          DYGKADAKHNRKMGHVTILTNDF---------------DQTINEIKATKIWD--------
F0K3F8_LACD2          DYGKGEVRRDRKMGHVTILTDDV---------------DKTLAEIVATKVWDV-------
Q8G588_BIFLO          DYGKAEVRHDRKMGHITVLTDDP---------------AKTVADLEATGCWDDLKKKA--
Q833Y5_ENTFA          YYGKAESKVGRKMGHVTITTPCL---------------SETLKEIETVGIWNVT------
K0DAQ9_LEUCJ          DYGKSAIKHDRKMGHITVLGQEN---------------IQKLQNWSQTHEQRDV------
D5T0S2_LEUKI          DYGKSVMKHNRKMGHITVLGEEN---------------IKKLYEWSQIHGQRDVSKPEH-
F9URK4_LACPL          DYGKAAIKPQRKMGHVTVLNHDI---------------DAALASLANLKGEQ--------
A0A0R1F635_LACCA      DYGKAEIRSGRKMGHLTVTDDR-----------------NVLDILKQMEAAW--------
PURK_STAAW            IYGKSERKDSRKMGHMTVLTNDV---------------NQTEQDMYAKFEGSN-------
PURK_STAAN            IYGKSGRKDSRKMGHMTVLTNDV---------------NQTEQDMYAKFEGSN-------
PURK_STAAR            IYGKSERKDSRKMGHMTVLTNDV---------------NQTEQDMYAKFEGSN-------
PURK_MYCTU            LYGK-AERPGRKVGHINFLGSDV---------AQLCERAELAAHWLSHGRWTDGWDPHRA
G0TI11_MYCCP          LYGK-AERPGRKVGHINFLGSDV---------AQLCERAELAAHWLSHGRWTDGWDPHRA
PURK_MYCLE            LYDK-VERPGRKVGHINFRGTDKDR----KNPTKLRERAELAAHWLSHGQWTDGWDPHRA
F5Z233_MYCSD          LYGK-DERPGRKIGHINLLGDDA------AGSAELRERAENAAHWLSHGEWRAGDDAERQ
R4UHE1_9MYCO          LYGK-GERPGRKLGHVNIQGREDGSLADPGYVAEVRERAERAAHWLSHAVWTDGWEGH--
A0QTF2_MYCS2          MYGK-GERPGRKLGHVNLVGKPGE------DVAAVRERANRASHWLSHAQWTDNWNEHGT
A8M3L7_SALAI          LYGK-QVRPGRKIGHVTVLGDDL---------DEVRTRAARAARWLREGRG---------
H2JRI9_STRHJ          MYGK-DVKPGRKVGHVNTYGDDL---------DDVLERARHAAGYLRGTITE--------
Q8CJX8_STRCO          MYGK-DVKPGRKVGHVNTYGDDL---------DDVLERARHAAGYLRGTITE--------
Q47LU2_THEFY          FYGK-EVRPGRKIGHVTVVGDDP---------EALLERARTAAAYLKGDAQ---------
PURK_CORAM            LYGK-GIAQGRKIGHVNLTGEDE---------EATRRDARLAADFLVNAAWSDNWSAK--
Q8NSG4_CORGL          LYGK-GHRPGRKIGHVNMVGSDL---------EKTRAEALACAYFLVNARWD--------
A0LRX0_ACIC1          LYNK-QVKPGRKIGHVNVCDAEV---------DAAVQRAGTAVRILRGEDGSR-------
Q7NL74_GLOVI          WYGKRGARPGRKLGHITAVARDP---------AVAYERALAAREALGI------------
A9WGJ1_CHLAA          FYGKREERIGRKMGHVTALGSTL---------AEAEAIARQAAALVAMPDGQQ-------
Q2S241_SALRD          IYGKPDVRPGRKMGHVTALGADR---------ADTRKRAEMAASAIEL------------
PURK_SYNY3            WYGKGDCRPGRKLGHVTLLNPDVESEP-------STAWAEDLVKQVEAIWYPD-------
Q8DJG7_THEEB          WYGKSQTYAGRKLGHITVLLEDPAA-------------AMGIIQEIEAIWYSTPVAV---
K9Z498_CYAAP          WYGKTESRQGRKLGHVTVLLDEKSPEK-------MYHQAQMMIEKVESIWYPQR------
Q2JM58_SYNJB          WYHKTPARPGRKLGHVTVCLPTAPSP----------FEAAALVRTLESLWYPQP------
Q2JQI9_SYNJA          WYHKTPARPGRKLGHVTVCLPTAPSP----------FEAAALVRTLESLWYPQP------
A2C9Y9_PROM3          WYGKDCETPGRKLGHVTVLLHGVDAPS-------RQLEAETALKHIRSIWPTQDTVCA--
Q7VBT4_PROMA          WYNKENNIPGRKLGHVTKLLSSIDIKQ-------RRNEALQVLNQIRSIWPMT-------
