CLUSTAL format seed alignment for MF_01934

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E4PMJ8_MARAH          ------------------------------------------------------------
A0A0H2XNS1_BURCA      ------------------------------------------------------------
Q07U14_RHOP5          ------------------------------------------------------------
A1WQA3_VEREI          ------------------------------------------------------------
F8GQ70_CUPNN          ------------------------------------------------------------
C1B2K6_RHOOB          ------------------------------------------------------------
Q7MMF4_VIBVY          -----MRATMSIKSSLTLLLTSSVRLFIRFINDKHIRTMGTTMAKTVGITEAELYAPVNW
A0A0H3AIA0_VIBC3      ----------------------------------MITTMGTTMAKTTGISEQELYAPVIW
C4L9G1_TOLAT          --------------------------------------------MQHHDDDARWYAPVEW
Q31YJ5_SHIBS          ---------------------------------------------MIYPDEAMLYAPVEW
MENB_ECOLI            ---------------------------------------------MIYPDEAMLYAPVEW
MENB_SALTY            ---------------------------------------------MIYPDETMLYAPVEW
S5MSD8_SALBN          ---------------------------------------------MIYPDETMLYAPVEW
B5XNX2_KLEP3          ---------------------------------------------MISLDEAMLYAPVEW
A0A0E1NR86_YERPA      ---------------------------------------------MLYPSEEQLYAAIDW
C6CQP0_DICC1          ---------------------------------------------MLYPSEELLYAPVTW
E0SE00_DICD3          ---------------------------------------------MLYPSEELLYAPVAW
MENB_HAEIN            ---------------------------------------------MQNPKDDVLYAPVEW
A4MW60_HAEIF          ---------------------------------------------MQNPKDDVLYAPVEW
B3GZ76_ACTP7          ---------------------------------------------MLYPSEEFLYAPITW
I3DA90_HAEPH          ---------------------------------------------MLYPSEEFLYAPIEW
MENB_ARATH            MADSNELGSASRRLSVVTNHLIPIGFSPARADSVELCSASSMDDRFHKVHGEVPTHEVVW
Q31QP0_SYNE7          ------------------------------------------------------MAQVQW
A0A0H3K7S7_SYNP6      ------------------------------------------------MFRGNGVAQVQW
P73495_SYNY3          ---------------------------------------------------------MDW
Q2JNU9_SYNJB          ----------------------------------------------------------MW
Q7VBN9_PROMA          -----------------------------------------MDPIRSSRRVLPGDITVNW
I0AJ71_IGNAJ          -------------------------------------------------------MKYNW
A7Z810_BACVZ          -------------------------------------------------------MAAEW
A0A0H3E5D8_BACA1      -------------------------------------------------------MAAEW
MENB_BACSU            --------------------------------------------------------MAEW
MENB_STAAC            ------------------------------------------------------MTNRQW
MENB_STAAN            ------------------------------------------------------MTNRQW
MENB_STAAS            ------------------------------------------------------MTNRQW
MENB_STAHJ            -------------------------------------------------------MTRQW
MENB_STAEQ            -------------------------------------------------------MTRQW
MENB_STAES            -------------------------------------------------------MTRQW
MENB_STAS1            -------------------------------------------------------MTRQW
Q6HC28_BACHK          -------------------------------------------------------MAIEW
A2RM75_LACLM          ------------------------------------------------------MSKFNW
Q92AY7_LISIN          -------------------------------------------------------MSFNW
Q8Y6L1_LISMO          -------------------------------------------------------MSFNW
A5VJX6_LACRD          ------------------------------------------------------MTTVDW
D5T1J1_LEUKI          ------------------------------------------------------MTT--W
F0R1X9_PHOSB          -----------------------------------------------------ME-KREW
E1WRU4_BACF6          -----------------------------------------------------METKREW
Q6ARP4_DESPS          --------------------------------------------------------MREW
MENB_CYACA            ---------------------------------------------------------MQT
A3DAN8_SHEB5          ----------------------------------------------MTQQVSDIFDPTLW
A4YCE3_SHEPC          ----------------------------------------------MTQQVSDIFDPTLW
E1X4E5_HALMS          -------------------------------------------------MVSDIFNPELW
