CLUSTAL format seed alignment for MF_01930

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q6HPA1_BACHK          ----------------------------------------------MSRLAVFASGSGSN
Q73EN2_BACC1          ----------------------------------------------MSRLAVFASGSGSN
Q81IQ0_BACCR          ----------------------------------------------MSRLAVFASGSGSN
A0A242Y8U5_BACTU      ----------------------------------------------MSRLAVFASGSGSN
Q8Y6C4_LISMO          -----------------------------------------------MNIAIFASGSGSN
Q92AP2_LISIN          -----------------------------------------------MNIAIFASGNGSN
PUR3_BACSU            ----------------------------------------------MKKFAVFASGNGSN
Q9KF54_BACHD          ----------------------------------------------MKRVAIFASGSGTN
B1HTV7_LYSSC          -------------------------------------------MTAPTKIAVFASGSGSN
PUR3_STAAR            ----------------------------------------------MVKIAIFASGSGSN
Q2FZI7_STAA8          ----------------------------------------------MVKIAIFASGSGSN
PUR3_STAAW            ----------------------------------------------MVKIAIFASGSGSN
PUR3_STAAN            ----------------------------------------------MVKIAIFASGSGSN
E6GHV8_ENTFL          -----------------------------------------------MKIAVFASGNGSN
Q833Z2_ENTFA          -----------------------------------------------MKIAVFASGNGSN
Q1G9G1_LACDA          -----------------------------------------------MKVAIFASGNGTN
Q8DRM3_STRR6          ----------------------------------------------MKKIAVFASGNGSN
D5AF79_STRGZ          ----------------------------------------------MKRIAVFASGNGSN
H5T027_LACLL          -----------------------------------------------MKIAVFASGNGSN
H9UKG3_SPIAZ          ----------------------------------------------MARCAVFASGNGSN
Q9X0X5_THEMA          -------------------------------------MCSVLQRRVPPRIVVLASGNGSN
A0A0H3PBG9_CAMJJ      ---------------------------------------------MLVKLAVLFSGNGGN
A0A0B6UZ56_CAMJU      ---------------------------------------------MLVKLAVLFSGNGSN
Q0PBV2_CAMJE          ---------------------------------------------MLVKLAVLFSGNGSN
A7GW50_CAMC5          --------------------------------------------MPTKKIAVLFSGSGSN
E6SMP0_THEM7          ------------------------------------------MPPCGCRIVVLASGAGTN
D7BF68_MEISD          --------------------------------------MSGFPLGRPARIAVFASGRGSN
PUR3_ECOLI            -----------------------------------------------MNIVVLISGNGSN
E3PFZ0_ECOH1          -----------------------------------------------MNIVVLISGNGSN
Q32D68_SHIDS          -----------------------------------------------MNIVVLISGNGSN
A0A0H2V9D8_ECOL6      -----------------------------------------------MNIVVLISGNGSN
A0A0H3JJE1_ECO57      -----------------------------------------------MNIVVLISGNGSN
H9L487_SALTY          -----------------------------------------------MNIVVLISGNGSN
R4Y758_KLEPR          ---------------------------------------------------MLISGSGSN
A0A0H3HF70_KLEOK      ----------------------------------------------MKNIVVLISGNGSN
D2T6R4_ERWP6          ----------------------------------------------MKRIVVLVSGNGSN
A0A384LGH9_YERPE      ----------------------------------------------MKKIVVLISGQGSN
Q7N3F6_PHOLL          ----------------------------------------------MKNIVVLISGSGSN
A0A1W6M605_VIBVL      ----------------------------------------------MKKIVVLISGSGSN
S5IMX5_VIBPH          ----------------------------------------------MKNIVVLISGNGSN
Q9KPY5_VIBCH          ----------------------------------------------MKSIVVLISGNGTN
Q5E3H2_ALIF1          ---------------------------------------------MMKNIVVLVSGNGSN
Q5QUP8_IDILO          ----------------------------------------------MKRIVVLISGTGSN
E6XGN7_SHEP2          -------------------------------------------MPQRCRVVVLISGNGSN
Q8EDI7_SHEON          -------------------------------------------MPQSCRVVVLISGNGSN
Q12ME9_SHEDO          --------------------------------------------MSVCRVLVLISGNGSN
Q83AY9_COXBU          ------------------------------------------MNREPLPIVVLISGNGTN
Q9I514_PSEAE          ------------------------------------------MP-KLCNVVVLISGSGSN
A5W7R8_PSEP1          ------------------------------------------MPSKTCNVVVLLSGSGSN
F6AG77_PSEF1          ------------------------------------------MP-RPCNVVVLLSGTGSN
PUR3_HAEIN            ----------------------------------------------MKKIAVLISGQGTN
A6VMA5_ACTSZ          ----------------------------------------------MKKIVVLISGTGTN
Q5F7F4_NEIG1          ----------------------------------------------MKNIVILISGRGSN
A1KUZ0_NEIMF          ----------------------------------------------MKNIVILISGRGSN
Q9JYI9_NEIMB          ----------------------------------------------MKNIVILISGRGSN
I1XKF9_METNJ          -----------------------------------------MTAALKPKLVILISGRGSN
Q63WI1_BURPS          ----------------------------------------------MKKLVILISGRGSN
B7JBZ7_ACIF2          ---------------------------------------------MTKRLVILVSGRGSN
Q5H3C3_XANOR          ----------------------------------------MHAPEARLRLAVLASGRGSN
Q8PID7_XANAC          ----------------------------------------MPAPDAPLRLAVLASGRGSN
Q8P723_XANCP          ---------------------------------------------MSLRLAVLASGRGSN
B2I7G1_XYLF2          ----------------------------------------MTSPSSPLRLAILASGRGSN
Q215Q7_RHOPB          ---------------------------------------------MKRRTAILISGRGSN
Q07LG6_RHOP5          ---------------------------------------------MKRRVAILISGRGSN
Q6N5C7_RHOPA          ---------------------------------------------MKPRVAILISGRGSN
Q89MR6_BRADU          --------------------------------------------MMKRRVAILISGRGSN
A9W4F2_METEP          -------------------------------------MSAPAPKK---RVAILISGRGSN
B0UKC5_METS4          -------------------------------------MTARP------RTAILISGRGSN
Q2RSC7_RHORT          -------------------------------------MNAPQSTAPRKRVAVLISGRGSN
Q9A7M0_CAUVC          -------------------------------------------MTQPTKVAVLISGRGSN
Q3J516_RHOS4          ----------------------------------------------MKRVAVLISGGGSN
Q8YGB8_BRUME          --------------------------------------------MKRNRVVIFISGGGSN
A0A0H3G630_BRUSU      --------------------------------------------MKRNRVVIFISGDGSN
Q7CZW4_AGRFC          ------------------------------------------------------------
Q2KA46_RHIEC          ------------------------------------------------------------
F7XMS4_METZD          ------------------------------MLQNCNIVKLHKKSAMTCNIAVLVSGRGSN
Q8TK92_METAC          -------------------------------MQNPNISLFQSKSSMTVKIAVLVSGRGSN
Q2FTJ6_METHJ          ------------------------------MNQG--------------RFVVLASGRGSN
Q8F3W7_LEPIN          ------------------------------MATLFTKPK--------KKIVFLASGRGSN
B5YK81_THEYD          ----------------------------------------------MLKIGVLASGRGSN
Q74CB5_GEOSL          -------------------------------------------MIQPLAVGVLVSGNGSN
O67023_AQUAE          ----------------------------------------------MLKIGVLVSGRGSN
B8E0V4_DICTD          --------------------------------------------MERKRLGVLVSGRGSN
A0RTU5_CENSY          ------------------------------------------------------------
A9A4N2_NITMS          ------------------------------------------------------------
Q1IM87_KORVE          --------------------MLKVHSHAHVLIPKSLSGFCPIYNNRVKNLGILLSGRGSN
Q3YRI0_EHRCJ          --------------------------------------------MVPLRLGILISGRGSN
B3CPV8_WOLPP          --------------------------------------------MKKIKLGILISGRGSN
Q7VBZ7_PROMA          -------------------MNSINIKS-----ITSPNIISLPRFTPKLKLAVLASGKGSN
A9BAE2_PROM4          -------------------MNLSVGHS-----ITSPEVSQFYSFKPKIRLGVMASGSGTN
Q8DGJ1_THEEB          -------------------MLAMSSEA-----LVVPSAPENTPTCRPLRLGVLASGSGSN
Q55172_SYNY3          -------------------MSAMSDLSNNLSFISPPVALGNIPQPRCLSLGIMASGSGSN
Q31PN1_SYNE7          -------------------MSSLT---------VPDRFPTESST--AIALGVLASGNGSN
Q7NKS6_GLOVI          ------------------------------------------------------------
Q2RGU8_MOOTA          ------------------------------------------MVASTLPIGILVSGRGSN
Q72E43_DESVH          ----------------------------------------------MLRIAVLASGNGSN
PUR3_MYCTU            --------------------MQEPLRVPPSAPA---------------RLVVLASGTGSL
PUR3_MYCTO            --------------------MQEPLRVPPSAPA---------------RLVVLASGTGSL
F6ERE0_HOYSD          MPVASSDELARSVIRRSALNSHTDVRSTHSAPVDS------RDPETPSRVVVLASGSGTL
Q8NS22_CORGL          ---------------MVPRPKTVNISVVNSDST--------------TTIVVLASGTGTL
Q9KY51_STRCO          MAAKPVD-------------------------------------RRAKRLVVLVSGSGTN
C7QGV4_CATAD          MVTPPVQVGRVRSADNSKHPYEEAAVVVHPEGTKSPPGLVHHRPDRPARIVVLVSGSGTN
