CLUSTAL format seed alignment for MF_01935

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

I0JPY7_HALH3      ------------------------------------------------MLHTQAPQINEI
D5DLU6_BACMD      ------------------------------------------------MIATTEQLVQEY
A8FGL0_BACP2      -----------------------------------------------MVTTVQSTFRQEA
MENF_BACSU        -----------------------------------------------MVTTVQRTFRKEV
Q65FT1_BACLD      -----------------------------------------------MVTTVQRTFLKEA
B7GK08_ANOFW      ---------------------------------------------------MVTLYQNKV
C5D6U9_GEOSW      ------------------------------------------------MAILYQHKIQEQ
C5BMH8_TERTT      -------------------------------------MSVQSTVSTSGTPSGLLEVLAEL
L0DUQ2_THIND      -----------------MRDPSAHGEGAVTLRAETPDRSGVGTPHPPAQHFEHEMAVARL
Q2LXF2_SYNAS      ----------------------------------------------MKSDFLFYPLFREE
F8L8Z2_SIMNZ      -----------------------------------------MQKRILNLDELITKALVQT
Q3APX3_CHLCH      ------------------------MPTTTPNDESHIHLTTREQLPLAIALEHLKDSVKAI
Q8KBE9_CHLTE      ----------------MSGTCKTMCLTRPENEPRNPMQADDSIPMMQKALQLLEASVKAA
A1BI73_CHLPD      -----------------------------MSDKRHTIIADNNPLPLQKAVQSLLREVERL
B3QUU3_CHLT3      -----------------------------MIECKTEQHIKICGKEIATVQNAARTIQQLI
D0MFF4_RHOM4      -----------------------------------MRRMDPSAVEGALPVCAPEELPRVL
Q2S2V7_SALRD      MPRPLPSRSATPHGRRREGPPPPAPPLHPRPVFLTHTSMLDLDPTVIRDIEGADDVRAAL
A1SRV3_PSYIN      ---------------------------------------------MLTAEHNFNLMVIFI
D4ZDG9_SHEVD      ---------------------------------------------------MLPQAIEYL
E1SVA5_FERBD      ------------------------------------------------------------
T2L871_9GAMM      --------------------------------------------------MHVTHPIEAL
C4L9G4_TOLAT      -----------------------------------------------------MLAQIRL
Q5E479_ALIF1      -------------------------------------------------MSTFQDAIESI
Q7MMF7_VIBVY      --------------------------------------------MYEVVLSHFHQAITNL
Q87R70_VIBPA      -------------------------------------------------MSEFHQAVKRI
F7YNU9_VIBA7      -------------------------------------------------MSHFHQAIARL
Q9KQM2_VIBCH      -------------------------------------------------MLHFYQAVAQL
M1SHP7_MORMO      -------------------------------------------------MTLFSDFISQV
I2B783_SHIBC      -------------------------------------------------MNSVVTALSEL
A6TBV9_KLEP7      ---------------------------------------MWGFTTVEVCVLSVSTALARL
MENF_ECOLI        -------------------------------------------------MQSLTTALENL
D2TH10_CITRI      -------------------------------------------------MYSFTAALESL
A8ADW8_CITK8      ------------------------------------------------------------
Q8ZNE7_SALTY      -------------------------------------------------MHSITTALENL