D0MH31_RHOM4          -------------------------------------------------MVSAIFDPDRW
G0TPQ8_MYCCP          -----------------------------------MVAPAGEQGRSSTALSDNPFDAKAW
MENB_MYCTU            -----------------------------------MVAPAGEQGRSSTALSDNPFDAKAW
MENB_MYCS2            --------------------------------------------MSSQAASDNPFDPAMW
A6W5P1_KINRD          --------------------------------------------MSALNGVSETFDPASW
F0M2Q2_PSEPM          ------------------------------------------MSKQIPAPVSDVFDPTRW
Q8NT47_CORGL          ---------------------------------------------MSNYSTDNPFDPTQW
D9QE70_CORP2          -----------------------------MEGAQVERLDSLIMDEQKTYSTDNPFDASQW
C7M2I0_ACIFD          --------------------------------------------MHQPDRPSPLFDPSLW
Q3IQY8_NATPD          -------------------------------------------------MVSELFDEDRW
Q6A9A6_CUTAK          --------------------------------------------MSTLPFVSDTFDAARW
                                                                                  

E4PMJ8_MARAH          -----------MTYEDILYDEN--------------NGVATITINRPDRYNAFRGQTCME
A0A0H2XNS1_BURCA      -----------MNYEDILYREA--------------GGVATITINRPSVYNAFRARTVDE
Q07U14_RHOP5          -----------MKFEDLIYEIR--------------NGVAWIIINRPDKMNAFRGTTCDE
A1WQA3_VEREI          -----------MDFEDILYAVR--------------NGVAWITINRPDKMNAFRGQTCDE
F8GQ70_CUPNN          -----------MQYEDILYEVR--------------NGAAWITINRPEKMNAFRGRTCDE
C1B2K6_RHOOB          ----------MTDYEDITYEVD--------------GAAAVVTINRPARYNAFRGKTVEE
Q7MMF4_VIBVY          NDC-------SAPYEDIQYHKSED-------------GIAKITIARPQVRNAFRPQTVKE
A0A0H3AIA0_VIBC3      QDC-------TGDYQDIHYHKSDD-------------GIAKITIARPQVRNAFRPLTVKE
C4L9G1_TOLAT          QDC-------SADYQDIRYHKSAD-------------GIAKITINRPQVRNAFRPLTVME
Q31YJ5_SHIBS          HDC-------SEGFEDIRYEKSTD-------------GIAKITINRPQVRNAFRPLTVKE
MENB_ECOLI            HDC-------SEGFEDIRYEKSTD-------------GIAKITINRPQVRNAFRPLTVKE
MENB_SALTY            HDC-------SEGYTDIRYEKSTD-------------GIAKITINRPQVRNAFRPLTVKE
S5MSD8_SALBN          NDC-------SEGYTDIRYEKSTD-------------GIAKITINRPQVRNAFRPLTVKE
B5XNX2_KLEP3          HDC-------SEGYTDIRYHKSAD-------------GIAKITINRPQVRNAFRPLTVKE
A0A0E1NR86_YERPA      LDC-------SAGFEDIRYHKSND-------------GIAKITINRPHVRNAFRPLTVKE
C6CQP0_DICC1          HDC-------SGDFVDILYHKSAD-------------GIAKITINRPQVRNAFRPQTVKE
E0SE00_DICD3          HDC-------SGDFVDILYHKSTD-------------GIAKITINRPQVRNAFRPQTVKE
MENB_HAEIN            IDH-------SEGYSDIRYHKSTD-------------GIAKITINRPEVRNAFRPQTVKE
A4MW60_HAEIF          VDH-------SEGYSDIRYHKSTD-------------GIAKITINRPEVRNAFRPQTVKE
B3GZ76_ACTP7          VDH-------SEGYTDIRYHKSTD-------------GIAKITINRPEVRNAFRPQTVKE
I3DA90_HAEPH          VDH-------SEGYTDIRYHKSTD-------------GIAKITINRPEVRNAFRPQTVKE
MENB_ARATH            KKTDFFGEGDNKEFVDIIYEKALDE------------GIAKITINRPERRNAFRPQTVKE
Q31QP0_SYNE7          QSV--------REYEDIRYEKC-----A--------EGIAKITINRPHKRNAFRPKTVVE
A0A0H3K7S7_SYNP6      QSV--------REYEDIRYEKC-----A--------EGIAKITINRPHKRNAFRPKTVVE
P73495_SYNY3          HIA--------KHYDDILYYK------A--------GGIAKIVINRPHKRNAFRPQTVFE
Q2JNU9_SYNJB          QTA--------KLYEDILYEK------T--------DGIAKITINRPHKRNAFRPKTIAE
Q7VBN9_PROMA          KTW--------GKYEDIFLDRS-----E--------EGIARVAINRPERRNAFRPLTVSE
I0AJ71_IGNAJ          KKV--------KDYQDIIYEKLE----G--------EGIARVTINRPEVRNAFRPETVKE
A7Z810_BACVZ          KSE--------RQYDEILYETY--------------NGIAKITINRPEVHNAFTPKTVSE
A0A0H3E5D8_BACA1      KSE--------RKYDEILYETY--------------NGIAKITINRPEVHNAFTPKTVSE
MENB_BACSU            KTK--------RTYDEILYETY--------------NGIAKITINRPEVHNAFTPKTVAE
MENB_STAAC            ETL--------REYDEIKYEFY--------------EGIAKVTINRPEVRNAFTPKTVAE
MENB_STAAN            ETL--------REYDEIKYEFY--------------EGIAKVTINRPEVRNAFTPKTVAE
MENB_STAAS            ETL--------REYDEIKYEFY--------------EGIAKVTINRPEVRNAFTPKTVSE
MENB_STAHJ            ETL--------REYDEIKYEFY--------------EGIAKVTINRPEVRNAFTPKTVAE
MENB_STAEQ            ETL--------REYDEIKYEFF--------------EGIAKVTINRPEVRNAFTPKTVAE
MENB_STAES            EIL--------REYDEIKYEFF--------------EGIAKVTINRPEVRNAFTPKTVAE
MENB_STAS1            ETI--------REYKEIKYELY--------------DGIAKVTINRPEVRNAFTPNTVQE
Q6HC28_BACHK          VKE--------GNYEDIIYSTY--------------NGIAKISINRPEVHNAFRPKTVME
A2RM75_LACLM          VALN-------RNYEDIIYETY--------------NGIAKITINRPEVRNAFRPKTVVE
Q92AY7_LISIN          QTE--------KVYEEIKYESY--------------EGIAKITINRPEVHNAFTPKTVTE