A9WEW1_CHLAA          ----------------------------------------------MPGIAVLLSGSGSN
Q83GZ2_TROWT          ----------------------------------------MSDMKTAMRLIVMVSGIGSG
G7V599_THELD          ----------------------------------------------MTSVAVLISGRGTN
D1B9N8_THEAS          ---------------------------------------------MKPNIGVLISGRGSN
Q97CD0_THEVO          ----------------------------------------------MTKICVMVSGNGTT
E4T8V1_RIEAD          ----------------------------------------------MKNIVVLVSGSGSN
A5N0Q1_CLOK5          ----------------------------------------------MFKIAVLASGGGTD
A5I5W0_CLOBH          ----------------------------------------------MFKIAVLVSGGGSN
Q97J92_CLOAB          ----------------------------------------------MYKIAVLVSGGGTD
Q0SV49_CLOPS          ----------------------------------------------MYKIAVLASGSGSN
D9RAC8_CLOSW          ----------------------------------------------MLRIGVLVSGGGTN
E6UD28_RUMA7          ----------------------------------------------MKNIVVLVSGGGTN
Q2JE89_FRACC          --------------------------------------------MADFRVAVFASHTGTN
Q9RSU6_DEIRA          ---------------------------------------------MTLRLAFLASHGGSA
Q8TTV9_METAC          ---------------------------------------MKCEDTKKLHIAIFASHTGTN
B3QS63_CHLT3          ------------------------------------------MNPEKKRIAVFCSGEGTN
Q8KFK7_CHLTE          ------------------------------------------MIDKKKRLAVFCSGTGSN
Q2S223_SALRD          -----------------------------------------------MRLAVFASGEGTN
E6SW52_BACT6          ---------------------------------------------MMKNIAVLASGSGTN
Q64ZV6_BACFR          ---------------------------------------------MGKNIAIFASGSGTN
A6LFS5_PARD8          ----------------------------------------------MKNIAIFASGSGTN
Q5NGF0_FRATT          --------------------------------------------MSKLNLVILGSTRGTN
PUR3_SCHPO            ---------------------------------------MVAS------LVVLISGSGSN
L8G8V8_PSED2          ---------------------------------------MSSSSHPPTKLTVLISGSGTN
PUR3_YEAST            ---------------------------------------MARI-------VVLISGSGSN
PUR3_DICDI            ---------------------------------------MTFN------ICVLISGNGTN
                                                                                  

Q6HPA1_BACHK          FQSLVNAVEEK----RLDA---EISLLVCDKPEARAVGRANYHHIPCFAF------SAKA
Q73EN2_BACC1          FQSLVNAVEEK----RLGA---EISLLVCDKPEARAVGRAHYHHIPCFAF------SAKA
Q81IQ0_BACCR          FQSLVNAVEEK----RLDA---EISLLVCDKPEARAVGRANYHHIPCFAF------SAKA
A0A242Y8U5_BACTU      FQSLVNAVEEK----RLDA---EISLLVCDKPEARAVGRAHYHHIPCFAF------SAKA
Q8Y6C4_LISMO          FQAL---VDDE----FIKP---YVKLLVCDKPNAYVLERANKHDIPVFLF------EAKN
Q92AP2_LISIN          FQAL---VDDE----LIKP---HVKLLVCDKPNAYVVERANKQNIPVFLF------DVKN
PUR3_BACSU            FEAIVTRLKEE----NWDA---SAALLVCDKPQAKVIERAEAFHIPSFAF------EPKS
Q9KF54_BACHD          AEAIIQSQKAG----QLPC---EVALLITDKPGAKVVERVKVHEIPVCAL------DPKT
B1HTV7_LYSSC          FQAIQEAIERK----ELHA---KIELVVTDKPGAYVVTRAEHLGIPVLAL------NPKD
PUR3_STAAR            FENIVEHVESG----KLENI--EVTALYTDHQNAFCIDRAKKHDIPVYIN------EPKQ
Q2FZI7_STAA8          FENIVEHVESG----KLENI--EVTALYTDHQNAFCIDRAKKHDIPVYIN------EPKQ
PUR3_STAAW            FENIVEHVESG----KLENI--EVTALYTDHQNAFCIDRAKKHDIPVYIN------EPKQ
PUR3_STAAN            FENIVEHVESG----KLENI--EVTALYTDHQNAFCIDRAKKHDIPVYIN------EPKQ
E6GHV8_ENTFL          FEAIAAAFSPK----KIAG---QLSLVFCDQPEAYVLTRAKKRKIPVVCF------SPSD
Q833Z2_ENTFA          FEAIAAAFSQK----KIAG---HLSLVFCDQPEAYVLTRAQKRKIPVVCF------SPSD
Q1G9G1_LACDA          YEVLAEHFQKG----DLPG---DLALLFCDHPDAPVIKRAEKFHTPVVTF------TVKS
Q8DRM3_STRR6          FQVIAEEFP--------------VEFVFSDHRDAYVLERAKQLGVLSYAF------ELKE
D5AF79_STRGZ          FQVIAEQFE--------------VAFVFSDRRNAYVLERAEKLGVPTFAF------ELKE
H5T027_LACLL          FQTLAEQFPD------------QVKFVFSDHHDAYVLERAKQLGVAKASL------ELKE
H9UKG3_SPIAZ          FLHIQESLHRD----PVHQ----LACLVCDRPDAPVVQRALRGGTPVLPLVYQR--DAAG
Q9X0X5_THEMA          FEAIVNAARSG----ELSA---EIQMLLVDR-NCYAIERAKKLQIPWERL----------
A0A0H3PBG9_CAMJJ      LENILEKLHKK----TIGENTYEVVLCLCNKKDAFGIQRAKKFGLDTVIV------DHKA
A0A0B6UZ56_CAMJU      LENILEKLHKK----TIGENTYEVVLCICNKKDAFGVQRAKKFGLDTVIV------DHKA
Q0PBV2_CAMJE          LENILEKLHKK----TIGENTYEIVLCLCNKKDAFGIQRAKKFGLNTVII------DHKA
A7GW50_CAMC5          LEAILSQLHGK----IFNGVRLEVVLTLTNKADAYGIERARKYGLTSVVI------ENKN
E6SMP0_THEM7          LQALLDAER------RGRL-GGRIVAVLSDRPGAGALDRARAAGKPAVLLR------PDP
D7BF68_MEISD          LEALLEAFP------PENP-LGHIVLVVSDKADAGALEKAVRAGVEAVHI----------
PUR3_ECOLI            LQAIIDACK------TNKIK-GTVRAVFSNKADAFGLERARQAGIATHTLI------ASA
E3PFZ0_ECOH1          LQAIIDACK------TNKIK-GTVRAVFSNKADAFGLERARQAGIATHTLI------ASA
Q32D68_SHIDS          LQAIIDACK------TNKIK-GTVRAVFSNKADAFGLERARQAGIATHTLI------TSA
A0A0H2V9D8_ECOL6      LQAIIDACK------TNKIK-GTVRAVFSNKADAFGLERARQAGIATHTLI------TSA
A0A0H3JJE1_ECO57      LQAIIDACK------TNKIK-GTVRAVFSNKADAFGLERARQAGIATHTLI------ASA
H9L487_SALTY          LQAIIDACE------AKKIK-GTLRAVFSNKADAFGLERAREAGIPAQALT------ADR
R4Y758_KLEPR          LQAIIDACG------RKQIN-GTLRAVFSNKADAFGLERARLAGIPAHALA------QSQ
A0A0H3HF70_KLEOK      LQAIIDACA------RKKIN-GTLRAVFSNKADAFGLERARAANIPAHALA------ASQ
D2T6R4_ERWP6          LQAILDACQ------QGRIG-GRIAAVFSNKAGAFALERARAANIAAHALA------AAQ
A0A384LGH9_YERPE      LQALIDAQQ------QGRIS-GKISAVFSNNPAAYGLERAESAGIPHHALD------AKA
Q7N3F6_PHOLL          LQAVIDACQ------QNRIN-GQVCAVLSNTANAYGLLRAKQADIPTHVIS------PKN
A0A1W6M605_VIBVL      LQAILEACE------CDTSR-AKVCAVFSNKADAYGLERAKQFSVPAHYID------PKA
S5IMX5_VIBPH          LQAILEACE------NSMPN-AHVAAVFSNKSDAYGLERAKQFNVDGHFVD------PKA
Q9KPY5_VIBCH          LQAIIDACA------TSIQD-GKVTAVFSNKATAYGLERAKQAGAAACFID------PKA
Q5E3H2_ALIF1          LQAFIDACG------NKIPN-ARIAAVISNKSDAYGLQRAIDADINVHSLN------AKA
Q5QUP8_IDILO          MQAIQQACE------DEKVT-GEIVAVISNKASAKGLEKAAAKGIDTEVLS------HKE
E6XGN7_SHEP2          LQAIIDGCD------DN-LQ-AEVVGVISNKPDAYGLVRAHYNEIDTSCVI------AHQ
Q8EDI7_SHEON          LQAVIDGCD------DN-LQ-AEVVGVISNNPDAYGLVRAHHSEIDTSCVI------ARP
Q12ME9_SHEDO          LQAVMDACD------DN-LR-AEVVGVISNKPQAYGLVRAHQAEIDASCVI------ARK
Q83AY9_COXBU          LQAIIGAIQ------KG-LA-IEIRAVISNRADAYGLKRAQQADIPTHIIP------HEE
Q9I514_PSEAE          LQALIDSLR------DGATP-ARIRAVISNRADAYGLERARQAGIQTEVLD------HKA
A5W7R8_PSEP1          LQALIDSCQ------GQDSP-VRIRAVVSNRADAYGLQRAAAAGIDSVVLD------HTQ
F6AG77_PSEF1          LQALIDSTA------DGESS-VRIAAVIANRSDAYGLQRAQAAGIATRVLE------HGD
PUR3_HAEIN            LQTIIDACH------SGDIP-AKIACVISNKADAYGLVRAKQAQIPQAVFL------RKN
A6VMA5_ACTSZ          LQAIMDACA------TADIH-AEVAAVISNRASAFGLERAKTAKIPTALFE------RQD
Q5F7F4_NEIG1          MQAIVNAAI------PN----VRIAAVLSNSETAAGLQWAAERGIPTDSLN------HKN
A1KUZ0_NEIMF          MQAIVNAAI------PN----VRIAAVLSNSETAAGLQWAAERGIPTDSLH------HKN
Q9JYI9_NEIMB          MQAIVNAAI------HN----VRIAAVLSNSETAAGLQWAAERGIPTDSLN------HKN
I1XKF9_METNJ          MQSIVKAIQ------ANELD-AEVAAVISNCPNAAGLKFAQQSDIATRTLD------HKN
Q63WI1_BURPS          MEAIVRACA------REGWP-AEVAAVISNRPGAAGLEFAASHGIATAVVD------HRA
B7JBZ7_ACIF2          LQSILAACR------SGQIPDTQVVAVISNRPAAGALELAVLAGIPALTVD------HRD
Q5H3C3_XANOR          LQAIVDAIA------SGRLR-AEVVGVFSDRPQAPALQKVEQR--RRWSAS------PRD
Q8PID7_XANAC          LQAIVDAIA------SGRLH-AEVVGVFSDRPQAPALQKVEPA--RRWSAS------PRD
Q8P723_XANCP          LQAILDAIA------AGQLA-AEVAGVFSDREQAPALQKVDAS--RRWSAS------PRA
B2I7G1_XYLF2          LQAILDAIA------TDRLH-AEVVGVFSDRPDAPALTKVLPR--HRWSAD------PHD
Q215Q7_RHOPB          MAALIDAAL------ADADFPAEIVAVISNTPSAGGLAIAAQSGIATVVVE------SKP
Q07LG6_RHOP5          MAALIEAAK------ADG-FPAEIVVVISNTADAGGLAIAQASGVPTEVIE------SKP
Q6N5C7_RHOPA          MAALIEAAA------EDG-FPAEIAVVISNVATAGGLAIAERSGIATVVIE------SKP
Q89MR6_BRADU          MVALIKAAS------ARD-FPAEISLVISNKADAPGLERARASGVNTLVIE------SKP
A9W4F2_METEP          MVSLIEAAR------APD-YPAEIVLVLSNRPDAAGLDRARAAGIPARAID------HKA
B0UKC5_METS4          MVSLLRAAE------DPA-YPAQFVLAASNRPDAPGLAHAAAAGLATLALD------HRA
Q2RSC7_RHORT          MEALIAACA------DPA-FPAGIVSVISNRADAKGLERAQAAGLSTTVID------HKA
Q9A7M0_CAUVC          MEALVRA-A------QAPGCPFEIALVLANKPDAKGLEIAAAAGVEALCVD------QKP
Q3J516_RHOS4          MLALLRS-M------EG-AHPARPVLVASNDPAAAGLKRAAELGVPVAAVD------HRP
Q8YGB8_BRUME          MEALIRAAQ------APG-FPAEIVAVFSDKAEAGGLAKAEAAGIATQVFK------RKD
A0A0H3G630_BRUSU      MEALIRAAQ------APG-FPAEIVAVFSDKAEAGGLAKAEAAGIATQVFK------RKD
Q7CZW4_AGRFC          MVSLAKACQ------AAD-FPAEIACVISDKASAGGLEKARDLGIPTLVFE------RKT
Q2KA46_RHIEC          MMALVAAAK------AAD-YPAEIVGVISDKAEAGGLAKAAAEGISTFAFP------RKD
F7XMS4_METZD          LQSIIDNIE------SGYIRNASINVVVSDVHDAYALERARDRAIDAIFIN------PSE