Q31BK1_PROM9          CYGKSREILGRKMAHITFLLNGKTHSE-------RYDQAQVLLTMVRDIWPSPNT-----
B0KC86_THEP3          FYGKRLTSPYRKMGHVTIVDDNL---------DSAIEKAKKVKERLKIKSEVER------
Q9WYS8_THEMA          FYGKKETRPYRKMGHFTVVDRDV---------ERALEKALRAKKILKVVSEEGAMCQG--
Q8U3N1_PYRFU          IYGKSVVKPLRKMGHVTVVNRNL---------EKALEIAHKVKKVIKVVGDA--------
Q5JDF6_THEKO          VYGKREVFPFRKMGHVTAVDRTL---------PGAIEKALRAKALIRVRGEVNAQSGNNN
A6GZC2_FLAPJ          IYGKRETRPFRKMGHVTIVNENM---------TEARKIAEEVKNSIRVIA----------
D4GVF3_HALVD          WYGKDEVRPLRKMGHLTAVGG-DDADL------ELLARARELRDGLRFD-----------
Q9HRM3_HALSA          WYGKRQLRPHRKMAHVTVSGG-DDR----------LARARAARDAVSFTDTHHS------
A0RVW3_CENSY          MYGKESSRPGRKMGHYTVTGSWDQDVE------RLVDEARLAGETIRLAPT---------
A9A5N1_NITMS          MYGKKISKPMRKLGHFNLISTNNESVE------DLLKKLESIKPRAAVQSI---------
D9SVN7_CLOC7          LYGKEETSYLKKIGHITALADCVEMAE------RKAKKVMDSLVIKSLEVS---------
Q9JZJ9_NEIMB          LYGKKTAHKGRKMGHFTVLTTDS---------------DTAFQEAKKLHQSL--------
Q9XAY8_NEIME          LYGKKTAHKGRKMGHFTILSTDS---------------DTAFQEAKKLHQSL--------
Q5F8B1_NEIG1          LYGKKTAQKGRKMGHFTVLTTDS---------------DTAFQEAKKLHQSL--------
Q7VY36_BORPE          LYGKREARRGRKMGHVTIVAATP---------------EQARDDAARVACALGMAAPL--
C6BCS8_RALP1          LYGKADARPGRKMGHVNCVGTSA---------------EVVDEAFRHAAQVLGLQSD---
Q8F650_LEPIN          LYGKTEIRNGRKMGHWNYSGPNI---------------ESAFLNWD--------------
Q7UQS2_RHOBA          LYGKHAAPAGRKMGHLTAVGNDL---------------PEVSERLRLARERLLGGLG---
Q2GFG3_EHRCR          IYGKKKATKNRKMGHINTLKFNQ-------------------------------------
C7JGI8_ACEP3          LYGKAEARVGRKMGHVNILFPYGALPGNLGIQDALGPLATKTAAPEPEED----------
Q2RVJ3_RHORT          LYGKVESRRGRKMGHVNTPV----------------------------------------
Q3J672_RHOS4          LYGKAEARPGRKMGHVNRILRPVTGA----------------------------------
A4WX21_RHOS5          LYGKAEARPGRKMGHVNRILRPVAGA----------------------------------
C7CHX9_METED          LYGKAEARPGRKMGHVTRLKPLD-------------------------------------
B2IE68_BEII9          LYGKQEARTGRKMGHVTRIIP---------------------------------------
Q89EH0_BRADU          IYGKGAPRPGRKMGHVTEVRPPRDK-----------------------------------
A0A4Y9UJP4_9BRAD      IYGKGAPRPGRKMGHVTEVRPTKGK-----------------------------------
Q13B79_RHOPS          LYGKRTALPGRKMGHVTVIEPQ--------------------------------------
B6JC22_OLICO          LYGKETVRPGRKMGHVTVVKPEE-------------------------------------
Q9A3C1_CAUVC          LYGKGEARPGRKMGHVNRLRSLRD------------------------------------
Q7CT83_AGRFC          LYGKTEARPGRKMGHVTELLHTGKA-----------------------------------
B9J9P1_AGRRK          LYGKTESRPGRKMGHVTQLRR---------------------------------------
D0RG26_9RHIZ          LYGKKEARAGRKMGHVTRIKPRTI------------------------------------