Q8Y6L1_LISMO          QTE--------KVYEEIKYESY--------------EGIAKITINRPEVHNAFTPKTVTE
A5VJX6_LACRD          QPV--------KDYSEIIFERA--------------GKIAKITMNRPEKMNAFTPVTIQE
D5T1J1_LEUKI          NAV--------KTYDEILFETNADGQNI--------GKIAKITMNDIATHNAFTPGMVSE
F0R1X9_PHOSB          KTI--------KEYKDILFDYY--------------NGIAKITINRPRYRNAFTPDTTME
E1WRU4_BACF6          TPI--------KEYEDILFDYY--------------NGIARITINRERYRNAFTPTTTGE
Q6ARP4_DESPS          KTI--------KEYEEIKFEIF--------------NGIAKITINRPRYYNAFTPDTNKE
MENB_CYACA            IAI--------KDFIDIKYIKQ--------------DQISEIIISRPQVLNAFRPRTINE
A3DAN8_SHEB5          DEVSGFQ------FDDITYHRAKAHG------------TVRIAINRPECRNAFRPKTVDE
A4YCE3_SHEPC          DEVSGFN------FDDITYHRAKAHG------------TVRIAINRPECLNAFRPKTVDE
E1X4E5_HALMS          NEVPNFN------FKDITYHRAKDQG------------TVRIAFNRPEVRNAFRPQTVDE
D0MH31_RHOM4          VEVEGFQ------FEDITYHRAKDQG------------TVRIAFNRPEVLNAFRPKTVDE
G0TPQ8_MYCCP          RLVDGFDD-----LTDITYHRHVDDA------------TVRVAFNRPEVRNAFRPHTVDE
MENB_MYCTU            RLVDGFDD-----LTDITYHRHVDDA------------TVRVAFNRPEVRNAFRPHTVDE
MENB_MYCS2            ERVPGFDD-----LTDITYHRHVLDGAR--Q------PTVRVAFDRPEVRNAFRPHTVDE
A6W5P1_KINRD          AEVPGFED-----LQDVTYHRSVVDGPA--R------GTVRIAFDRPEVRNAFRPGTVDE
F0M2Q2_PSEPM          RTVAGFED-----FQDMTYHRQVERDSD--GGWVRDLPTVRIAFNRPEVRNAFRPGTVDE
Q8NT47_CORGL          ATVPGFEE-----FTDITYHRHVGTTRA--D------GIVRIAFDRPEVRNAFRPHTVDE
D9QE70_CORP2          ETVAGFQD-----LTDITYHRHVGEGRE--N------GIVRIAFDRPEVRNAFRPHTVDE
C7M2I0_ACIFD          EPVEGFD------ATDITYHRAREGG------------FVRIAFNRPEVRNAFRPRTVDE
Q3IQY8_NATPD          EPI--TDD-----FEDITYHRSTETG------------AVRIAFDRPEVRNAFRPETVDE
Q6A9A6_CUTAK          RDVDLPGAP----LTDMTFHRLVSRGKSDHAPAGEDLPVVRIAFDRPAIRNAFRPHTVDE
                                     ::                        : :      ***      *

E4PMJ8_MARAH          LLDAFNRAGWNKDIGVIVFTGAGE------KAFCTGGDQGAH--EGQYDG--RGLIG---
A0A0H2XNS1_BURCA      LLHAFQQAGWNREIGVIVLTGAGE------KAFCTGGDQTSHG-DGGYGG--RGAIG---
Q07U14_RHOP5          LIKALYKAGYDKDVGAIVLAGAGD------RAFCTGGDQSTH--DGNYDG--RGTVG---
A1WQA3_VEREI          LIAALNKAGYDREVGAIVLAGAGD------RAFCTGGDQSAH--SGNYDG--RGTIG---
F8GQ70_CUPNN          LIHAINRAGYDREIGAIVLAGAGD------KAFSTGGDQSAH--EGQYDG--RGTIG---
C1B2K6_RHOOB          LIKAFRSAWADDAVQAIILTGAGE------KAFCTGGDVKQRAETGDYGP--TESGM---
Q7MMF4_VIBVY          MIQALADARYDSNVGVIILTGLGE------DAFCSGGDQKIRGDYGGYKD-DSGVHH---
A0A0H3AIA0_VIBC3      MIHALADARYDDKVGVIILTGLGE------DAFCSGGDQKIRGDYGGYRD-DSGTHH---
C4L9G1_TOLAT          MMKALQDARFDASIGVIILTGEGE------LAFCSGGDQKVRGDYGGYKD-DEGTHH---
Q31YJ5_SHIBS          MIQALADARYDDNVGVIILTGAGD------KAFCSGGDQKVRGDYGGYKD-DSGVHH---
MENB_ECOLI            MIQALADARYDDNIGVIILTGAGD------KAFCSGGDQKVRGDYGGYKD-DSGVHH---
MENB_SALTY            MIQALADARYDDNVGVIILTGEGD------KAFCAGGDQKVRGDYGGYQD-DSGVHH---
S5MSD8_SALBN          MIQALADARYDDNVGVIILTGEGE------KAFCAGGDQKVRGDYGGYQD-DSGVHH---
B5XNX2_KLEP3          MIQALADARYDDNIGVIVLTGEGE------KAFCAGGDQKVRGDYGGYQD-DSGVHH---
A0A0E1NR86_YERPA      MIQALADARYDDNIGVIILTGEGD------KAFCSGGDQKVRGDYGGYQD-NSGVHH---
C6CQP0_DICC1          MIQALDNARHDDGIGVIILTGAGE------KAFCSGGDQKVRGDYGGYQD-DSGVHH---
E0SE00_DICD3          MIQALDNARHDDGIGVIILTGAGE------KAFCSGGDQKVRGDYGGYKD-DSGVHH---
MENB_HAEIN            MMTAFSDARFDENIGVIVLTGEGE------KAFCSGGDQKVRGDYGGYKD-DSGVHH---
A4MW60_HAEIF          MITAFSDARFDENIGVIVLTGEGE------KAFCSGGDQKVRGDYGGYKD-DSGVHH---
B3GZ76_ACTP7          MIHAFADARFDEKIGVIVLTGEGE------YAFCAGGDQKIRGDYGGYKD-DSGVHH---
I3DA90_HAEPH          MIHAFADARFDEKIGVIVLTGEGE------YAFCAGGDQKIRGDYGGYKD-DSGVHH---
MENB_ARATH            LMRAFNDARDDSSVGVIILTGKGT------KAFCSGGDQALRTQ-DGYAD-PNDVGR---
Q31QP0_SYNE7          LYDAFCDAREDIAIGVILLTGAGPHT-DGRYAFCAGGDQSVRGA-GGYID-EEGLPR---
A0A0H3K7S7_SYNP6      LYDAFCDAREDIAIGVILLTGAGPHT-DGRYAFCAGGDQSVRGA-GGYID-EEGLPR---
P73495_SYNY3          LYDAFCNAREDNRIGVVLLTGAGPHS-DGKYAFCSGGDQSVRGE-GGYID-DQGTPR---
Q2JNU9_SYNJB          LIDAFADVREDPRIGVVLLTGAGPHT-DGKYAFCAGGDQSVRGE-AGYLD-EAGIPR---
Q7VBN9_PROMA          LCDAFIKIRDDTSIGVVLFTGVSPAK-DGVFSFCAGGDQSVRGE-GGYLD-EEGLPR---
I0AJ71_IGNAJ          MIDAFNDAREDQTIGVILLTGAGPAK-DGKYAFCSGGDQRIRGD-KGYIGSDDKVPR---
A7Z810_BACVZ          MIDAFARARDDSNIGVIVLAGAGD------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
A0A0H3E5D8_BACA1      MIDAFAYARDDSNIGVIVLAGAGD------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