Q8TK92_METAC          LQAIIDSIE------KGYIKNAAVSVVISNKADAYALERAEKHGISAVFLD------P-E
Q2FTJ6_METHJ          FQAIIDRVH------DGYI-NAECSGLITDNPDAYAIKRAHNAGIPAEVVP------YRN
Q8F3W7_LEPIN          LRAVLQNIK------VGKI-RGIAQTLICDHPDAKALEVAQEFELTSQVLN------FSS
B5YK81_THEYD          FQAIIDEIE------AGKI-PAKIEILIVDNPNAYAIERAKKHGIPYLFIN------PKD
Q74CB5_GEOSL          LQAIIDRIE------DGSL-PARIVCVISNKADAFGLERARKHGVPAIHID------HRA
O67023_AQUAE          LQAIIDAIE------SGKV-NASIELVISDNPKAYAIERCKKHNVECKVIQ------RKE
B8E0V4_DICTD          LQALIDASK------DENY-PAEVVVVISNNPSAYAIERAKRENIPVFVIR------RED
A0RTU5_CENSY          MEAIIKHVQ------KRRV-PANLAVVISSRSDARGLRIAERLGVDTEVVE------SRG
A9A4N2_NITMS          MESILKSIK------KKKI-PINPAVVISNKPDAKGLKIAQKLGVDIEVVE------SKG
Q1IM87_KORVE          FEAIADNVA------AGKI-PAQISVVISNRADAGGIESAKRRGLNALVIP------SKG
Q3YRI0_EHRCJ          MHALINACM------QDDF-PAEISCVISNNPNANGLLIAQRNNIKTFVIQ------GRP
B3CPV8_WOLPP          MQALIEACQ------DQNF-PAETVCVITNNSEAGGLKIAKQAGVSAFVVE------DKP
Q7VBZ7_PROMA          LKAIIEDIL------SKRL-DAEIKCLIVSNPNCGAIEIANKHLIPVKVVT------SND
A9BAE2_PROM4          FEALINAIK------NSKL-DAEIKCLVVNNSKCKAIEKAQKYNIPYVILD------HRS
Q8DGJ1_THEEB          FAALAEAIA------AGEL-AAQIQVLIYNNPDAFVAERAKQWQIPSVLLN------HRH
Q55172_SYNY3          FEAIAKAIK------EGKL-NAVVKLVIYNNPNAGVRKRAMDHGVPHRLLN------HRD
Q31PN1_SYNE7          FEALAQAIT------ADQL-QAEIRLLIYNNPDAYVRQRAERLGIPALLLD------HRQ
Q7NKS6_GLOVI          --MLADAAR------SGRL-PVEIAVLVYNNPGAYVADRARAAGIAAVLLD------HRK
Q2RGU8_MOOTA          MEAIAAAIE------AGEV-PARIQAVISDRPEARALELARERGLKAFCLA------PGE
Q72E43_DESVH          LQAILDRIA------SGAL-DAEVGVVISNKPQARALERARSAGVPSLALD------PAA
PUR3_MYCTU            LRSLLDAAV--------GDYPARVVAVGVDRE-CRAAEIAAEASVPVFTVR------LAD
PUR3_MYCTO            LRSLLDAAV--------GDYPARVVAVGVDRE-CRAAEIAAEASVPVFTVR------LAD
F6ERE0_HOYSD          FQALADAAT--------GDFPACIAALVTDRD-CEAEARAQRAGIECVRVT------PRS
Q8NS22_CORGL          LQSLIEAQ---------GTYS--IVGVVSDVE-CPALSRAADAGIDTAVVP------LGK
Q9KY51_STRCO          LQALLD----EIATTGAEAYGAEIVAVGADRDGIEGLARAERAGVTTFVRR------VKD
C7QGV4_CATAD          LQALIDAENAEKARSSAPAFGATVVAVGADRTDIQGLDRAEQAGIPTFALR------VKD
A9WEW1_CHLAA          LQALLDAQA-------AGDLAGEVVLVASDRAQAYGLQRALQAGVAAAYIP------LRA
Q83GZ2_TROWT          LLRLIRACE-------QKELKAEIVAVGSDRH-APALSHASDYGIPFFVSP------FKE
G7V599_THELD          METIVKNCQ-------AGKIPATVAFVGSSKKNAEGLKKAKNLGIPTVVLP------YQE
D1B9N8_THEAS          LMAIKEAID-------RGDLNARIGFVGSDVPDCPGMVWASGQGLDTVFLD------YSK
Q97CD0_THEVO          LQAIIDAVK------NKKI-DVEISKVIADRE-CLAIKRAEDNNIPYRILK------RGE
E4T8V1_RIEAD          LQRLIEAIE------NEEISNAQISMVVADRD-CYGLERARKYGIETLLIK------RGK
A5N0Q1_CLOK5          FQSIIDAVH------SGYLKNCIIDILISDRPGVYALERAKKNNIEYHVLD------RKI
A5I5W0_CLOBH          LQSIIDKIE------EGYIKNCKIEMVIGDRSNIYGIERAEKKGIKTLTLD------RKI
Q97J92_CLOAB          LQSIIDAIE------EGYIKNCIIEAVISDKKGAFAIERAKKHGIKSYTFD------RKE
Q0SV49_CLOPS          LQSILDNID------NGNI-NGEVSLVIGSKEGIFALERAEKQGIKTSVVS------KKE
D9RAC8_CLOSW          LQAVLDAID------CGRITNAEVKVVISNNRNAYALERARNHGIPAFSIS------PGD
E6UD28_RUMA7          LQALIDAQA------RGEIKGGKISCVISSKEGAYALERAAKAGIPSVVLP------RKE
Q2JE89_FRACC          LRALHQSSL------RPAA-AFRLALVLSNNGGSGALAYARAHAIPAAHMS------GVT
Q9RSU6_DEIRA          ARALVQACR------AGEL-DAEPLALASNNSRSPALAWAREAGLRTAHLS------SAT
Q8TTV9_METAC          MQAIIDACR------RGDL-NGEVCAVISNNSNSQALEKARIAGVPEYHLS------NKT
B3QS63_CHLT3          FKALVKSVS------EKEL-NAEIVLCLSNRSNCGAMKFARENGIEAQHLS------ENQ
Q8KFK7_CHLTE          FKALFHAII------EREL-PAEIVMCLSNRSQCGAIDFAKEYGIETLHLS------ESQ
Q2S223_SALRD          FQAILDAVG------GDRL-PAEVACCISNTKDAGALKRADQHDVPTEVIP------PAS
E6SW52_BACT6          TENIIRFFR------EKD--SACVRLVLTNRQDALVLERAKRLGVPYACFA------KND
Q64ZV6_BACFR          AENIIRYFE------KNA--SVRVRLVLSNRKDAYVLERACRLGVPYRAFP------KSD
A6LFS5_PARD8          AENITRYFA------NSE--NVNVAVVLSNNRNVGVHGRVNKLGVPSFVFS------REE
Q5NGF0_FRATT          MQAIIDAIA-------NKQLNAQISLVISNKSDAYILQRAADYNIPTKYIA------AKG
PUR3_SCHPO            LQAIIDATLNGV-----LKGEAAVTHVLSNRKNAYGLERAAKAGIPTSLHTLLP--YKK-
L8G8V8_PSED2          LQALIDATTSSPP----TLPNTVITHVISNKKNAYGLDRARSAGIKTSYHNLVAGHYLKS
PUR3_YEAST            LQALIDAQKQGQ-----LGEDAHIVSVISSSKKAYGLTRAADNNIPTKVCSLYP--YTKG
PUR3_DICDI            LQAIIDAIESKY-------LNVCIKVVISNKETAYGLERAKKASIETRVFSLQK--YLKQ
                         .                         .                              

Q6HPA1_BACHK          YE----------------------------------------------SKEAFEKEILNK
Q73EN2_BACC1          YE----------------------------------------------SKEAFEKEILKK
Q81IQ0_BACCR          YE----------------------------------------------SKEAFEKEILKK
A0A242Y8U5_BACTU      YE----------------------------------------------SKEAFEKEILKK
Q8Y6C4_LISMO          YP----------------------------------------------DKEAFETEILLE
Q92AP2_LISIN          YP----------------------------------------------DKEAFETEILLE
PUR3_BACSU            YE----------------------------------------------NKAAFEQAIIEQ
Q9KF54_BACHD          YP----------------------------------------------SKEAYEIEVVQQ
B1HTV7_LYSSC          FA----------------------------------------------SKAAYEKVIVDA
PUR3_STAAR            FG----------------------------------------------SKAAYEQHLVTL
Q2FZI7_STAA8          FD----------------------------------------------SKAAYEQHLVTL
PUR3_STAAW            FD----------------------------------------------SKAAYEQHLVSL
PUR3_STAAN            FD----------------------------------------------SKAAYEQHLVTL
E6GHV8_ENTFL          FP----------------------------------------------SRGQYEEQVLKH
Q833Z2_ENTFA          FS----------------------------------------------SRGQYEEQVLKH
Q1G9G1_LACDA          CG----------------------------------------------GKQKYEEKILRV
Q8DRM3_STRR6          FE----------------------------------------------SKTDYEAALVEL
D5AF79_STRGZ          FA----------------------------------------------DKQAYEEAIIQL
H5T027_LACLL          FS----------------------------------------------SKVDYEKALVEI
H9UKG3_SPIAZ          KL----------------------------------------------DRRTAERGVIPL
Q9X0X5_THEMA          -------------------------------------------------EKPWAESLKKR
A0A0H3PBG9_CAMJJ      YN----------------------------------------------TREEFDTILVQK
A0A0B6UZ56_CAMJU      YN----------------------------------------------TREEFDTILVQK
Q0PBV2_CAMJE          YN----------------------------------------------TREEFDTILVQK
A7GW50_CAMC5          FA----------------------------------------------SREEFDAALVSE
E6SMP0_THEM7          GGPGPGRAGSSGAGGRWGTDREGEAVTGAGSGSAAGCGTGGTPPAPTPGREAWDRAILAE
D7BF68_MEISD          -------------------------------------------PWPKGGRQLFEQAALQL
PUR3_ECOLI            F----------------------------------------------DSREAYDRELIHE
E3PFZ0_ECOH1          F----------------------------------------------DSREAYDRELIHE
Q32D68_SHIDS          F----------------------------------------------DSREAYDRELIHE
A0A0H2V9D8_ECOL6      F----------------------------------------------DSREAYDRELIHE
A0A0H3JJE1_ECO57      F----------------------------------------------DSREAYDRELIHE
H9L487_SALTY          F----------------------------------------------DSRDAFDRELIRK
R4Y758_KLEPR          F----------------------------------------------ADREAFDRQLMHE
A0A0H3HF70_KLEOK      F----------------------------------------------ANREAFDRELMHE
D2T6R4_ERWP6          F----------------------------------------------ADRCAFDRQLMLE
A0A384LGH9_YERPE      F----------------------------------------------TDRVSFDLALAQA
Q7N3F6_PHOLL          Y----------------------------------------------ADRQTYDEALKHT
A0A1W6M605_VIBVL      F----------------------------------------------TDRESFDRELMKA
S5IMX5_VIBPH          F----------------------------------------------ESREAFDAELMQQ
Q9KPY5_VIBCH          Y----------------------------------------------ETRDAFDAALMEQ
Q5E3H2_ALIF1          Y----------------------------------------------DSRELYDDALATL
Q5QUP8_IDILO          F----------------------------------------------DSREAYDAELKSL
E6XGN7_SHEP2          G----------------------------------------------ESRSEYDARLIAV
Q8EDI7_SHEON          G----------------------------------------------ESRSDYDARLLAA
Q12ME9_SHEDO          G----------------------------------------------ESRAEYDERLQLK
Q83AY9_COXBU          F----------------------------------------------PSRTDFESTLQKT
Q9I514_PSEAE          Y----------------------------------------------ADRESFDEALAQR
A5W7R8_PSEP1          F----------------------------------------------DGREAFDAALMAR
F6AG77_PSEF1          Y----------------------------------------------QGRDAFDAALMEA