B5RCD5_SALG2      -------------------------------------------------MHSITTALENL
F4HAZ1_GALAU      -------------------------------------------------MDVLQQLKSLL
M4RHK0_BIBTR      -------------------------------------------------MSVFTQLTQAL
B8F6A0_HAEPS      -------------------------------------------------MSVFSQLKQQL
MENF_HAEIN        ------------------------------------------MYLKQNLMSYLAQAIGEL
A6VMF7_ACTSZ      ----------------------------------------------------MERLQHAL
Q65RK8_MANSM      ---------------------------------------------MFLTMDSLQSLQQQL
MENF_PASMU        -------------------------------------------------MDNLQSIKAQF
B0UT52_HISS2      -----------------------------------------MFNLIRYKMDNLHEIKAEF
                                                                              

I0JPY7_HALH3      IEKAINQAQERNE--PQLISVVDQI----EPSDPFQFLDAGT-----SINNHCLFWRSA-
D5DLU6_BACMD      IKDAIECAKNENQ--PKLVSLVKKV----RPIDPLIFYANGH--DQFYKERF--FWKDP-
A8FGL0_BACP2      LATLEEAN-NVNH--AVLISYSRRV----DDLDPLAFFQSGE--ADFLGERF--FWSDP-
MENF_BACSU        LHALHKAK-EVNH--AVLISYSRQI----ESLDPLSFFNYGA--KKYTGNRF--FWSDP-
Q65FT1_BACLD      PEALNIVK-KVNH--AVLISYSRKI----ESIDALSFFINGK--EQFAGERF--FWSDP-
B7GK08_ANOFW      IDQLRYVL--GKK--EHMVSITIRM----EQIDPLAFFSAGE--TLFYGQRF--YWSDC-
C5D6U9_GEOSW      LHFIGKKA----N--RPFISWSEEI----ERVDPVYFFSLGQ--ACSFRQRF--YWSDR-
C5BMH8_TERTT      RERLRGEKYC--A--QRLLRVSLPVELDNTPLEIAAACRESE--------RQ--IFATR-
L0DUQ2_THIND      LRRITHWP--FRK--GQLLHLSERL----PALDLLAWLQANP-----QNARS--FWQNR-
Q2LXF2_SYNAS      IDRLSRNSGRKEA--GYLLRIENRTELSDPILDIILSCQIPE--------KF--YYSAR-
F8L8Z2_SIMNZ      PFKPETVTLKNHT--FPFMRLEIPI----PGIDLLAWLEQQT-----LYPKI--YFETP-
Q3APX3_CHLCH      RRSLPYHK--AQK--AQVITCVEAI----EPIEPLHWLYVQQ-----LYPRL--YWKNR-
Q8KBE9_CHLTE      MRQRDGSPAVSGQ--PMLERFSAPL----GEVDATRWLSAQR-----LFPRL--FWMNR-
A1BI73_CHLPD      KERTTDRFEESPS--GSLLTISQPL----LPLDPLDWLNRQH-----LFPKL--YWMNR-
B3QUU3_CHLT3      DENIPELTETIAQ--PTLVSFQISL----ENCDPLSWLSQQA-----STTRL--YWSDR-
D0MFF4_RHOM4      GSRIRRAL-RQPT--AEIVQLRCPV----APLDLLAWLAAQP-----EPVRF--YWADR-
Q2S2V7_SALRD      ADRIRDAT-RSSA--ARTVRVSVPV---PGRMRPIDWVRARS-----SAEAV--YWSGR-
A1SRV3_PSYIN      REQLQQFAIKQGD--KPSCNLVIPL----TPFDLLGLLKGQSLDSDALYPRI--YWEDI-
D4ZDG9_SHEVD      TDKLQQLNFQSHC--DPIIQVSVNI----KAVPVIAWLAAQP-----IYPRI--YWKGR-
E1SVA5_FERBD      MAQLECQ---PPG--HLCLQLSEPL----DAPPLIAWLANQS-----ELPRI--YWRGR-
T2L871_9GAMM      KHQLDALR-HTDK--KGFMRLNTPC----QVGNLMGWLNVQS-----VYPRL--YWQSR-
C4L9G4_TOLAT      LEQLNALA-KTDQ--HGFVRLRAPV----DVTSLIGWLKAQP-----LYPRI--YWHAR-
Q5E479_ALIF1      RHQITQAT--TSH--TISLKLDWSI-----GEQLIDWLEAQP-----VFPKF--YWQSR-
Q7MMF7_VIBVY      IERVKNAK--DDE--TRLVELLTTK----PTLTFIDWLEAQP-----VFPKF--YWQSR-
Q87R70_VIBPA      IERVQHT-----E--GNQVRLVEPL-SEKPNFAFIDWLDAQP-----LFPKF--YWQSR-