Q9RYC6_DEIRA          LYHK-AHRTGRKLGHVNLAAPDL---------------PTLHQRLAQLEQLIP-------
PURK_PSEAE            HYGK-AFKNGRKVGHATLRCADRATLQA---------RIAEVEALIEA------------
C3K4E1_PSEFS          HYGK-AFKAGRKVGHANLRCKDRATLQA---------QILKVEALIAEQ-----------
Q5SKY0_THET8          WYGK-AVRPGRKVGHITLRRDGLKALEE---------GLARLSRLVSELPWEGRV-----
G7TK78_XANOB          DYGK-QARNGRKVGHATLRAETTQALAL---------VVRDAGAALLRDAQVGPVVARLN
Q8P7V6_XANCP          DYGK-QARDGRKVGHSTVRADTPALLAQ---------LLGDVGQALQRDAQTAPVVARLA
B2FJA6_STRMK          DYGK-EPREGRKVGHATLRDDDAAALAD---------ALEQVGLELDRQAQVAPAVHALR
Q5ZYZ4_LEGPH          AYGK-APRPDRKVGHVTLID---THLER---------YAKSKDLLLDIS-----------
E4PGK3_MARAH          LYNK-GERPGRKLGHVNILADSYEELVW---------RVKNCAQFLPGSPEFKSSLTPKG
Q5NGE8_FRATT          SYNK-EPRKGRKVGHLNLNLNDETDEYQ---------LLQVKKLIALSEEI---------
B0U004_FRAP2          SYNK-EPRKGRKVGHLNLNLNDETDAYQ---------LLQAKKLIELSQEL---------
PURK_VIBVY            WYGK-EKRAGRKMGHINVCGDYSGELQR---------RLCALANVLDEKAFPAVHEFAKK
PURK_VIBVU            WYGK-EKRAGRKMGHINVCGDYSGELQR---------RLCALANVLDEKAFPAVHEFAKK
PURK_VIBPA            WYGK-EKREGRKMGHINVCGDYPGELHR---------RLCALAEVLDPMIFPAVHEFAKQ
PURK_VIBCH            WYGK-AKRSGRKMGHINVTADYSGELQR---------KLCQLATVLDEKAFPAVHAVAKE
A0A0H3AKH5_VIBC3      WYGK-AKRSGRKMGHINVTADYSGELQR---------KLCQLATVLDEKAFPAVHAVAKE
PURK_ALIF1            WYGK-EKRAGRKMGHINVCADSPEMLQK---------ELSKLANILDKQAFKALS-----
Q5QZV5_IDILO          WYGK-EARHGRKVGHVNIMIDSFERGEN---------LASSWAEKLQLLVG---------
A0A3D8XFP4_9ENTR      WYDK-EVRPGRKVGHLNLTDSDTSRLTA---------TLEALIPLLPPEYASGVMWAQSK
Q32JL4_SHIDS          WYDK-EVRPGRKVGHLNLTDSDTSRLTA---------TLEALIPLLPPEYASGVMWAQSK
PURK_ECOLI            WYDK-EVRPGRKVGHLNLTDSDTSRLTA---------TLEALIPLLPPEYASGVIWAQSK
B7ME44_ECO45          WYDK-EVRPGRKVGHLNLTDSDTSRLTA---------TLEALIPLLPPEYASGVMWAQSK
Q8ZR71_SALTY          WYDK-AVRPGRKVGHLNLTDSDTSRLSA---------TLEALSPLLPGEYASGIIWAQSK
A0A0D6H8H0_SALTM      WYDK-AVRPGRKVGHLNLTDSDTSRLSA---------TLEALSPLLPGEYASGIIWAQSK
E5B3B2_ERWAM          WYNK-EVRAGRKVGHLNLADASTLALST---------ALNALVPLLPVEYASGIAWAVDK
A0A0H2W378_YERPE      WYDK-EVREGRKVGHLNLNDPEGTALSA---------SLAALAPLLPAEYQNALRWAQDK
D0ZCX4_EDWTE          WYDK-AVRPGRKVGHLNLNHFQSQRLVS---------ALDTLRGQLPAEYQDALAWAGAR
E7A526_HAEIF          WYGK-EVRTGRKVGHINLSHTNRAVIIQ---------QLEKLRSELPEDYQSGLNWAIEK
A4NZE7_HAEIF          WYGK-EVRAGRKVGHINLSHPNKAVIIQ---------QLEKLRSELPEDYQSGLNWAIEK
PURK_HAEIN            WYGK-EVRIGRKVGHINLSHPNKAVIIQ---------QLEKLCTELPEDYQSGLNWAIEK
Q8EBG3_SHEON          WYNK-EVRPGRKVGHLNLSVPNLTVLTN---------SISALQTWMPNQYQAPLAWILAE
Q8D2V6_WIGBR          WYNK-KVKHNRKVGHINIISDKYNKIKK---------SLLILKEKLPLEYKKYLLWLIKK
PURK_SACS2            WYSKSEVRKRRKMGHVNVVGNNLEEVKQ---------KIDKIMQLIYTNGLDL-------
Q973U0_SULTO          WYGKKEVRKRRKLGHVNVVGSNLEDVKQ---------KIDIIMKLIYPQGLDL-------