PUR3_HAEIN            F----------------------------------------------SNNLEMDDAIGDY
A6VMA5_ACTSZ          F----------------------------------------------ADNGAMDRAIGDY
Q5F7F4_NEIG1          F----------------------------------------------ESRLAFDTAMMEK
A1KUZ0_NEIMF          F----------------------------------------------ESRLAFDTAMMEK
Q9JYI9_NEIMB          F----------------------------------------------TSRLAFDTAMMEK
I1XKF9_METNJ          F----------------------------------------------ASREAFDEQLMKL
Q63WI1_BURPS          F----------------------------------------------DGRDSFDAALAAE
B7JBZ7_ACIF2          Y----------------------------------------------GARVDFDAALQRR
Q5H3C3_XANOR          F----------------------------------------------ANRAAFDAALGDA
Q8PID7_XANAC          F----------------------------------------------ADRAAFDAALGQA
Q8P723_XANCP          F----------------------------------------------ADRAAFDSALGDA
B2I7G1_XYLF2          S----------------------------------------------PDRISFDTTLSAA
Q215Q7_RHOPB          FG---------------------------------------------KDRAGFEAKLQAV
Q07LG6_RHOP5          FG---------------------------------------------KDRAAFEAKLQQA
Q6N5C7_RHOPA          FG---------------------------------------------KDRAGFEAKLQAE
Q89MR6_BRADU          FG---------------------------------------------KDRAGFEAVLQAA
A9W4F2_METEP          F----------------------------------------------PDRARFDAALQAE
B0UKC5_METS4          H----------------------------------------------PDRAGFDAALDAG
Q2RSC7_RHORT          F----------------------------------------------AGREPFEAALSAH
Q9A7M0_CAUVC          FG---------------------------------------------KDREAYERAIDAA
Q3J516_RHOS4          FR---------------------------------------------GDRAAFEAALLEP
Q8YGB8_BRUME          F----------------------------------------------ASKEAHEDAILAA
A0A0H3G630_BRUSU      F----------------------------------------------ASKEAHEDAILAA
Q7CZW4_AGRFC          Y----------------------------------------------ASKAEHEGAILAA
Q2KA46_RHIEC          Y----------------------------------------------ASKDAHEAAIFSA
F7XMS4_METZD          HG---------------------------------------------S-KKDYEKYLIGI
Q8TK92_METAC          GR---------------------------------------------D-RAGYDREILKI
Q2FTJ6_METHJ          FP---------------------------------------------D-KIQYENALMEV
Q8F3W7_LEPIN          FS---------------------------------------------N-KSEYHTKLLQL
B5YK81_THEYD          FQ---------------------------------------------S-KEAFYEKIRDE
Q74CB5_GEOSL          HG---------------------------------------------G-RESYDAALVET
O67023_AQUAE          FP---------------------------------------------S-KKEFEERMALE
B8E0V4_DICTD          YK---------------------------------------------S-KKEYEEKIKEV
A0RTU5_CENSY          FS---------------------------------------------GTRKEYDRKVMAA
A9A4N2_NITMS          FK---------------------------------------------GSRAEYDKKIISV
Q1IM87_KORVE          VP-----------------------------------------------REEHDRRVVKA
Q3YRI0_EHRCJ          LD---------------------------------------------F------DAIDNI
B3CPV8_WOLPP          LD---------------------------------------------T------DKIHEI
Q7VBZ7_PROMA          FI---------------------------------------------N-RESLDQHLVNL
A9BAE2_PROM4          FE---------------------------------------------S-RESLDREIIEY
Q8DGJ1_THEEB          YP---------------------------------------------N-RESLDAAIVET
Q55172_SYNY3          YD---------------------------------------------S-REDLDQDIVEH
Q31PN1_SYNE7          FA---------------------------------------------S-REDLDQAIITA
Q7NKS6_GLOVI          FV---------------------------------------------S-REVLDEEIVAT
Q2RGU8_MOOTA          YP---------------------------------------------S-RQAYDLALATA
Q72E43_DESVH          YA---------------------------------------------D-RESYDAALVEA
PUR3_MYCTU            H----------------------------------------------PSRDAWDVAITAA
PUR3_MYCTO            H----------------------------------------------PSRDAWDVAITAA
F6ERE0_HOYSD          Y----------------------------------------------SDRAAWNHALTSV
Q8NS22_CORGL          ------------------------------------------------DRAQWNHELADA
Q9KY51_STRCO          Y----------------------------------------------GTREEWDAALAES
C7QGV4_CATAD          F----------------------------------------------ATRAEWDRALRDK
A9WEW1_CHLAA          TRG--------------------------------------------PQRQQWEQRLADI
Q83GZ2_TROWT          YS----------------------------------------------NRDAWGANLLNT
G7V599_THELD          G------------------------------------------------VETAEKTLLEE
D1B9N8_THEAS          G------------------------------------------------REAAECQIDRA
Q97CD0_THEVO          YFQR---------------------------------------------------DLKEE
E4T8V1_RIEAD          NFSS---------------------------------------------------ELKER
A5N0Q1_CLOK5          YKSN------------------------------------------------ISDEILKL
A5I5W0_CLOBH          YKSN------------------------------------------------LSNKICEC
Q97J92_CLOAB          YKGT------------------------------------------------VCDEVLKL
Q0SV49_CLOPS          FEDK------------------------------------------------TSDEILRL
D9RAC8_CLOSW          FTGRE----------------------------------------------AFYESLLLK
E6UD28_RUMA7          YADKK----------------------------------------------AYSQAILEE
Q2JE89_FRACC          HPDPD----------------------------------------------QLDTAICTL
Q9RSU6_DEIRA          SPDPD----------------------------------------------ALDAAIHDF
Q8TTV9_METAC          YPEED----------------------------------------------ELDEAICKV
B3QS63_CHLT3          FESHE----------------------------------------------AFSDAMLDE
Q8KFK7_CHLTE          FGSHD----------------------------------------------DFARAMLSE
Q2S223_SALRD          FESPE----------------------------------------------AFGHALLDG
E6SW52_BACT6          WES--------------------------------------------------GEAILPL
Q64ZV6_BACFR          WEA--------------------------------------------------AESILDL
A6LFS5_PARD8          FIA--------------------------------------------------GVPILKK
Q5NGF0_FRATT          LT-----------------------------------------------REQYDELVVAE
PUR3_SCHPO            -EYGPEI-----------------------------------------GRKKYDAELAEK
L8G8V8_PSED2          GEKDPEAIKA--------------------------------------GREKYDADLAAL
PUR3_YEAST            IAKEDKAARAK-------------------------------------ARSQFENDLAKL
PUR3_DICDI            DPINN-------------------------------------------TRSTYGLELAKI
                                                                                  

Q6HPA1_BACHK          LEEYEID----YVILAGYMRLIGPTLLEAYGG-----RIINIHPSLLPS-----------
Q73EN2_BACC1          LEEYEID----YVILAGYMRLIGPTLLEAYGG-----RIINIHPSLLPS-----------
Q81IQ0_BACCR          LEEYEID----YVILAGYMRLIGPTLLEAYGG-----KIINIHPSLLPS-----------
A0A242Y8U5_BACTU      LEEYEID----YVILAGYMRLIGPTLLEAYGG-----KIINIHPSLLPS-----------
Q8Y6C4_LISMO          LRRLEID----LLVLAGYMRLIGPTLLAEFPE-----QIVNLHPSLLPE-----------
Q92AP2_LISIN          LRGLEID----LLVLAGYMRLIGPTLLAEFPE-----QIVNLHPSLLPA-----------
PUR3_BACSU            LRLHEVE----LIALAGYMRLIGDTLLQAYGG-----KIINIHPSLLPA-----------
Q9KF54_BACHD          LKEKQID----FVVLAGYMRLVGPTLLGAYEG-----RIVNIHPSLLPA-----------
B1HTV7_LYSSC          LHECDVK----WIVLAGYMRLISDVLLAAFPQ-----RIVNIHPSLLPA-----------
PUR3_STAAR            LNEDKVE----WIILAGYMRLIGPDLLASFEG-----KILNIHPSLLPK-----------
Q2FZI7_STAA8          LNEDKVE----WIILAGYMRLIGPDLLASFEG-----KILNIHPSLLPK-----------
PUR3_STAAW            LNEDKVE----WIILAGYMRLIGPDLLASFEG-----KILNIHPSLLPK-----------
PUR3_STAAN            LNKDKVE----WIILAGYMRLIGPDLLASFEG-----KILNIHPSLLPK-----------
E6GHV8_ENTFL          LKEHQID----LIVLAGYLRIIGKTLLEAYPK-----RIVNIHPSLLPS-----------
Q833Z2_ENTFA          LKEHQID----LIVLAGYLRIIGKTLLEAYPK-----RIVNIHPSLLPS-----------
Q1G9G1_LACDA          LKDYQID----FIALAGYMRVIGPTILSEYEG-----RIVNLHPAYLPA-----------
Q8DRM3_STRR6          LEEHQID----LVCLAGYMKIVGPTLLSAYEG-----RIVNIHPAYLPE-----------
D5AF79_STRGZ          LDQHQID----LVVLAGYMKIVGPTLLAQYEG-----RIINIHPAYLPE-----------
H5T027_LACLL          LKDQEID----LILLAGYMKIIGATVLSKYKG-----KIINVHPSYLPD-----------
H9UKG3_SPIAZ          LQRLQVD----CLVFAGFMRLITPTLLNAFPD-----RILNIHPSLLPR-----------
Q9X0X5_THEMA          LEELNPD----LVVLAGFMRILPAEIVERWKW-----KIVNIHPSLLPA-----------
A0A0H3PBG9_CAMJJ      IKESGAN----LTVLAGFMRILSPVFTKNI-------KAINLHPSLLPL-----------
A0A0B6UZ56_CAMJU      IKESGAN----LTVLAGFMRILSPVFTKNI-------KAINLHPSLLPL-----------
Q0PBV2_CAMJE          IKESGAN----LTVLAGFMRILSPVFTKNI-------KAINLHPSLLPL-----------