MENB_BACSU            MIDAFADARDDQNVGVIVLAGAGD------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
MENB_STAAC            MIDAFSRARDDQNVSVIVLTGEGD------LAFCSGGDQKKRGH-GGYVG-EDQIPR---
MENB_STAAN            MIDAFSRARDDQNVSVIVLTGEGD------LAFCSGGDQKKRGH-GGYVG-EDQIPR---
MENB_STAAS            MIDAFSRARDDQNVSVIVLTGEGD------LAFCSGGDQKKRGH-GGYVG-EDQIPR---
MENB_STAHJ            MIDAFSRARDDQNISVIILTGEGD------KAFCSGGDQKKRGH-GGYVG-EDQIPR---
MENB_STAEQ            MIDAFSRARDDQNVSVIVLTGEGD------KAFCSGGDQKKRGH-GGYVG-EDDIPR---
MENB_STAES            MIDAFSRARDDQNVSVIVLTGEGD------KAFCSGGDQKKRGH-GGYVG-EDDIPR---
MENB_STAS1            MIDAFTRARDDQRISVIILTGEGD------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
Q6HC28_BACHK          LIDAFAHARDDANVGVIILTGEGG------RAFCSGGDQKVRGH-GGYVG-DDQIPR---
A2RM75_LACLM          MIDAFSIARDDTNVGVIILTGANHGKGEDKEAFCSGGDQKVRGN-GGYVG-EDQIPR---
Q92AY7_LISIN          MIDAFNLARDNSDLGVIILTGEGE------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
Q8Y6L1_LISMO          MIDAFNLARDNSNLGVIILTGEGE------KAFCSGGDQKVRGH-GGYVG-DDQIPR---
A5VJX6_LACRD          MIDAFTICRDDSTIGVIILTGAGD------KAFSSGGDQGVRGN-GGYVG-PDKIAR---
D5T1J1_LEUKI          MIDAFTIARDDATIGVIIMTGAGD------QAFSSGGNQKVRGN-GGYVG-SDGIPR---
F0R1X9_PHOSB          LSNALLYCRECPDINVIVLTGAGD------KAFCSGGDMHVKGH-GGYVG-TDGVPR---
E1WRU4_BACF6          MSDAMRICREEPDINVVVLTGAGD------KAFCSGGDQNVKGR-GGYIG-KDGVPR---
Q6ARP4_DESPS          MLEAMVYCRECQDVRVVIFTGAGD------KAFCAGGDQNVKST-GGYIG-KDGVPR---
MENB_CYACA            IIAAFYDSREDSSIGVVILSGHGS------RAFCVGGDQKIRSK-TGYID-EKGRSS---
A3DAN8_SHEB5          LFIALDHARQWSDVGCVLLTGNGPSAKDGGWAFCSGGDQRIRGK-DGYKYEGAEEGK---
A4YCE3_SHEPC          LYIALDHARQWSDVGCVLLTGNGPSAK-GQYSFSSGGDQRIRGK-DGYKYEGAEEGK---
E1X4E5_HALMS          LYQALDHARMSSDVGCVLITGNGPSPKDGGWAFCSGGDQRIRGK-DGYQYVGDE-GE---
D0MH31_RHOM4          LYQALDHARQTPDVGVVLLTGNGPSKKHGKWAFSAGGDQRVRGP-SGYQYEEGDDSP---
G0TPQ8_MYCCP          LYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGR-SGYQYASGDTAD---
MENB_MYCTU            LYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGR-SGYQYASGDTAD---
MENB_MYCS2            LYRVLDHARMSSDVGVILLTGNGPSPKDGGWAFCSGGDQRIRGR-TGYQYASGETAE---
A6W5P1_KINRD          LARALDHARRTPDVGCVLLTGNGPSPKDGGWAFCSGGDQRIRGR-SGYQYAEGDTAE---
F0M2Q2_PSEPM          LYRAMDHARMSPDVATVLLTGNGPSPKDGGHSFCSGGDQRIRGR-DGYKYADGETQE---
Q8NT47_CORGL          LYQALDHARRTPDVGTILLTGNGPSEKDGGWAFCSGGDQRIRGR-SGYQYATEHARDDAT
D9QE70_CORP2          LYRALDHARRTPDVGTVLLTGNGPSEKDGGWAFCSGGDQRIRGR-SGYRYATEHAHDDAT
C7M2I0_ACIFD          LARALEDATLRDDVGCVLLTGNGPSPTDGGWAFCSGGDQRVRGA-EGYEYHDTEHAH---
Q3IQY8_NATPD          LYTALDHAKRQTDIGCVLLTGNGPSPKDDGWAFCSGGDQRIRGE-AGYEYEDTPDAE---
Q6A9A6_CUTAK          LYRCIDAARCTPDVAALILTGNGPSPRDGGYAFCSGGDQRIRGA-AGYQYESQETSGDED
                      :   :        :  ::::* .        :*. **:   :     *            

E4PMJ8_MARAH          -----------------LPVEELQRTIREVPKPVIARVNGFAIGGGHVLHVICDLSIAS-
A0A0H2XNS1_BURCA      -----------------LPVDELQSLIRDVPKPVIARVNGYAIGGGNVLVTVCDLAIAS-
Q07U14_RHOP5          -----------------LPMEELHTAIRDVPKPVIARVQGFAIGGGNVLATICDLTICS-
A1WQA3_VEREI          -----------------LPMEELHSAIRDVPKPVIARVQGYAIGGGNVLATICDLTICS-
F8GQ70_CUPNN          -----------------LPMEELHNAIRDVPKPVIARVQGFAIGGGNVLCTICDFTIAS-
C1B2K6_RHOOB          -----------------FEIGNLHKLIRDVPKPVIAAVNGIAVGGGHVLHVLCDLTIAS-
Q7MMF4_VIBVY          -----------------LNVLDFQRDIRTCPKPVIASVAGWAVGGGHVLHMMCDLTIAA-
A0A0H3AIA0_VIBC3      -----------------LNVLDFQRQIRTCPKPVIAAVAGWAVGGGHVLHMMCDLTIAA-
C4L9G1_TOLAT          -----------------LNVLDFQRQIRTCPKPIVAMVAGYAIGGGHVLHMLCDLTIAA-
Q31YJ5_SHIBS          -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
MENB_ECOLI            -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
MENB_SALTY            -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
S5MSD8_SALBN          -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
B5XNX2_KLEP3          -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
A0A0E1NR86_YERPA      -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTVAA-
C6CQP0_DICC1          -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
E0SE00_DICD3          -----------------LNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAA-
MENB_HAEIN            -----------------LNVLDFQRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAA-