Q9HJ65_THEAC          WYGKEGIRRRRKVGHVNLTGYTRDRLDD---------RISRVMDILYPDGVQNYI-----
PURK_AQUAE            WYGK-EKKPRRKVGHVNVVGRSKEEVVE---------KVERVFTLLKGSREKLPAP----
A8MCK4_CALMQ          WYGKSQVRPRRKMGHVTIVADNDEELTQ---------RIRDILSVIYGSLINHFIPPWDH
Q8ZZJ2_PYRAE          WYYKKEARPRRKMGHVNITGGSLAEVAS---------KARLALQLIYGRDFPRLVLRSYA
                       * :      : :.* .                                           

A0A0F7RI76_BACAN      KR--------------------
Q81IQ8_BACCR          KR--------------------
A0A0E0T7S3_GEOS2      ----------------------
PURK_BACSU            ----------------------
C7VAB9_ENTFL          ----------------------
Q8Y6B7_LISMO          ----------------------
Q8DRL8_STRR6          ----------------------
Q48VY5_STRPM          ----------------------
A0A0H3MSS3_STRS4      ----------------------
Q9CFG5_LACLA          ----------------------
F0K3F8_LACD2          ----------------------
Q8G588_BIFLO          ----------------------
Q833Y5_ENTFA          ----------------------
K0DAQ9_LEUCJ          ----------------------
D5T0S2_LEUKI          ----------------------
F9URK4_LACPL          ----------------------
A0A0R1F635_LACCA      ----------------------
PURK_STAAW            ----------------------
PURK_STAAN            ----------------------
PURK_STAAR            ----------------------
PURK_MYCTU            SDDAVGVPPACGGRSDEEERRL
G0TI11_MYCCP          SDDAVGVPPACGGRSDEV----
PURK_MYCLE            GDDVVEISLACGGRNDAQRQR-
F5Z233_MYCSD          R---------------------
R4UHE1_9MYCO          ----------------------
A0QTF2_MYCS2          DTE-------------------
A8M3L7_SALAI          ----------------------
H2JRI9_STRHJ          ----------------------
Q8CJX8_STRCO          ----------------------
Q47LU2_THEFY          ----------------------
PURK_CORAM            ----------------------
Q8NSG4_CORGL          ----------------------
A0LRX0_ACIC1          ----------------------
Q7NL74_GLOVI          ----------------------
A9WGJ1_CHLAA          ----------------------
Q2S241_SALRD          ----------------------
PURK_SYNY3            ----------------------
Q8DJG7_THEEB          ----------------------
K9Z498_CYAAP          ----------------------
Q2JM58_SYNJB          ----------------------
Q2JQI9_SYNJA          ----------------------
A2C9Y9_PROM3          ----------------------
Q7VBT4_PROMA          ----------------------
Q31BK1_PROM9          ----------------------
B0KC86_THEP3          ----------------------
Q9WYS8_THEMA          ----------------------
Q8U3N1_PYRFU          ----------------------
Q5JDF6_THEKO          G---------------------
A6GZC2_FLAPJ          ----------------------
D4GVF3_HALVD          ----------------------
Q9HRM3_HALSA          ----------------------
A0RVW3_CENSY          ----------------------