A7GW50_CAMC5          IKKYDVD----LVVLAGFMRILSEIFTSQI-------RAINLHPSILPL-----------
E6SMP0_THEM7          LGRWRPD----LVVLAGFMRILGPAVVAAYRN-----RILNVHPSLLPA-----------
D7BF68_MEISD          LAERHVD----LVLLAGFMRLLSPAFVEPWMG-----RILNIHPSLLPN-----------
PUR3_ECOLI            IDMYAPD----VVVLAGFMRILSPAFVSHYAG-----RLLNIHPSLLPK-----------
E3PFZ0_ECOH1          IDMYAPD----VVVLAGFMRILSPAFVSHYAG-----RLLNIHPSLLPK-----------
Q32D68_SHIDS          IDMYAPD----VVVLAGFMRILSPAFVSHYAG-----RLLNIHPSLLPK-----------
A0A0H2V9D8_ECOL6      IDMYAPD----VVVLAGFMRILSPAFVSHYAG-----RLLNIHPSLLPK-----------
A0A0H3JJE1_ECO57      IDMYAPD----VVVLAGFMRILSPAFVSHYAG-----RLLNIHPSLLPK-----------
H9L487_SALTY          IDAYAPD----VVVLAGFMRILSPMFVAHYYG-----RLLNIHPSLLPK-----------
R4Y758_KLEPR          IDAYAPD----LVVLAGYMRILSPAFVSHYQG-----RLLNIHPSLLPK-----------
A0A0H3HF70_KLEOK      IDAYAPD----LVVLAGYMRILSPAFVAHYQG-----RMLNIHPSLLPK-----------
D2T6R4_ERWP6          IDAYSPD----LVVLAGYMRILSAEFVQRYAG-----RMLNIHPSLLPK-----------
A0A384LGH9_YERPE      IDQYQPD----LLVLAGYMRILSPEFVKHYAG-----RMLNIHPSLLPK-----------
Q7N3F6_PHOLL          IDQYQPD----LLVLAGYMRILTPDFVQHYLG-----RLLNIHPSLLPK-----------
A0A1W6M605_VIBVL      IDEYQPD----IVVLAGYMRILSGEFVRHYLG-----KMVNIHPSLLPK-----------
S5IMX5_VIBPH          IDKYQPN----VVVLAGYMRILSGAFVSHYLG-----KMINIHPSLLPK-----------
Q9KPY5_VIBCH          MDKFAPD----LVVLAGYMRILSSEFVRHYLG-----RMINIHPSLLPK-----------
Q5E3H2_ALIF1          IDLHKPD----IIILAGFMRILSEAFVTRYQG-----KMLNIHPSLLPK-----------
Q5QUP8_IDILO          IDSYQPD----LVVLAGFMRILTGEFTRHYEG-----RMFNIHPSLLPK-----------
E6XGN7_SHEP2          IEQYQPD----LIVLAGFMRILTDDLVNRYLG-----RIINIHPSLLPK-----------
Q8EDI7_SHEON          IEQYQPD----LIVLAGFMRILTNDFVNHYLG-----RMINIHPSLLPK-----------
Q12ME9_SHEDO          IDEYQPD----LIVLAGFMRILTDELVSRYLG-----KMINIHPSLLPK-----------
Q83AY9_COXBU          IDHYDPK----LIVLAGFMRKLGKAFVSHYSG-----RMINIHPSLLPK-----------
Q9I514_PSEAE          IDAHEPH----LVILAGFMRILSADFVRHYQG-----RLLNIHPSLLPR-----------
A5W7R8_PSEP1          IDGFAPD----LVVLAGFMRILSGDFVRHYQG-----RLLNIHPSLLPK-----------
F6AG77_PSEF1          IDGFDPQ----LVVLAGFMRILTPAFVRHYHG-----RLLNIHPSLLPR-----------
PUR3_HAEIN            LQSLAVD----LIVLAGYMKILTPKFTQRFAG-----KILNIHPSLLPK-----------
A6VMA5_ACTSZ          IEKIGAD----LIVLAGYMKILSESFVTRFAG-----KILNIHPSLLPK-----------
Q5F7F4_NEIG1          IDAYQPD----LVVLAGFMRILTPEFCAHYEG-----RLMNIHPSILPS-----------
A1KUZ0_NEIMF          IDAYQPD----LVVLAGFMRILTPEFCAHYEG-----RLMNIHPSILPS-----------
Q9JYI9_NEIMB          IDAYQPD----LVVLAGFMRILTPEFCARYEG-----RLMNIHPSILPS-----------
I1XKF9_METNJ          IDSFTPD----YVVLAGFMRILSAGFVKHYAN-----KLINIHPSLLPK-----------
Q63WI1_BURPS          IDRFAPD----LVVLAGFMRILTPAFVAKYEG-----RMLNIHPSLLPS-----------
B7JBZ7_ACIF2          IDDYAPD----VVALAGFMRQLTPAFVQHYEG-----RMLNVHPSLLPA-----------
Q5H3C3_XANOR          IAATQPD----WVICAGYMRILGEPLVRRFAG-----RMLNIHPSLLPK-----------
Q8PID7_XANAC          IAAAQPD----WVICAGYMRILGEPLVRRFAG-----RMLNIHPSLLPK-----------
Q8P723_XANCP          IAAVQPD----WVICAGYMRILGEPLVRRFTG-----RMLNIHPSLLPK-----------
B2I7G1_XYLF2          IAAVTPH----WVVCAGYMRILSAAFIERFPK-----RILNIHPSLLPK-----------
Q215Q7_RHOPB          LDDARVE----LICLGGFMRLFTADFVQRWHG-----KMLNIHPSLLPS-----------
Q07LG6_RHOP5          LDAHRVE----LICLGGFMRLLTSEFVQHWHG-----KMLNIHPSLLPS-----------
Q6N5C7_RHOPA          LDARGIE----LICLGGFMRLFTAEFAQHWYG-----RMLNIHPSLLPS-----------
Q89MR6_BRADU          LDQHGIE----LICLGGFMRLFTAEFTKAWYG-----RMLNIHPSLLPS-----------
A9W4F2_METEP          LDEAGIE----LIVLAGFMRILTDAFVEAWSG-----RMINIHPSLLPL-----------
B0UKC5_METS4          LRAHGIE----LVVLAGFMRVLTPGFVEAWAG-----RMVNIHPSLLPL-----------
Q2RSC7_RHORT          IEAVGAD----IICLAGFMRLLTAGFVTRWQD-----RMINIHPSLIPA-----------
Q9A7M0_CAUVC          LRARGIE----VIALAGYMRILTPFLVDAWEG-----RMLNIHPSLLPA-----------
Q3J516_RHOS4          ILAAEPD----ILCLAGFMRVLTPAFVARFEG-----RMLNIHPSLLPK-----------
Q8YGB8_BRUME          LDVLKPD----IICLAGYMRLLSGRFIAPYEG-----RILNIHPSLLPL-----------
A0A0H3G630_BRUSU      LDVLKPD----IICLAGYMRLLSGRFIAPYEG-----RILNIHPSLLPL-----------
Q7CZW4_AGRFC          LGEIAPD----IICLAGYMRLISGDFIAPYEG-----RIINIHPSLLPL-----------
Q2KA46_RHIEC          LDELSPD----ILCLAGYMRLLTPTFIQRYEG-----RMLNIHPSLLPL-----------
F7XMS4_METZD          LEEYSID----LILLAGYMRLLGNSFIRRYKN-----RIMNIHPSLLPS-----------
Q8TK92_METAC          LKQYDTD----LLLLAGYFRLLGSEIIEAYRH-----RILNIHPSLLPA-----------
Q2FTJ6_METHJ          LARYNPD----LVVLAGYMRLLGERIVDAYTG-----KMMNIHPSLLPA-----------
Q8F3W7_LEPIN          LLEIKPD----LIVTAGYMRILKSPIIQTFSN-----RIINIHPSLLPA-----------
B5YK81_THEYD          LLSKDVE----LVILAGFMRIVKKPLLDAFPN-----RIMNIHPALLPS-----------
Q74CB5_GEOSL          LRSHGVQ----LVVLAGFMRIVTPVLLDAFPN-----AVMNIHPALLPA-----------
O67023_AQUAE          LKKKGVE----LVVLAGFMRILSHNFLKYFPN-----KVINIHPSLIPA-----------
B8E0V4_DICTD          LQNFKVD----LVVLAGYMKIVGKTLLEAFPN-----RIINIHPSLLPS-----------
A0RTU5_CENSY          LRRHGVTRRDGLVCLAGFMRIIGPECVKRYKH-----RMLNIHPALLPS-----------
A9A4N2_NITMS          LTKYGVTPRNGLVCLAGFMRIISPEFVKKYKN-----RIINIHPALLPS-----------
Q1IM87_KORVE          LQDHGVD----LICLAGYMRLLSPWFVQQFPR-----RILNIHPSLLPA-----------
Q3YRI0_EHRCJ          LKEHKVD----LICLAGFMSIVPEKFINKWFH-----KVINIHPSLLPS-----------
B3CPV8_WOLPP          LVQHKVD----LICLAGFMRIIKANFLNKWHN-----KVINIHPSLLPS-----------
Q7VBZ7_PROMA          LHAYNVE----LVIMAGWMRIVTHILIDSFKN-----KIINIHPSLLPS-----------
A9BAE2_PROM4          FESYKIE----GIVMAGWMRIVTSTLINKYPN-----RLVNIHPSLLPS-----------
Q8DGJ1_THEEB          LKAHEVE----WVVMAGWMRIVTPVLLNAYPQ-----RVINLHPSLLPS-----------
Q55172_SYNY3          FRQAGVE----WVIMAGWMRIVTPVLLDAFSR-----RVLNIHPSLLPS-----------
Q31PN1_SYNE7          FRNRGVE----WIAMAGWMRLVTETLIQAFPE-----RIINIHPSLLPS-----------
Q7NKS6_GLOVI          LEAHGVE----LVVMAGWMRKVTEVLIGRFAD-----RILNIHPSLLPA-----------
Q2RGU8_MOOTA          LKKEGVE----LVALAGFMRLLGREFLEQFPG-----AVINIHPALLPA-----------
Q72E43_DESVH          IRAAGAQ----CVVLAGYMRLLTPVFLAAFPG-----AVINIHPSLLPS-----------
PUR3_MYCTU            TAAHEPD----LVVSAGFMRILGPQFLSRFYG-----RTLNTHPALLPA-----------
PUR3_MYCTO            TAAHEPD----LVVSAGFMRILGPQFLSRFYG-----RTLNTHPALLPA-----------
F6ERE0_HOYSD          VDSYRPD----LVVTAGFMRILGPEFLAAFPG-----KIVNSHPALLPA-----------
Q8NS22_CORGL          VAVSDPD----LVVSAGFMKILGEGFLSRFPS-----RIINTHPALLPS-----------
Q9KY51_STRCO          VAAHEPD----LVVSAGFMKIVGKEFLARFGG-----RFVNTHPALLPS-----------
C7QGV4_CATAD          VAEYEPD----LVVSAGFMKLLGADFLAAFDG-----RVINTHPALSPS-----------
A9WEW1_CHLAA          VACFEPD----LIVLAGFMRVLSAAFLERFPN-----RVINQHPALLPADGGDTVTTTSG
Q83GZ2_TROWT          VLAYKPD----LVVLSGFMRILPSCVVDALSP-----NLINTHPSYLPE-----------
G7V599_THELD          LKNHHVE----WIILAGFMRILSPKVVRSYPN-----RIVNIHPSLLPS-----------
D1B9N8_THEAS          MELHRVR----HLVLAGFMRILSAPFVGRHRG-----QVINLHPSLLPS-----------
Q97CD0_THEVO          MRSSKCDF----FVLAGFLSIIGKEITDEFRY-----RIINTHPSLLPCFGGHG------
E4T8V1_RIEAD          L-PKNVDL----IVLAGFLSIIKSPLTEEYQG-----KMINLHPSLLPKFGGKG------
A5N0Q1_CLOK5          LH-NRVEL----IVCAGWLSILKGDLISQFKN-----KMINIHPSLIPSFCGDG------
A5I5W0_CLOBH          LY-GNVDL----IVLAGWLSILNGDLVNKFEN-----KIINIHPSLIPSFCGDG------
Q97J92_CLOAB          LY-KKVDL----IVLAGFLSILKGDLLNKFKN-----RIINIHPSLIPAFCGNG------
Q0SV49_CLOPS          AKENNIDL----IVLAGYLSILKGKLLEEYGN-----RIINIHPSLIPSFCGNK------
D9RAC8_CLOSW          LDQYCLDL----IVLAGYLVTVPVAMIQKYRN-----KIINVHPSLIPSFCGKG------
E6UD28_RUMA7          LNRQKADL----VVLAGFMIILDEVVTKAYPY-----KIINVHPALIPSFCGEG------
Q2JE89_FRACC          LNERKISL----IVTAGYMKNIGPCTLKSYAG-----KIINVHPSLLPRHGGKG------
Q9RSU6_DEIRA          LVGSGADT----LVLSGYMKALGPRTLGAFAG-----RVLNIHPSLLPRHGGRG------
Q8TTV9_METAC          LTESGADI----VALAGYMKKLGPEVLKHYKG-----RILNIHPSLLPKYGGKG------
B3QS63_CHLT3          LKSRGVEI----VCLAGYLKKVPKKVVEAYPK-----RMLNIHPALLPKFGGEG------
Q8KFK7_CHLTE          LRDRQIDM----ILLAGYLRKIPDAVIAAYPE-----KIVNIHPSLLPQFGGHG------
Q2S223_SALRD          LAAHDVTF----VALAGYMQKIPPNVVDAYRG-----SMTNIHPALLPAFGGQG------
E6SW52_BACT6          LQEHDIDF----IVLAGFLARVPNSILHAYPN-----KMINIHPSLLPKFGGKG------
Q64ZV6_BACFR          LRKYQIDF----IVLAGFLLRIPDALLHAYPD-----KIINIHPALLPKFGGKG------
A6LFS5_PARD8          LAEYDVCL----IVLAGFMNKISDVILQAFPG-----KIVNIHPALLPKYGGKG------
Q5NGF0_FRATT          IQKYNPD----LILLIGFMRILSSVFIKAFEG-----KILNIHPSLLPK-----------
PUR3_SCHPO            IIKLQP----SLVVCAGWMHILSPEVLIPLETNK--IGIINLHPALPGA-----------
L8G8V8_PSED2          ILGDGP----DLIVCAGWMHILSPPFLAPLEKEH--VPVINLHPALPGA-----------
PUR3_YEAST            VLEEKP----DVIICAGWLLILGSTFLSQLQS----VPILNLHPALPGC-----------