A4MW60_HAEIF          -----------------LNVLDFQRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAA-
B3GZ76_ACTP7          -----------------LNVLQFQRDIRTCPKPVVAMVAGYAVGGGHVLHMMCDLTIAA-
I3DA90_HAEPH          -----------------LNVLQFQRDIRTCPKPVVAMVAGYAVGGGHVLHMMCDLTIAA-
MENB_ARATH            -----------------LNVLDLQVQIRRLPKPVIAMVAGYAVGGGHILHMVCDLTIAA-
Q31QP0_SYNE7          -----------------LNVLDLQRLIRTIPKVVIALVAGYAIGGGHVLHILCDLTIAA-
A0A0H3K7S7_SYNP6      -----------------LNVLDLQRLIRTIPKVVIALVAGYAIGGGHVLHILCDLTIAA-
P73495_SYNY3          -----------------LNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAA-
Q2JNU9_SYNJB          -----------------LNVLDLQRIIRSLPKVVIALVAGYAIGGGHVLHLICDLTIAA-
Q7VBN9_PROMA          -----------------LNVLDLQRLIRSIPKVVIALVSGYAIGGGQVLHLLCDLSLAA-
I0AJ71_IGNAJ          -----------------LNVLDLQKIIRSIPKVVIAVVAGYAIGGGHVLHVVCDLTIAA-
A7Z810_BACVZ          -----------------LNVLDLQRLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAA-
A0A0H3E5D8_BACA1      -----------------LNVLDLQRLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAA-
MENB_BACSU            -----------------LNVLDLQRLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAA-
MENB_STAAC            -----------------LNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAA-
MENB_STAAN            -----------------LNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAA-
MENB_STAAS            -----------------LNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAA-
MENB_STAHJ            -----------------LNVLDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAA-
MENB_STAEQ            -----------------LNVLDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAA-
MENB_STAES            -----------------LNVLDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAA-
MENB_STAS1            -----------------LNVLDLQRLIRVIPKPVVAMVRGYAIGGGNVLNVVCDLTIAA-
Q6HC28_BACHK          -----------------LNVLDLQRLIRAIPKPVIAMVAGYAIGGGHVLHIVCDLTIAA-
A2RM75_LACLM          -----------------LNVLDLQHLIRITPKPVIAMVNGFAIGGGHVLHIVCDLTIAS-
Q92AY7_LISIN          -----------------LNVLDLQRLIRVIPKPVIAMVAGWSIGGGNVLQLVCDLTIAA-
Q8Y6L1_LISMO          -----------------LNVLDLQRLIRVIPKPVIAMVAGWSIGGGNVLQLVCDLTIAA-
A5VJX6_LACRD          -----------------LNVLDLQHLIRIIPKPVIAMVKGWSVGGGNILQLVCDLTIAA-
D5T1J1_LEUKI          -----------------LNVLDLQRLMRIIPKPIIAMVKGWSVGGGNVLQLVADLTVAA-
F0R1X9_PHOSB          -----------------LNILDVQKQIRSIPKPVIAMVNGYAIGGGHVLHVVCDLSIAS-
E1WRU4_BACF6          -----------------LSVLDVQKQIRSIPKPVIAAVNGFAIGGGHVLHVVCDLSIAS-
Q6ARP4_DESPS          -----------------LNVLDLQKAIRSLPKPVIAMVNGFAIGGGHVLHVVCDLTIAS-
MENB_CYACA            -----------------LNVLELQRIIRTFPKPVIAKVSGYAVGGGQILNMMCDLTIAS-
A3DAN8_SHEB5          -----ADQARM----GRLHILEVQRLIRFMPKVVIAVVPGWAVGGGHSLHVVCDLTLASK
A4YCE3_SHEPC          -----ADQARM----GRLHILEVQRLIRFMPKVVIAVVPGWAVGGGHSLHVVCDLTLASK
E1X4E5_HALMS          -----KDPAKL----GRLHILEVQRLIRFMPKVVIAVVPGWSVGGGHSLHVVCDMTIASE
D0MH31_RHOM4          -----AAKARM----GRLHILEVQRLIRFMPKVVIAVVSGWAVGGGHSLHVVCDLTIASR
G0TPQ8_MYCCP          ----TVDVARA----GRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASR
MENB_MYCTU            ----TVDVARA----GRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASR
MENB_MYCS2            ----TVDPARA----GRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVTCDLTLASR
A6W5P1_KINRD          ----TVDAVRAKAEGGRLHVLEVQRLIRFMPKVVIAVVPGWAAGGGHSLHVVADLTIASA
F0M2Q2_PSEPM          ----TIDPARA----GRLHILEVQRLMRTMPKVVIAVVNGWAAGGGHSLHVVADLTIASR
Q8NT47_CORGL          ADVSTVDIARTKVEGGRLHILEVQRLIRTMPKVVIAVVNGWAAGGGHSLHVVCDLTIASR
D9QE70_CORP2          ADESTVDTAREKVEGGRLHILEVQRLIRTMPKVVIAVVNGWAAGGGHSLHVVCDMTIASR
C7M2I0_ACIFD          ---------------GRLHILEVQRRIRTMPKVVIAVVPGWAVGGGHSLHVVADLTIASR
Q3IQY8_NATPD          -------QQDA----PRLHILEVQRLIRHIPKPVIAVVPGWAVGGGHSLHVVCDMTLASE
Q6A9A6_CUTAK          LATDARREHIEKGRLGRLHILEVQRLMRATPKPIIAAIPGWTTGGGHSLMVVADMAVASR
                                       : : :.:  :*  ** ::. : * : ***: *   .*:::.: 

E4PMJ8_MARAH          ETAIFGQVGPKVGSVDPGFGTAYLARVVGEKRAREIWYLCRKYSAQQALEWGLVNAVVPP
A0A0H2XNS1_BURCA      EAAQLGQVGPRVGSVDPGFGTALLARVLGEKRAREVWFLCRRYTAREALAMGWLNAVVPA
Q07U14_RHOP5          EKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCRRYSGKEAEAMGLANLCVPH
A1WQA3_VEREI          DKAQFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYLNRRYGGAEAVAMGLANFCFPH