A9A5N1_NITMS          ----------------------
D9SVN7_CLOC7          ----------------------
Q9JZJ9_NEIMB          ----------------------
Q9XAY8_NEIME          ----------------------
Q5F8B1_NEIG1          ----------------------
Q7VY36_BORPE          ----------------------
C6BCS8_RALP1          ----------------------
Q8F650_LEPIN          ----------------------
Q7UQS2_RHOBA          ----------------------
Q2GFG3_EHRCR          ----------------------
C7JGI8_ACEP3          ----------------------
Q2RVJ3_RHORT          ----------------------
Q3J672_RHOS4          ----------------------
A4WX21_RHOS5          ----------------------
C7CHX9_METED          ----------------------
B2IE68_BEII9          ----------------------
Q89EH0_BRADU          ----------------------
A0A4Y9UJP4_9BRAD      ----------------------
Q13B79_RHOPS          ----------------------
B6JC22_OLICO          ----------------------
Q9A3C1_CAUVC          ----------------------
Q7CT83_AGRFC          ----------------------
B9J9P1_AGRRK          ----------------------
D0RG26_9RHIZ          ----------------------
Q9RYC6_DEIRA          ----------------------
PURK_PSEAE            ----------------------
C3K4E1_PSEFS          ----------------------
Q5SKY0_THET8          ----------------------
G7TK78_XANOB          EG--------------------
Q8P7V6_XANCP          P---------------------
B2FJA6_STRMK          NR--------------------
Q5ZYZ4_LEGPH          ----------------------
E4PGK3_MARAH          ----------------------
Q5NGE8_FRATT          ----------------------
B0U004_FRAP2          ----------------------
PURK_VIBVY            WQA-------------------
PURK_VIBVU            WQA-------------------
PURK_VIBPA            AQR-------------------
PURK_VIBCH            IQP-------------------
A0A0H3AKH5_VIBC3      IQP-------------------
PURK_ALIF1            ----------------------
Q5QZV5_IDILO          ----------------------
A0A3D8XFP4_9ENTR      FS--------------------
Q32JL4_SHIDS          FS--------------------
PURK_ECOLI            FG--------------------
B7ME44_ECO45          FS--------------------
Q8ZR71_SALTY          LK--------------------
A0A0D6H8H0_SALTM      LK--------------------
E5B3B2_ERWAM          LA--------------------
A0A0H2W378_YERPE      L---------------------
D0ZCX4_EDWTE          LS--------------------
E7A526_HAEIF          LK--------------------
A4NZE7_HAEIF          LK--------------------
PURK_HAEIN            LK--------------------
Q8EBG3_SHEON          FTKS------------------
Q8D2V6_WIGBR          IKEIN-----------------
PURK_SACS2            ----------------------
Q973U0_SULTO          ----------------------
Q9HJ65_THEAC          ----------------------
PURK_AQUAE            ----------------------
A8MCK4_CALMQ          VDGIQGITGHGTPH--------
Q8ZZJ2_PYRAE          ASGSELASSAGGRQAVVTG---