PUR3_DICDI            IREYSSI---DLIVLAGWMIILPATFLKEFTDNKPTIDIINLHPALPGQ-----------
                                      *::  .                  * **:               

Q6HPA1_BACHK          -----FPGK---DAVGQALEAG-----VKVTGVTIHYVDAGMDTGPIIAQEAVVVSEG--
Q73EN2_BACC1          -----FPGK---DAVGQALEAG-----VKVTGVTIHYVDAGMDTGPIIAQEAVVVSEG--
Q81IQ0_BACCR          -----FPGK---DAVGQALEAG-----VKVTGVTIHYVDAGMDTGPIIAQEAVVVSEG--
A0A242Y8U5_BACTU      -----FTGK---DAVGQALEAG-----VKVTGVTIHYVDAGMDTGPIIAQEAVVVSEG--
Q8Y6C4_LISMO          -----FKGK---DAIGQAIQAN-----VSGTGVTAHFVDAGMDTGPIIDQVKVTIETA--
Q92AP2_LISIN          -----FKGK---DAIGQAIEAK-----VSETGVTAHFVDAGMDTGPMIDQVKVVVAKT--
PUR3_BACSU            -----FPGI---DAVGQAFRAG-----VKVAGITVHYVDEGMDTGPIIAQKAIEIDEH--
Q9KF54_BACHD          -----FPGL---HAIEQAIRAN-----VKVTGVTIHYVDEGMDTGPIIAQEAVSIEEE--
B1HTV7_LYSSC          -----FPGK---DAIGQALNHG-----VKITGVTVHFVDEGMDTGPIIAQAAVSVIEG--
PUR3_STAAR            -----YKGI---DAIGQAYHSG-----DTITGSTVHYVDSGMDTGEIIEQRQCDIRPD--
Q2FZI7_STAA8          -----YKGI---DAIGQAYHSG-----DTITGSTVHYVDSGMDTGEIIEQRKCDIRPD--
PUR3_STAAW            -----YKGI---DAIGQAYHSG-----DTITGSTVHYVDCGMDTGEIIEQRQCDIRPD--
PUR3_STAAN            -----YKGI---DAIGQAYHSG-----DTITGSTVHYVDCGMDTGEIIEQRQCDIRPD--
E6GHV8_ENTFL          -----FPGL---HGIEEAFHYG-----VKITGITIHYVDSGVDTGPIIFQTTTKIDTE--
Q833Z2_ENTFA          -----FPGL---HGIEEAFHYG-----VKITGITIHYVDSGVDTGPIIFQTTTKIDTE--
Q1G9G1_LACDA          -----YPGL---HSIERAFADH-----PAETGVTVHYIDSGLDSGPAIAQRHVPIYDD--
Q8DRM3_STRR6          -----FPGA---HGIEDAWNAG-----VGQSGVTIHWVDSGVDTGQVIKQVRVPRLAD--
D5AF79_STRGZ          -----FPGA---HGIEDAWNAG-----VAESGVTVHWVDSGIDTGQIIKQVRVPRLAD--
H5T027_LACLL          -----FAGSP--HAIEESHEAK-----KGL-GISIHYVDEGVDTGELIAQISLAYHED--
H9UKG3_SPIAZ          -----HPGA---RGLADSIASD-----DQQLGITIHLVDEGMDTGPVICQQSFTRVSG--
Q9X0X5_THEMA          -----FPGT---HAIEKAYEYG-----VKVTGITIHFVDEGVDTGPIIFQKAVEIKKD--
A0A0H3PBG9_CAMJJ      -----FKGA---HAIKESYESD-----MKVAGVSVHWVSEELDGGMIIAQKAFEKRN---
A0A0B6UZ56_CAMJU      -----FKGA---HAIKESYESD-----MKVAGVSVHWVSEELDGGMIIAQKAFEKRN---
Q0PBV2_CAMJE          -----FKGA---HAIKESYESD-----MKVAGVSVHWVSEELDGGMIIAQKAFEKRN---
A7GW50_CAMC5          -----FKGA---HAIKESFASD-----MQIGGVSVHWVSAELDGGKIIAQRAFERKDG--
E6SMP0_THEM7          -----FPGK---DAPRQALEHG-----VRITGCTVHFVDEGVDTGPILLQAPVPVLA---
D7BF68_MEISD          -----FPGL---HAQKQALEAR-----VQESGCTVHFVDTGMDTGPIILQRRVPVFP---
PUR3_ECOLI            -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
E3PFZ0_ECOH1          -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
Q32D68_SHIDS          -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
A0A0H2V9D8_ECOL6      -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
A0A0H3JJE1_ECO57      -----YPGL---HPHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
H9L487_SALTY          -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
R4Y758_KLEPR          -----YPGL---HTHRQVLENG-----DEEHGTSVHFVTDELDGGPVILQAKVPVFA---
A0A0H3HF70_KLEOK      -----YPGL---HTHRQALENG-----DEEHGTSVHFVTDELDGGPVVLQAKVPVFA---
D2T6R4_ERWP6          -----YPGL---HTHRQAIENG-----DEEHGTSVHFVTEQLDGGPVILQAKVPVFS---
A0A384LGH9_YERPE      -----YPGL---HTHRQALENG-----DQEHGTSVHFVTEELDGGPVILQAKVPIFS---
Q7N3F6_PHOLL          -----YPGL---HTHRKAITNG-----DTEHGTSVHFVTEELDGGPVILQAKVPIFA---
A0A1W6M605_VIBVL      -----YPGL---HTHQRAIDAG-----DSEHGTSVHFVTEELDGGPVILQAKVPVFA---
S5IMX5_VIBPH          -----YPGL---HTHQRAIDAK-----DKEHGTSVHFVTEELDGGPVVLQAKVPVFE---
Q9KPY5_VIBCH          -----YPGL---NTYQRAIHAG-----DEEHGTSVHFVTEQLDGGPVILQAKVPIFE---
Q5E3H2_ALIF1          -----YTGL---HTHQRAIDAG-----DKEHGTSVHFVTPELDGGPVILQAKVPIFE---
Q5QUP8_IDILO          -----YKGV---NTHQRALDAG-----DTEHGVSVHFVTEELDGGPVVLQAKVPIFE---
E6XGN7_SHEP2          -----YTGL---NTHQRAIDAN-----DNEHGASVHFVTPELDAGPVILQAKVPVYE---
Q8EDI7_SHEON          -----FTGL---NTHQRAIDAK-----ETEHGASVHFVTPELDAGPVVLQAKVPVYE---
Q12ME9_SHEDO          -----YPGL---HTHERALQAK-----EEEHGASVHFVIPELDAGPVILQAKVPVYE---
Q83AY9_COXBU          -----YTGL---NTHERALAAG-----ETEHGVSVHYVTEDLDAGPLICQARLSITP---
Q9I514_PSEAE          -----HKGL---HTHQRALEAG-----DREHGCSVHFVTEELDGGPLVVQAVIPVES---
A5W7R8_PSEP1          -----YKGL---HTHRRALEAG-----DAEHGCSVHFVTEELDGGPLVVQAVVPVAS---
F6AG77_PSEF1          -----HKGL---HTHQRALEAG-----DTEHGCSVHFVTEELDGGPLVVQAVIPVHS---
PUR3_HAEIN            -----YAGL---NTYQRAIEAG-----DNEHGTTVHFVNEEVDGGAIVLQAKVPIFP---
A6VMA5_ACTSZ          -----YKGL---HTYRQALNAG-----DSEHGTTVHFVTAELDSGAIILQAKVPIFA---
Q5F7F4_NEIG1          -----FTGL---HTHERALEAG-----CRVAGCTIHFVTAELDCGPIVSQGIVPILD---
A1KUZ0_NEIMF          -----FTGL---HTHERALEAG-----CRVAGCTIHFVTAELDCGPIVSQGVVPILD---
Q9JYI9_NEIMB          -----FTGL---HTHERALEAG-----CRVAGCTIHFVTAELDCGPIVSQGVVPILD---
I1XKF9_METNJ          -----FKGM---HTHKRAIEAG-----EKEHGATVHFVTEELDAGPVILQAKVPVLE---
Q63WI1_BURPS          -----FKGI---HTHQQALDAG-----VALHGASVHFVIPELDSGAIVAQAAVPVVA---
B7JBZ7_ACIF2          -----FPGL---HTHARALEQG-----VLWHGASVHFVTSALDAGPAIIQAAVAVLP---
Q5H3C3_XANOR          -----YRGL---HTHARALEAG-----DAEHGASVHLVVPELDAGTVIAQARVPVLP---
Q8PID7_XANAC          -----YRGL---HTHARALEAG-----DAEHGASVHLVVPELDAGAVIAQARVPVLP---
Q8P723_XANCP          -----YRGL---HTHARALEAG-----DAEHGASVHLVVPELDAGPVIAQAHVPVLP---
B2I7G1_XYLF2          -----HRGL---NTHARALAAG-----DTEHGASVHLVIPELDAGTVLAQAVVPILT---
Q215Q7_RHOPB          -----FPGL---DPHGQALRAG-----VKISGATVHFVIPETDAGPIVMQGAVAVRD---
Q07LG6_RHOP5          -----FPGL---DPHGQALRAG-----VKISGATVHFVIPATDAGPIVMQGAVAVRD---
Q6N5C7_RHOPA          -----FPGL---DPHGQALRAG-----VKISGATVHFVTPDTDAGPIIMQGAVPVQD---
Q89MR6_BRADU          -----FPGL---DPHGQALRAG-----VKLSGATVHFVIPETDAGPIVMQGAVPVSD---
A9W4F2_METEP          -----FKGT---YTHERALDAG-----VRLHGCTVHYVVPELDAGPIVAQAAVPVLP---
B0UKC5_METS4          -----FRGT---HTHAQALAAG-----VRLHGCTVHFVVPELDAGPIIAQAAVPVRP---
Q2RSC7_RHORT          -----FRGL---HTHERVIEAG-----VRVHGCTVHFVRAEMDDGPIIVQAALPVRP---
Q9A7M0_CAUVC          -----YPGL---DTHARAIAAG-----ELEAGCTVHLVTAGVDEGPILGQARVPILP---
Q3J516_RHOS4          -----YQGL---HTHQRALEAG-----DAEAGCTVHEVTAALDDGPILGQARVPILP---
Q8YGB8_BRUME          -----FPGL---HTHQRALDAG-----MKLAGCTVHLVTEGMDEGPILAQAAVPVLD---
A0A0H3G630_BRUSU      -----FPGL---HTHQRALDAG-----MKLAGCTVHLVTEGMDEGPILAQAAVPVLD---
Q7CZW4_AGRFC          -----FPGL---HTHQRAIDSG-----MKISGCTVHFVTEGMDEGPTIAQGAVPVLS---
Q2KA46_RHIEC          -----FPGL---HTHQRAIDAG-----MRIAGCTVHFVTEGMDEGPTIGQAAVPILS---
F7XMS4_METZD          -----FKGL---DAQKQALEYG-----VKVSGCTVHFVDEGMDSGPIILQQSVRVLE---
Q8TK92_METAC          -----FKGL---HAQKQAFEYG-----VKVAGCTVHFVDEGLDSGPIIIQKCVPVLP---
Q2FTJ6_METHJ          -----FQGL---HAQRQALTYG-----TKVAGCTVHFVTHDMDAGPVIIQRTVPVLD---
Q8F3W7_LEPIN          -----FPGL---NAQKQALEYG-----VKIAGCTAHFVDEGIDSGPIILQGVVKIEE---
B5YK81_THEYD          -----FPGL---HGQKQAVDYG-----VRISGCTVHFVDEGVDSGPIIIQAAVPVHP---
Q74CB5_GEOSL          -----FPGL---HAQAQALRYG-----VKFSGCTVHFVDEGTDTGPIIIQAAVPVMD---
O67023_AQUAE          -----FQGL---HAQKQAVEFG-----VKFSGCTVHIVDESVDAGPVIVQAVVPVLP---
B8E0V4_DICTD          -----FPGL---EAQRQAWEYG-----VKISGCTVHFVDEGIDSGPIIGQRAVPVYD---
A0RTU5_CENSY          -----FRGI---DAQKQALEYG-----AKVSGCTVHLVDEGTDTGPVVAQSVVQIRE---
A9A4N2_NITMS          -----FPGL---DAQKQALEYG-----AKFSGCTVHFVDAGMDTGPVIIQSIVKVKE---
Q1IM87_KORVE          -----FPGL---EASKQAFDYG-----VKVSGCTVHFVDEHLDHGDIIVQKVVPVLD---
Q3YRI0_EHRCJ          -----FKGL---SAQAQALKAG-----VKIAGCTVHYVYPELDAGPIIIQAAVPVFS---
B3CPV8_WOLPP          -----FKGL---NAQEQALKAG-----VKITGCTVHYVTPEIDAGAIIAQATVPVLP---
Q7VBZ7_PROMA          -----FKGK---EAVKNALNNK-----VKITGCTVHIVEEEVDSGEILIQSAVQVNT---
A9BAE2_PROM4          -----FPGN---NAIKQALESG-----VKITGCSVHLVKEKVDSGPILIQSAVPIFE---
Q8DGJ1_THEEB          -----FRGL---RAVEQALAAG-----VKITGCTVHLVEEEVDSGPILVQAAVPVLP---
Q55172_SYNY3          -----FRGV---RAVEQALAAG-----VKVSGCTVHYAEATVDSGPIVAQAVVPILA---
Q31PN1_SYNE7          -----FKGI---RAVEQAIAAK-----VRISGCTAHLVTLDVDSGPILVQAAVPVLP---
Q7NKS6_GLOVI          -----FRGA---KAIEQALDYG-----VKVAGCTVHIVRLEVDAGPIILQAAEAVRE---
Q2RGU8_MOOTA          -----FPGL---NAQRQALEYG-----VKFSGCTVHFVDAGMDTGPIIAQAVVPVRN---
Q72E43_DESVH          -----FPGL---RGAGDALDYG-----VRLAGCTVHFVNEEMDGGAVIVQAAVPVTP---
PUR3_MYCTU            -----FPGT---HGVADALAYG-----VKVTGATVHLVDAGTDTGPILAQQPVPVLD---
PUR3_MYCTO            -----FPGT---HGVADALAYG-----VKVTGATVHLVDAGTDTGPILAQQPVPVLD---
F6ERE0_HOYSD          -----FPGA---HAVRDALSYG-----VRVTGTTIHIVDEGVDTGPVLAQEAVTVGT---
Q8NS22_CORGL          -----FPGA---HAVRDALAYG-----VKVSGSTVHLVDAGVDTGPIIAQRAVPVEV---
Q9KY51_STRCO          -----FPGA---HGVRDALAYG-----ARVTGCTVHFVDDGVDTGPIIAQGVVEVRDED-