F8GQ70_CUPNN          EKAVFGQVGPKVGSVDPGYGTAFLARVVGEKKAREIWYLCRRYPAAEALAMGLVNAVVPH
C1B2K6_RHOOB          ETAKFGQAGPRVGSFDAGFGSAFLARVVGEKRAREIWYLCRQYDAATAERWGLVNWVVPA
Q7MMF4_VIBVY          ENAQFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRFYDAQEALDMGLVNTVVPI
A0A0H3AIA0_VIBC3      ENAQFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRFYNAQEALDMGLVNTVVPV
C4L9G1_TOLAT          DNARFGQTGPKVGSFDGGWGASYMARLVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPL
Q31YJ5_SHIBS          DNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPL
MENB_ECOLI            DNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPL
MENB_SALTY            ENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPL
S5MSD8_SALBN          ENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPL
B5XNX2_KLEP3          DNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPL
A0A0E1NR86_YERPA      DNAIFGQTGPKVGSFDGGWGAAYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPL
C6CQP0_DICC1          ENAIFGQTGPRVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPL
E0SE00_DICD3          ENAIFGQTGPRVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPV
MENB_HAEIN            ENAIFGQTGPKVGSFDGGWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPY
A4MW60_HAEIF          ENAIFGQTGPKVGSFDGGWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPY
B3GZ76_ACTP7          DNAKFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRMYDAQEALNMGLVNTVVPY
I3DA90_HAEPH          DNAKFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRMYDAKQALDMGLVNTVVPY
MENB_ARATH            DNAIFGQTGPKVGSFDAGYGSSIMSRLVGPKKAREMWFMTRFYTASEAEKMGLINTVVPL
Q31QP0_SYNE7          DNAVFGQTGPKVGSFDGGFGASYLARLVGQKKAREIWFLCRQYGAKEALQMGLVNTVVPV
A0A0H3K7S7_SYNP6      DNAVFGQTGPKVGSFDGGFGASYLARLVGQKKAREIWFLCRQYGAKEALQMGLVNTVVPV
P73495_SYNY3          DNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPV
Q2JNU9_SYNJB          DNAIFGQTGPRVGSFDGGFGAAYLARVVGQKKAREIWFLCRQYTAAQALEMGLVNAVVPV
Q7VBN9_PROMA          DNAVFGQTGPRVGSFDAGFGAGYLARVVGQRKAREIWFLCRKYGAQEALHFGLINSITPV
I0AJ71_IGNAJ          DNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYNAQQAFEMGLVNTVVPI
A7Z810_BACVZ          DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
A0A0H3E5D8_BACA1      DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQDALEMGLVNTVVPL
MENB_BACSU            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAAC            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAAN            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAAS            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAHJ            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAEQ            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAES            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
MENB_STAS1            DNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
Q6HC28_BACHK          DNAVFGQTGPKVGSFDGGYGAGYLARMVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPL
A2RM75_LACLM          ENAKFGQTGPRVGSFDAGYGAGLLAAMVGQKKAREIWFLCRQYTAKEAMDMGMVNTVVPF
Q92AY7_LISIN          DNAKFGQTGPNVGSFDAGYGSGYLARVIGHKKAKEVWFMCRQYTADEALEMGWINTVVPV
Q8Y6L1_LISMO          DNAKFGQTGPNVGSFDAGYGSGYLARVIGHKKAKEVWFMCRQYTADEALEMGWINTVVPV
A5VJX6_LACRD          DNAKFGQTGPKVGSFDAGYGSGYLARVIGHKRAKEVWFLNHFYSAEEAYQMNWINKVVPL
D5T1J1_LEUKI          DNAKFGQTGPMVGSFDAGYGSGYLARVIGHKRAKEVWFLNHFYTAEEAYQMNWINKVVPL
F0R1X9_PHOSB          ENAIFGQTGPRVGSFDAGFGASYLARVVGQKKAREIWFLCRQYSAQEALEMGLVNKVVPF
E1WRU4_BACF6          ENAIFGQTGPRVGSFDAGFGSSYLARVVGQKKAREIWFLCRKYNAQEALDMGLVNKVVPL
Q6ARP4_DESPS          ENAKFGQTGPKVGSFDAGFGSSYLARQVGQKKAREIWFLCDQYSAQEAMDMGMVNKVVPL
MENB_CYACA            ENAVLGQSGPKVGSFDAGYGSAYMARIIGQKKARELWFTCYQYDAFEAYKMGLVNWVVKI
A3DAN8_SHEB5          EHAIFKQTDPDVASFDSGYGSAYLAKMIGQKRAREIFFCGFNYSADEAFDMGMVNKSVPH
A4YCE3_SHEPC          EHAIFKQTDPDVASFDSGYGSAYLAKMIGQKRAREIFFCGFNYSADEAFAMGMVNKSVPH
E1X4E5_HALMS          EHAVFKQTDPDVASFDSGYGSAYLARQCGQKRAREIFFLGLNYSAKEAFDMGMINKVVPH
D0MH31_RHOM4          EHALFKQTDPDVASFDGGFGSAYLARMVGQKRAREIFFLGRTYTAEEAYQMGMVNAVVPH
G0TPQ8_MYCCP          EYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEH
MENB_MYCTU            EYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEH
MENB_MYCS2            EHARFKQTDADVGSFDGGFGSAYLARQTGQKFAREIFFLGRAYDAQTMHQMGAVNEVVDH
A6W5P1_KINRD          EHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRPYTAQQAHEMGMVNAVVPH
F0M2Q2_PSEPM          QHGKFKQTDATVGSFDAGYGSALLARQIGQKAAREIFFLAREYSAEDMVRMGAVNEAVDH
Q8NT47_CORGL          QEARFKQTDADVGSFDAGYGSAYLAKMVGQKNAREIFFLGRTYDAERMQQMGAVNIVADH
D9QE70_CORP2          QEARFKQTDADVGSFDAGYGSAYLAKMVGQKFAREIFFLGRTYDAETMQRMGAVNIVADH
C7M2I0_ACIFD          QHARFMQTDTRVASVDGAYGSAYLARLVGQKRAREIFFLGFDYSAEEAYAMGMVNAVVDH
Q3IQY8_NATPD          AHAKFLQTDPDVASFDAGFGSAYLARQIGHKKAREVFFLGKTYSADEAVEMGMANEAVPH
Q6A9A6_CUTAK          EYARFKQVDANVGSFDAGYGSALLARQIGDKRAREIFFLAETYDAEQAEKWGVINQAVDH
                        . : * .. :.*.* .:*:. ::   * : *:*:::    * .      .  *     

E4PMJ8_MARAH          EQLDEEVQKWCEEILEKSPTAISIAKRSFNADSDNIAGIGALGMQALSLYYDTDESKEGV
A0A0H2XNS1_BURCA      DQLDGEVARWCDEILALSPTALAIAKRSFNADSENIRAIGALGFEALSLYYDTDESKEGT
Q07U14_RHOP5          EELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTDESREGV
A1WQA3_VEREI          AELDAEVQKIGEELCERSPTALAIAKRSFNADTAHQAGIAGLGMYALKLYYDTQESREGA
F8GQ70_CUPNN          DQLDAEVQKWCDEILDKSPTAIAIAKRSFNMDTAHQGGIAGMGMYALKLYYDTEESREGV
C1B2K6_RHOOB          DRLLDEAKAVAAEIAEKSPTALRFLKQSFNADTDHQAGLSNLAMSALDLFTHSPEGLEGA
Q7MMF4_VIBVY          DDLEKETVRWCREVLQHSPMALRCLKAALNADCDGQAGLQELAGNATMMFYMTDEGQEGR
A0A0H3AIA0_VIBC3      EELERETVRWCREVLQHSPMAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
C4L9G1_TOLAT          AELEKETVRWCREILQHSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
Q31YJ5_SHIBS          ADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
MENB_ECOLI            ADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
MENB_SALTY            ADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
S5MSD8_SALBN          ADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
B5XNX2_KLEP3          AELEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
A0A0E1NR86_YERPA      ADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTDEGQEGR
C6CQP0_DICC1          AELERETVRWCREMLQNSPMALRCLKAALNADCDGQSGLQELAGNATMLFYMTEEGQEGR
E0SE00_DICD3          AQLERETVRWCREMLQNSPMALRCLKAALNADCDGQSGLQELAGNATMLFYMTEEGQEGR
MENB_HAEIN            ADLEKETVRWCREMLRNSPIAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
A4MW60_HAEIF          ADLEKETVRWCREMLRNSPIAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
B3GZ76_ACTP7          ADLEKETVRWCREMLQNSPIALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
I3DA90_HAEPH          ADLEKETVRWCREMLQNSPIALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGR
MENB_ARATH            EDLEKETVKWCREILRNSPTAIRVLKAALNAVDDGHAGLQGLGGDATLLFYGTEEATEGR
Q31QP0_SYNE7          EELEAEGIRWALEILEKSPIAIRCLKAAFNAELDGMAGIQELAGHATHLYYLTEEGSEGK
A0A0H3K7S7_SYNP6      EELEAEGIRWALEILEKSPIAIRCLKAAFNAELDGMAGIQELAGHATHLYYLTEEGSEGK
P73495_SYNY3          DRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGK
Q2JNU9_SYNJB          EELEAEGIRWAQEILQHSPLAIRCLKAAFNADCDGQVGLQELAGDATLLFYMTEEAAEGK
Q7VBN9_PROMA          EQLEAEGVKWAKEILENSPTAIRCMKAAFNAETDGLAGIQELAGQATHLFYRTTEAKEGK
I0AJ71_IGNAJ          DKLEDESVQWAREIMQHSPMAIRVLKSAFNAELDGQAGIQELAGNATLLYYMSEEAQEGK
A7Z810_BACVZ          EKLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGR
A0A0H3E5D8_BACA1      EKLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGR
MENB_BACSU            EQLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGR
MENB_STAAC            EKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAAN            DKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAAS            EKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAHJ            DQIEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAEQ            EQVEDETVKWCKDIMQHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAES            EQVEDETVKWCKDIMQHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
MENB_STAS1            DQVEDETVQWCQEMKQHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGR
Q6HC28_BACHK          EELEAETVQWAQEILANSPMALRFLKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGR
A2RM75_LACLM          DRLEEETVQWAEEMLALSPMALRMLKGSMNAATDGLAGLQQFAGDATLMFYTTDEAKEGR
Q92AY7_LISIN          ADLEKETVAWAKEMLQKSPTALRFIKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGR
Q8Y6L1_LISMO          ADLEKETVAWAKEMLQKSPTALRFIKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGR
A5VJX6_LACRD          DQVESVTLDWCNEILKKSPTALRFIKAAMNADTDGLAGLQQLGGDATMLFYTTDEGKEGR
D5T1J1_LEUKI          AEVEAATIEWADELLTKSPTALRFIKAAMNADTDGLAGLQQFAGDATMMYYTTDEAKEGR