C7QGV4_CATAD          -----FPGM---HGPADALAYG-----VKVTGCTVFFVAGGVDDGPVVAQAAVPVEP---
A9WEW1_CHLAA          LVIPALRGA---HVVADALRLG-----LPVTGCTIHRVTPRVDDGPILARAEVPIQP---
Q83GZ2_TROWT          -----FPGM---NAVEDALRAG-----VKTTGASVIRVDNGIDTGPVISQMRVKVYS---
G7V599_THELD          -----FPGV---DAIRQAFEYG-----VKVTGVTVHLVDEEVDHGPILAQMPVRISP---
D1B9N8_THEAS          -----FPGR---SGIRDAFLYG-----VRITGVTVHLVDEQVDHGPILAQEAVEILE---
Q97CD0_THEVO          -----FYGR---KVHEAVIKSG-----MKYSGCTVHFVTDEVDGGPIILQRCVSVEDV--
E4T8V1_RIEAD          -----MWGM---NVHKAVLEAG-----EKETGATVHFVTSGIDEGDIILQDKVEISPN--
A5N0Q1_CLOK5          -----MYGI---KVHEKVLEHG-----VKISGCTVHFVDEGTDSGPIIFQEAVPVYFE--
A5I5W0_CLOBH          -----MYGI---KVHQKALEYG-----VKVSGCTVHFVDESTDSGPIIIQKSVPVFAE--
Q97J92_CLOAB          -----MYGM---KVHEKAIEYG-----VKISGCTVHFVDEGTDSGPIILQSAVEVLAT--
Q0SV49_CLOPS          -----MYGI---NVHEAAIEKG-----VKFSGCTVHFVNDEVDGGAIIAQEIVEVNFE--
D9RAC8_CLOSW          -----YYGL---KVHEAALARG-----VKVTGATVHYVDEGMDTGPILLQKAVEVREG--
E6UD28_RUMA7          -----YYGL---KVHEKALEYG-----VKISGATIHFVNEEADAGAIILQGAVDIAND--
Q2JE89_FRACC          -----MYGR---AVHESVLASG-----DRITGPSVHIVTAEYDAGPVIAQHELPVQPD--
Q9RSU6_DEIRA          -----LYGD---RVHESVLAAG-----DPESGATVHLVTAGIDEGPVLEQVRVPVLPG--
Q8TTV9_METAC          -----MYGT---HVHRAVIDAG-----EKTTGVTIHLVEEEYDTGKIIRQCEIEVLDG--
B3QS63_CHLT3          -----MYGI---NVHRAVIAAG-----EVESGATVHFVDEEYDSGANLIQEIVPVQKD--
Q8KFK7_CHLTE          -----MYGM---RVHEAVIASG-----ETRSGATVHFVNEEYDKGRIIMQNHVPVLPG--
Q2S223_SALRD          -----MYGM---HVHRAVIDYG-----VHWTGATVHLVDEEYDHGPIVLQEPVPVYAD--
E6SW52_BACT6          -----MYGD---RVHEAVIAAG-----EKESGITIHYTNEHYDEGAVICQIKCSVLPG--
Q64ZV6_BACFR          -----MYGD---RVHEAVVMAG-----ESESGITIHYIDEHYDEGSTVFQAKCPVLPG--
A6LFS5_PARD8          -----MYGM---HVHEAVVKAG-----ERESGITIHYINEHYDEGAIIFQASCPVLPS--
Q5NGF0_FRATT          -----HRGLMDLAVHQSVIDAG-----DSISGCTIHQVSEEVDGGDIVLQLKCDVVKE--
PUR3_SCHPO            -----FNGI---HAIERAFEAAQQGK-ITHTGAMVHWVIAAVDEGKPIIVQEVPILSTD-
L8G8V8_PSED2          -----YDGA---NAIKRAYEDFVAGKSKGPTGVMVHYVVAEVDRGQPVLVREVEFQEGE-
PUR3_YEAST            -----FDGTT--HAIEMAWRKCQDENKPLTAGCMVHYVIEEVDKGEPLVVKKLEIIPGEE
PUR3_DICDI            -----YPGA---HAIERAFNDFKENK-IKHSGIMIHKVIEEVDAGEVILTKEIPILPTD-
                             *                       *          * *  :            

Q6HPA1_BACHK          --DTRESLQKKIQQV-EHKLYVNTVNQIVQSTKEPTVN----------------------
Q73EN2_BACC1          --DTRESLQKKIQQV-EHKLYVNTVNQIVQSTKEPTVN----------------------
Q81IQ0_BACCR          --DTRESLQKKIQQV-EHKLYVNTVNQIVQSVKESTVN----------------------
A0A242Y8U5_BACTU      --DTRESLQNKIQQV-EHKLYVNTVNQIVQSVKESTVN----------------------
Q8Y6C4_LISMO          --ETTDTLAEKIHQV-EHIFYPKVIRGLIQNGGND-------------------------
Q92AP2_LISIN          --ETADSLAEKIHQV-EHIFYPKVIRGLIQNGGND-------------------------
PUR3_BACSU            --DTLETIEQRIHKL-EHKWYPSVIKQLLGLNNRGEKA----------------------
Q9KF54_BACHD          --DTLETLTTKIQAV-EHRLYPATLHKLLSK-----------------------------
B1HTV7_LYSSC          ---NREATEAAIHKQ-EHLLYTKALQQLLQ------------------------------
PUR3_STAAR            --DSKEQLEEKVKKL-EYELYPSVIAKIVK------------------------------
Q2FZI7_STAA8          --DSKEQLEEKVKKL-EYELYPSVIAKIVK------------------------------
PUR3_STAAW            --DSKEQLEEKVKKL-EYELYPSVIAKIVK------------------------------
PUR3_STAAN            --DSKEQLEEKVKKL-EYELYPSVIAKIVK------------------------------
E6GHV8_ENTFL          --DTLDTLTEKIHAL-EHEWYPKIISQIVKETTK--------------------------
Q833Z2_ENTFA          --DTVDTLAEKIHAL-EHEWYPKIISQIVKETMK--------------------------
Q1G9G1_LACDA          --DTVDTLEARIHEC-EHHLYPEALRKALLKFEEENK-----------------------
Q8DRM3_STRR6          --DTIDRFEARIHEA-EYRLYPEVVKALFTD-----------------------------
D5AF79_STRGZ          --DILETFEARIHEA-EYQLYPAVLEELGAVKK---------------------------
H5T027_LACLL          ----LEVYERSVHEA-EHKLYAEVVRQIILHQQ---------------------------
H9UKG3_SPIAZ          --AAPEQEEQQIHEL-EHTTYPRVIREFLDTLSG--------------------------
Q9X0X5_THEMA          --WSLERLEEEIHKI-EHRYYPLVIQKVLEGKWKIEGRRVILEEDIG-------------
A0A0H3PBG9_CAMJJ      --LSFEEFEEKIHSL-EHEILPLSVIEIFS------------------------------
A0A0B6UZ56_CAMJU      --LSFEEFEEKIHSL-EHEILPLSVIEIFS------------------------------
Q0PBV2_CAMJE          --LSFEEFEEKIHSL-EHEILPLSVIEIFS------------------------------
A7GW50_CAMC5          --MSEQEWEAKIHAI-EHEILPQSIVKILCK-----------------------------
E6SMP0_THEM7          -GDDAETLHRRIQAV-EHRLYPAAVRLVATGRVRVEGRRVKILGPHPRTASRRPGRAGPA
D7BF68_MEISD          -DDTEETLSARILAE-EHQAYPEAVRRVLMGQK---------------------------
PUR3_ECOLI            -GDSEDDITARVQTQ-EHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE----
E3PFZ0_ECOH1          -GDTEDDITARVQTQ-EHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE----
Q32D68_SHIDS          -GDTEDDVTARVQTQ-EHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE----
A0A0H2V9D8_ECOL6      -GDTEDDITARVQTQ-EHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE----
A0A0H3JJE1_ECO57      -GDTEDDVTARVQTQ-EHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE----
H9L487_SALTY          -NDSEDDITARVQTQ-EHAIYPLVISWFAQGRLKMRDNAAWLDGRRLPPQGYASDE----
R4Y758_KLEPR          -GDSEEEITARVQAQ-EHAIYPLVISWFVDGRLRMAGNHAWLDERQLPPQGYAADE----
A0A0H3HF70_KLEOK      -EDTEDDITARVQAQ-EHDIYPLAISWFVDGRLRAEGNEAWLDDVPLPPQGYAAEE----
D2T6R4_ERWP6          -DDTEDDIAARVQHQ-EHAIYPLVVSWFVDGRLAMRDGAAWLDGQRLPTNGHAVG-----
A0A384LGH9_YERPE      -DDSEEDVAERVQTQ-EHSIYPLVVSWFTDGRLAMRDNAAWLDGVRLPLQGYAAE-----
Q7N3F6_PHOLL          -GDQENEVVKRVQTQ-EHNIYPLVINWFIEGRLSMVNGKAYLDGKILPPEGYAAE-----
A0A1W6M605_VIBVL      -EDDAQSLAERVLTQ-EHSIYPLVVKWMAEERLVMQQGVAYLDGQPLGSAGYAAE-----
S5IMX5_VIBPH          -DDDAAALAARVQTQ-EHTIYPIVTKWLVEERLIMQDGKAWLDGKELGPHGYAAAEEE--
Q9KPY5_VIBCH          -DDTVEELTARVQDQ-EHRIYPLVVKWFVEERLAMKDGKAYLDGEALGIHGYAAE-----
Q5E3H2_ALIF1          -NDNAEDVASRVQAQ-EHVIYPMVANWLVEERLTMVDGKAILDGTELGLSGLETE-----
Q5QUP8_IDILO          -GDTVEEVQARVHEQ-EHRIYPLVVNWFCQERLKLQGGRVTLDGEVLGAQGYATE-----
E6XGN7_SHEP2          -DDTADMLAARVHEQ-EHAIYPLVVKWFSQQRLNMQNGQAYLDGNLIGPSGYAPD-----
Q8EDI7_SHEON          -DDTAEMLAARVHEQ-EHAIYPLVVKWFSHQRLNMQDGQAYLDGTLIGPSGYAPD-----
Q12ME9_SHEDO          -DDDAEQLALRVHEQ-EHAIYPLVVKWFSHGRLIMKDNKAYLDGQDVGPHGYAPD-----
Q83AY9_COXBU          -QDTPETLKTRVHAL-EHIIYPEVLSWFAAGRLNYHNNQVFLDGKPLAKSGHAFP-----
Q9I514_PSEAE          -QDTPERLARRVHEE-EHRIYPLAMRWFAEGRLRLGEQGALLDGQALPATGHQIRTKEIR
A5W7R8_PSEP1          -DDTVESLAQRVHHQ-EHLIYPLAVRWFAEGRLRLGEHGALLDGQPLAASGHLIRS----
F6AG77_PSEF1          -QDTAASLAQRVHAQ-EHRIYPLAVRWFAEGRLQLTDAGPQLDGVVLPATGYPINSKETP
PUR3_HAEIN            -EDSIEEVEARTREQ-EYQIYPLVIKWFTEGRLRLKDNLAYLDGKALPKSGYANE-----
A6VMA5_ACTSZ          -GDDIADIEARVKTQ-ELRIYPLAVKWFIDGRLQEIDGKAYLDGKLLPEKGYADE-----
Q5F7F4_NEIG1          -GDTADDVAARVLAV-EHKLYPKAVADVAAGRLIIEGNRVRNSENADAARFLTA------
A1KUZ0_NEIMF          -GDTADDVAARVLAV-EHKLYPKAVADFAAGRLIIEGNRVRNSENADAARFLTA------
Q9JYI9_NEIMB          -GDTADDIAARVLAV-EHKLYPKAVADFAAGRLIIEGNRVRNSENADAARFLTA------
I1XKF9_METNJ          -NDTEEALAARVLIE-EHKLYPDALRLLIQQN----------------------------
Q63WI1_BURPS          -GDDADALAARVLAA-EHTLYPRAVRWFVEGKLRLDAGRAIVAPDEARWLFADAIDTSTS
B7JBZ7_ACIF2          -EDDEQSLAARVLDA-EHRIYPQALAWLLAGRVAYAAGRAQWR-DPPETAMREAIAPSLE
Q5H3C3_XANOR          -GDNAEQLAARVLAR-EHPLLLATLQLLASGRVAVQGDTVHIDGQCLFTPLRLESADIAF
Q8PID7_XANAC          -GDSAEQLAARVLAR-EHPLLLATLEVLASGRVAVHGDTVLIDGQCLFTPLRLESANTAL
Q8P723_XANCP          -DDTAESLAARVLDR-EHPLLLATLRLLASGRVTTPDGRVHIDGQCLFTPLRLESAGIAL
B2I7G1_XYLF2          -NDTAETLAKRVLVR-EHPLLVATLELLANGRLTVDGPTPQLDTQYLFTPLRLDSQGTLT
Q215Q7_RHOPB          -DDDADSLAARVLSV-EHKIYPEALRLVASDAARLD-GDYCRLVTLQSCDDSLIVPPPH-
Q07LG6_RHOP5          -DDTADSLAARILTL-EHKIYPEALRLIATGAAALD-GEYCRTATAKLSDAVLIVPAR--
Q6N5C7_RHOPA          -DDTPDTLAARVLAV-EHRIYPEALRLLAAGLLRFD-GDLCRSATQSAPERTLIVPAAH-
Q89MR6_BRADU          -HDTADTLSERILEV-EHRIYPAALRLLATGKVQIE-GDVCKTAGSGPSENFLVSPVAS-
A9W4F2_METEP          -GDDADTLSARVIVQ-EHRLYPAALALIAGGGAALE-GGRVRFTTQARDAGAALLSL---
B0UKC5_METS4          -DDDADSLAARVLVQ-EHRLYPAAVALVAAGRARLD-GDRVAFAQGSAPPEGALLSLAS-
Q2RSC7_RHORT          -DDTADSLGARVLTR-EHQIYPLALRLLAEGKVRVE-GNRAIIDAAADDITLINPPLSA-
Q9A7M0_CAUVC          -GDDEPALAARVLEQ-EHRLYADTLATFCRGL----------------------------
Q3J516_RHOS4          -GDKAETLAARVLTR-EHALYPAVLRRFAAGDRTPL-LLD--------------------
Q8YGB8_BRUME          -GDTAETLAARVLKA-EHRLYPLALQKFAAGE-----------KASNQFSDGMVLSA---
A0A0H3G630_BRUSU      -GDTAETLAARVLKA-EHRLYPLALQKFAAGE-----------KASNQFSDGMVLSA---
Q7CZW4_AGRFC          -GDTAETLAARILTV-EHQLYPLTLKRLAEGKVRMEDGKAVSTDNESKSEYSSLISAF--