F0R1X9_PHOSB          DRLEDEVVEWAETMMQHSPLALRMIKAGLNAELDGQAGIQELAGDATMLYYMTDEAQEGG
E1WRU4_BACF6          DKLEDEYVQWAEEMMQLSPLALRMIKAGLNAELDGQAGIQELAGDATLLYYLTDEAQEGK
Q6ARP4_DESPS          EQLEDTTVEWCEKIIKRSPMALRMIKAGLNAELDGQAGIQELAGNATMMFYMMEEAQEGK
MENB_CYACA            EDLDSYAIKLATDILNKSPLAIRFLKSSLNADCDGQSGLQELAGYSTMLFYMSAEGQEGH
A3DAN8_SHEB5          AELETEALMWAKEINSKSPTAMRMLKYGFNMTDDGMVGQQLFAGEATRLAYASAEAQEGR
A4YCE3_SHEPC          AELETEALMWAKEINSKSPTAMRMLKYGFNMTDDGMVGQQLFAGEATRLAYASAEAQEGR
E1X4E5_HALMS          AQLEDVALEWGKLINSKSPTAMRMLKFGFNLLDDGLVGQQLFAGEATRLAYGTDEAKEGR
D0MH31_RHOM4          EKLEEVALEWAAEINRKSPTAIRMLKYAFNLIDDGLIGQQLFAGEATRLAYMTEEAREGR
G0TPQ8_MYCCP          AELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGR
MENB_MYCTU            AELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGR
MENB_MYCS2            ADLEKAGLQYAAEINGKSPQAIRMLKFAFNLIDDGLVGQQVFAGEATRLAYMTDEAVEGR
A6W5P1_KINRD          AELEATALQWSAEINGKSPTAQRMLKFAFNALDDGMVGQQVFAGEATRLAYMTDEAVEGR
F0M2Q2_PSEPM          ERLEEVALEYAADIARQSPQAIRMLKFAFNLADDGLAGQQVFAGEATRLAYMTDEAVEGK
Q8NT47_CORGL          GDLEKEAIQAAREINTKSPTAQRMLKFAFNLTDDGLMGQQVFAGEATRLAYMTDEAVEGK
D9QE70_CORP2          KNLEDEAIQMAREINGKSPTAQRMLKFAFNLTDDGLMGQQVFAGEATRLAYMTDEAVEGK
C7M2I0_ACIFD          EDLEAVAVAWARRILDRSPTAQRLAKYALNLVDDGMVGQQLFAGEATRLLYGTREATEGR
Q3IQY8_NATPD          EDLEDVAHEWAERILSKSPMAIRMLKYAFNMDSDGLVGQQVFAGEATRLGYMTTEAQEGR
Q6A9A6_CUTAK          AELENTAIEWGLTIAGKSPQAIRMLKYAFNMVDDGIAGQQAFAGEATRMAYMTEEAQEGR
                        :          :   ** *    * .:*       .   :.  :  :     *. ** 

E4PMJ8_MARAH          NAFLEKRKPEFRKYYK------
A0A0H2XNS1_BURCA      RAFRERRKPDFRRGKAGHDPQP
Q07U14_RHOP5          NALKEKRKPEFRKYVK------
A1WQA3_VEREI          NALREKRKPEFRKYAK------
F8GQ70_CUPNN          KAFQEKRKPDFRKYAR------
C1B2K6_RHOOB          AAFAEKRKPEFDKYVNA-----
Q7MMF4_VIBVY          NAFNEKRRPDFNKFPRNP----
A0A0H3AIA0_VIBC3      NAFNEKRRPDFNKFPRNP----
C4L9G1_TOLAT          NAFNEKREPDFNKFPRNP----
Q31YJ5_SHIBS          NAFNQKRQPDFSKFKRNP----
MENB_ECOLI            NAFNQKRQPDFSKFKRNP----
MENB_SALTY            NAFNQKRQPDFSKFKRNP----
S5MSD8_SALBN          NAFNQKRQPDFSKFKRNP----
B5XNX2_KLEP3          NAFNQKRQPDFSKFKRNP----
A0A0E1NR86_YERPA      NAFNEKRQPDFSKFKRNP----
C6CQP0_DICC1          NAFNEKRQPDFSKFKRNP----
E0SE00_DICD3          NAFNEKRQPDFSKFKRNP----
MENB_HAEIN            NAFNEKRAPDFSKFRRNP----
A4MW60_HAEIF          NAFNEKTRARLQQIQT------
B3GZ76_ACTP7          NAFNEKREPDFSKFKRNP----
I3DA90_HAEPH          NAFNEKREPDFSKFKRNP----
MENB_ARATH            TAYMHRRPPDFSKFHRRP----
Q31QP0_SYNE7          QAFLEKRSPDFRQYPWLP----
A0A0H3K7S7_SYNP6      QAFHEKRSPDFRQYPWLP----
P73495_SYNY3          QAFLEKRPPDFSQYPWLP----
Q2JNU9_SYNJB          RAFLEKRPPNFRQFPWLP----
Q7VBN9_PROMA          NAFLQKRKPDFSDFDWLP----
I0AJ71_IGNAJ          NAYLQKRKPDFKKFPKLP----
A7Z810_BACVZ          DSFKEKRSPDFGQFPRFP----
A0A0H3E5D8_BACA1      DSFKEKRDPDFGQFPRFP----
MENB_BACSU            DSFKEKRKPDFGQFPRFP----
MENB_STAAC            DAFKEKRDPDFDQFPKFP----
MENB_STAAN            DAFKEKRDPDFDQFPKFP----
MENB_STAAS            DAFKEKRDPDFDQFPKFP----
MENB_STAHJ            DAFKEKRDPDFDQFPKFP----
MENB_STAEQ            DAFKEKRNPDFDQFPKFP----
MENB_STAES            DAFKEKRNPDFDQFPKFP----
MENB_STAS1            DAFKEKRDPDFDQFPKFP----
Q6HC28_BACHK          DAFKEKRSPDFGQFPRFP----
A2RM75_LACLM          DAFKEKRKPDFDQFPKFP----
Q92AY7_LISIN          DAFKEKRDPDFDQFPKFP----
Q8Y6L1_LISMO          DAFKEKRDPDFDQFPKFP----
A5VJX6_LACRD          DAFNEKRDPDFDQFPKFP----
D5T1J1_LEUKI          DSFKEKREPDFDQFPKFP----
F0R1X9_PHOSB          KAFLEKRKPDWSKYPKLP----
E1WRU4_BACF6          NAFLEKRKPDFKQYPKFP----
Q6ARP4_DESPS          NAFLEKREPDFDQFPKFP----
MENB_CYACA            RAFLENREPDFSKFNS------
A3DAN8_SHEB5          DAFLEKRDQDFSAFPWHY----
A4YCE3_SHEPC          DAFLEKRDQDFSAFPWHY----
E1X4E5_HALMS          DAFLEKRDQDYSGFPYHY----
D0MH31_RHOM4          DAFLEKRKPDYSKFPWYY----
G0TPQ8_MYCCP          DAFLQKRPPDWSPFPRYF----
MENB_MYCTU            DAFLQKRPPDWSPFPRYF----
MENB_MYCS2            DAFLEKRDPDWSRFPRYF----
A6W5P1_KINRD          DAFLGKREPDWSPFPWYF----
F0M2Q2_PSEPM          EAFLQKREPDWSTFPHYF----
Q8NT47_CORGL          EAFLEKREPNWNEFPYYY----
D9QE70_CORP2          EAFLQKRAPDWNDFPYYY----
C7M2I0_ACIFD          DAFLQRREPDWSAFPWLA----
Q3IQY8_NATPD          DAFNENRKPDFEQFDWHY----
Q6A9A6_CUTAK          DAFLEHRSPDWSDYPYYF----
                       :   .