Q2KA46_RHIEC          -GDTAESLAARVLTV-EHQIYPQALRLFAEGRVTMEDGKAIGAEASAATPKAQLISLIGD
F7XMS4_METZD          -NDTVESLSERILEQ-EHVIYPEAVKLFVEGKLKVQGRIVLTRNYERPVK----------
Q8TK92_METAC          -EDTEETLTARILEQ-EHIIYPEAVRLFVESKLKVEGRNVITLK----------------
Q2FTJ6_METHJ          -DDDEETLADRILVE-EHQAYAEAIKLFFEKRLRIEGRRVRILPDS--------------
Q8F3W7_LEPIN          -GMTERDLTLEILKE-EHKILPLAVQYFCEDRLTIQNRKVKIG-----------------
B5YK81_THEYD          -DDTEDSLSERILKL-EHKIFPEAIRLFAEGRLKVEGRKVKILNYKLPDKYFTNPEIGQ-
Q74CB5_GEOSL          -DDDEASLSARIQRE-EHRAYPEAIRLFAAKRLRIEGRKVSILQGA--------------
O67023_AQUAE          -EDDENTLADRILKW-EHKILPQTVQWFAQDRIIIDGRKV-IVKDATYGTLPVNPALEIF
B8E0V4_DICTD          -DDTPATLAERILQE-EHKLIVESVKKILTEDFEIIGRRVVFKKRG--------------
A0RTU5_CENSY          -DDTEESLSKRILAR-EHKIYPYTVELFARGKIQVKGRRVCVG-----------------
A9A4N2_NITMS          -NDTEKSLSKRILKE-EHRIYPEAVNLFARKKIKVTDRRTKIS-----------------
Q1IM87_KORVE          -NDDDHTLAARILEQ-EHIAYSEAVRIVLSDSFKVVGRRVVATAQ---------------
Q3YRI0_EHRCJ          -SDTVTDLSNRILQM-EHICYPKAVKLIALNQVQLDENLTTSDESLQLFYSEAI------
B3CPV8_WOLPP          -NDDVHSLSERILAE-EHKCYVKAVRSIV--------------EGINY------------
Q7VBZ7_PROMA          -GDTEELLLKRIQSQ-EHKIISLGIAIAGQRLR---------------------------
A9BAE2_PROM4          -SDNENILLRRVQKR-EHKILYVGVAIAARLWRE--------------------------
Q8DGJ1_THEEB          -DDTPQTLHARIQVQ-EHRILKQAIADIAARQAQRS------------------------
Q55172_SYNY3          -DDTGETLHQRIQVQ-EHRLFPLAIA-LAAQQSP--------------------------
Q31PN1_SYNE7          -DDTVDSLQQRIQVE-EHKILPLAIALAAARSPLPV------------------------
Q7NKS6_GLOVI          -DDTPETLAVRIHAH-EYRILPEAVRLFAEGRVRVEGNRARIVIDEVEPTGFEEQL----
Q2RGU8_MOOTA          -DDTPETLAARILAE-EHRLYPRVIKWLAEGRVELRGRRVIVRI----------------
Q72E43_DESVH          -GEPLDDLKARIHAM-EHRIYPQALQWLAQGRLRVEGRCVHVAPPDSGVVPAAAGGAWLV
PUR3_MYCTU            -GDDEETLHERIKVT-ERRLLVAAVAALATH---GVTVVGRTATMGRKVTIG--------
PUR3_MYCTO            -GDDEETLHERIKVT-ERRLLVAAVAALATH---GVTVVGRTATMGRKVTIG--------
F6ERE0_HOYSD          -DDSESSLHERIKAV-ERRLLVEVVAALVTR---GVIIDGRKALIP--------------
Q8NS22_CORGL          -NDDESSLHERIKQV-ERKLIVEVLNSVEFSRQGGVQLNWRG------------------
Q9KY51_STRCO          YEDEGVALHERIKEV-ERRLLVDVVGRLARN---GYRIEGRKVVIQ--------------
C7QGV4_CATAD          -GDDVESLHERIKTA-ERALLVDVVGRLARQ---GWTIDNRKVTFQ--------------
A9WEW1_CHLAA          -DDTVESLHERIKAV-ERRLIVATVNRLLAGE----------------------------
Q83GZ2_TROWT          -SDTCQTLHSRIKKV-EHLLLCRAIKNIYTEQFILKNLLHNSVRRPSGKTGDR-------
G7V599_THELD          -YDTLETLEEKIHRV-EHYLYTEVLKDLFTNG-QSATRMRRDV-----------------
D1B9N8_THEAS          -GDTLESLEERVHRV-EHRLYPATIDRWLKEGDFSLASLRLRPW----------------
Q97CD0_THEVO          --DDAQSLEEKIHGI-EHSAIVEAISLLSNGHYKIEGKRVILNM----------------
E4T8V1_RIEAD          --DTADSIATKVHEI-EYKILPKAVNIVLNGLV---------------------------
A5N0Q1_CLOK5          --DTPEELQQRVLKE-EHKALPKVIKLISEDKVVVEGKRVKIYK----------------
A5I5W0_CLOBH          --DTAEILQKRVLEK-EHEALPEAIKLISEEKVKLQGRKVFIKTY---------------
Q97J92_CLOAB          --DTPDTLQKRVLEA-EHKLLPEAVKVLSEGKVQIEGRHVKVIK----------------
Q0SV49_CLOPS          --DTPESLQKKVLEK-EHILLPRIVKYLCEEKIEIHNGKVKILN----------------
D9RAC8_CLOSW          --DTPEVLQRRVMEEAEWLILPQAIQLIANGQEEPE------------------------
E6UD28_RUMA7          --ETPETLQKKIMENVEWKLLPKAVSLFCEDRITIRDGKAYIDL----------------
Q2JE89_FRACC          --ETVESLSERVLAA-EHILLPTVVQDLAVHAI---------------------------
Q9RSU6_DEIRA          --DTLDTLKARVQAE-EAALMLRAVQSLAARHG---------------------------
Q8TTV9_METAC          --DTIDTLSKRVLER-EHAFYVETLKLISEGVIKL-------------------------
B3QS63_CHLT3          --DTPESLAKAVLCI-EHQIYPTALQLLLKMIEEEESVSSESK-----------------
Q8KFK7_CHLTE          --DTPKTLAERVLRC-EHRLYPAALEKLLDKQP---------------------------
Q2S223_SALRD          --DTPEALANRVREV-EHRLYPEALRLFAAGRVHQDDRCIRIDAPDHPRRSPTDSE----
E6SW52_BACT6          --DTPDILAQRIHKL-EYEYYPRVIEELLNTID---------------------------
Q64ZV6_BACFR          --DTPADVAKKVHAL-EYEWFPKIIERVVNSL----------------------------
A6LFS5_PARD8          --DTPDEVAAKVHAL-EYAHYPHVIESLL-------------------------------
Q5NGF0_FRATT          --DTADSLKEKVQAL-ESKAWIEVIKNWDK------------------------------
PUR3_SCHPO            ---SIEALEEKIHAA-EHVILVQAIHQIITDNK---------------------------
L8G8V8_PSED2          ---TLEGLEGRIHEV-EHGIIVEGTRKASEELWEGREKEGGK------------------
PUR3_YEAST            ---TLEQYEQRVHDA-EHIAIVEATYKVLQQLHK--------------------------
PUR3_DICDI            ---TLESLEERFHQQ-EHKSLVESIKLLSTK-----------------------------
                                      *                                           

Q6HPA1_BACHK          --------
Q73EN2_BACC1          --------
Q81IQ0_BACCR          --------
A0A242Y8U5_BACTU      --------
Q8Y6C4_LISMO          --------
Q92AP2_LISIN          --------
PUR3_BACSU            --------
Q9KF54_BACHD          --------
B1HTV7_LYSSC          --------
PUR3_STAAR            --------
Q2FZI7_STAA8          --------
PUR3_STAAW            --------
PUR3_STAAN            --------
E6GHV8_ENTFL          --------
Q833Z2_ENTFA          --------
Q1G9G1_LACDA          --------
Q8DRM3_STRR6          --------
D5AF79_STRGZ          --------
H5T027_LACLL          --------
H9UKG3_SPIAZ          --------
Q9X0X5_THEMA          --------
A0A0H3PBG9_CAMJJ      --------
A0A0B6UZ56_CAMJU      --------
Q0PBV2_CAMJE          --------
A7GW50_CAMC5          --------
E6SMP0_THEM7          RG------
D7BF68_MEISD          --------
PUR3_ECOLI            --------
E3PFZ0_ECOH1          --------
Q32D68_SHIDS          --------
A0A0H2V9D8_ECOL6      --------
A0A0H3JJE1_ECO57      --------
H9L487_SALTY          --------
R4Y758_KLEPR          --------
A0A0H3HF70_KLEOK      --------
D2T6R4_ERWP6          --------
A0A384LGH9_YERPE      --------
Q7N3F6_PHOLL          --------
A0A1W6M605_VIBVL      --------
S5IMX5_VIBPH          --------
Q9KPY5_VIBCH          --------
Q5E3H2_ALIF1          --------
Q5QUP8_IDILO          --------
E6XGN7_SHEP2          --------
Q8EDI7_SHEON          --------
Q12ME9_SHEDO          --------
Q83AY9_COXBU          --------
Q9I514_PSEAE          NA------
A5W7R8_PSEP1          --------
F6AG77_PSEF1          CAAP----
PUR3_HAEIN            --------
A6VMA5_ACTSZ          --------
Q5F7F4_NEIG1          --------
A1KUZ0_NEIMF          --------
Q9JYI9_NEIMB          --------
I1XKF9_METNJ          --------
Q63WI1_BURPS          EGV-----
B7JBZ7_ACIF2          M-------
Q5H3C3_XANOR          A-------
Q8PID7_XANAC          A-------
Q8P723_XANCP          V-------
B2I7G1_XYLF2          R-------
Q215Q7_RHOPB          --------
Q07LG6_RHOP5          --------
Q6N5C7_RHOPA          --------
Q89MR6_BRADU          --------
A9W4F2_METEP          --------
B0UKC5_METS4          --------
Q2RSC7_RHORT          --------
Q9A7M0_CAUVC          --------
Q3J516_RHOS4          --------
Q8YGB8_BRUME          --------
A0A0H3G630_BRUSU      --------
Q7CZW4_AGRFC          --------
Q2KA46_RHIEC          LA------
F7XMS4_METZD          --------
Q8TK92_METAC          --------
Q2FTJ6_METHJ          --------
Q8F3W7_LEPIN          --------
B5YK81_THEYD          --------
Q74CB5_GEOSL          --------
O67023_AQUAE          --------
B8E0V4_DICTD          --------
A0RTU5_CENSY          --------
A9A4N2_NITMS          --------
Q1IM87_KORVE          --------
Q3YRI0_EHRCJ          --------
B3CPV8_WOLPP          --------
Q7VBZ7_PROMA          --------
A9BAE2_PROM4          --------
Q8DGJ1_THEEB          --------
Q55172_SYNY3          --------
Q31PN1_SYNE7          --------
Q7NKS6_GLOVI          --------
Q2RGU8_MOOTA          --------
Q72E43_DESVH          SPPLEPGF
PUR3_MYCTU            --------
PUR3_MYCTO            --------
F6ERE0_HOYSD          --------
Q8NS22_CORGL          --------
Q9KY51_STRCO          --------
C7QGV4_CATAD          --------
A9WEW1_CHLAA          --------
Q83GZ2_TROWT          --------
G7V599_THELD          --------
D1B9N8_THEAS          --------
Q97CD0_THEVO          --------
E4T8V1_RIEAD          --------
A5N0Q1_CLOK5          --------
A5I5W0_CLOBH          --------
Q97J92_CLOAB          --------
Q0SV49_CLOPS          --------
D9RAC8_CLOSW          --------
E6UD28_RUMA7          --------
Q2JE89_FRACC          --------
Q9RSU6_DEIRA          --------
Q8TTV9_METAC          --------
B3QS63_CHLT3          --------
Q8KFK7_CHLTE          --------
Q2S223_SALRD          --------
E6SW52_BACT6          --------
Q64ZV6_BACFR          --------
A6LFS5_PARD8          --------
Q5NGF0_FRATT          --------
PUR3_SCHPO            --------
L8G8V8_PSED2          --------
PUR3_YEAST            --------
PUR3_DICDI            --------