F7YNU9_VIBA7      IEQINDAK--DDD--VRFVQILQEA----PPFAPIDWLEAQP-----IFPKF--YWQSR-
Q9KQM2_VIBCH      MEHIRGA-----K--AHDVRFTQPL-ADKPPFALIDWLDAQP-----IFPKF--YWQSR-
M1SHP7_MORMO      CTEITHNKNKPDGIYQYAVTLSPLLAAVLPPSALTGWLNAQT-----CWPQF--YWQHR-
I2B783_SHIBC      QQKLIAPLPDSSG--TLVFTVPLTL---SDDSDALQWLAAQS-----VWPQF--YWQQR-
A6TBV9_KLEP7      QDGLGESFPDSPG--TRIIDVAFPL---NDAFDPLLWCGQQA-----QWPQF--YWQQR-
MENF_ECOLI        LRHLSQEIPATPG--IRVIDIPFPL---KDAFDALSWLASQQ-----TYPQF--YWQQR-
D2TH10_CITRI      TRLLTQEISARPG--IRVIDVPFPL---NDAFDALSWLASQP-----VYPQF--YWQQR-
A8ADW8_CITK8      ---------------MRIVDVPFPL---NDAFDALSWLASQA-----IWPQF--YWQQR-
Q8ZNE7_SALTY      TRQLSQEIPATPG--LCVFDAPFPL---NDAFDALSWLASQS-----SFPQF--YWQQR-
B5RCD5_SALG2      TRQLSQEIPATPG--LCVFDAPFPL---NDAFDALSWLASQS-----SFPQF--YWQQR-
F4HAZ1_GALAU      TTQIAIYQPDCRR--FGEIQASIEA----SNIDLIAWLKGQT-----VFPQF--YLQQR-
M4RHK0_BIBTR      SQQLAQN---EVS--AGLLRFSATVKCQPNDADLLSWLKGQA-----CFPQM--FWQQR-
B8F6A0_HAEPS      YQQLQQK---PVA--QGLVQLQAEIAIDLENQQLLAWLKAQP-----LFPHY--YWQNR-
MENF_HAEIN        KSQIHAYL-QQST--NELVRFQVKL----DKVDLLAWLKGQS-----AYPQF--YLHFR-
A6VMF7_ACTSZ      SEQIKTHSFTPQS--QTITAFRAET---AAVGSLLSWLKGQV-----MFPQY--YLNFR-
Q65RK8_MANSM      IQQMDAYQPCKNQ--PEITALTAKI---QLEQNLLAWLKAQQ-----DYPQF--YLHCRA
MENF_PASMU        IAQINAYQP-EKD--RDIVVFQCNT---ETTFSLLAWLKAQQ-----YYPQF--YLHGR-
B0UT52_HISS2      IRLINQYQF-DPK--NDFSVLHLDL---DEELNLLGWLKAQH-----HYPQF--YLNFR-
                                                                              

I0JPY7_HALH3      ----E-EDFTMVAVGSAYKMYAEN--ENRFKE-IQVMWDNIHQSALTYDEFNE---KGTG
D5DLU6_BACMD      ----N-SYYTFVGLGYAHTICTNAA-KERYFH-IENEWKRFIK--EDFYKNNQISPDGTG
A8FGL0_BACP2      ----E-SQMIFSGLGRAAVIKSSEQGKERFDT-VHQEWEQLKQHMFHFHDEKELRQAAVG
MENF_BACSU        ----E-SELTIVGLGKEAVFQTNQKNSERYRE-VFEQWERFKKTAFHIYEEEKLQHSAVG
Q65FT1_BACLD      ----D-GGLTLVGLGKEISVSTDLKDAGRYQA-VHEKWERLKEKTYHFHEDQSRGQAAVG
B7GK08_ANOFW      ----L-HERTFVGLGRAQVIKSEEKTKKRFRD-VEREWKQIVEG---------AFIEGQG
C5D6U9_GEOSW      ----T-NETVYVGLGCTYIIETEEK-EQRFRT-VETEWKRWMEQTASYSNGTD-----AV
C5BMH8_TERTT      ----D-NKFTLVGFGHSRRLSTNN--AEQTAAILDQAQQLVAGS---------------D
L0DUQ2_THIND      ----E-RTISVAGLGAAVELTAQS--EQEVGDLLERSYSILGDR---------------D
Q2LXF2_SYNAS      ----D-DLFELGGLGSALNI---E--AAGEDE-ILNGFSWLWDA--------D-----ET
F8L8Z2_SIMNZ      ----K-TGFRVAGVGAAYTL----------DE-IPSFHRLSASS----------------
Q3APX3_CHLCH      ----E-QNNEVAAVGIADSF---T--AKDDDN-NNSAFAAFQAA----CDERS-----PA
Q8KBE9_CHLTE      ----E-KSEWIAGIGEADRI---E--ITESGP-NDRSFLVLEEA----MTRKN-----PH
A1BI73_CHLPD      ----E-KSFSVAGIGTADCI---E--QNTPGT-NASSFAELTRT----IATKD-----PD
B3QUU3_CHLT3      ----E-ASYEVAAAGETDRLFAEG--EPHLTE-LILELQRRLAS-------SS-----ED
D0MFF4_RHOM4      ----E-NAEAVAALGAVLLH---EATHPLTREALAPVEDRLRRA-------------DPG
Q2S2V7_SALRD      ----D-EDRTVAACGTADVV--------SGST-APVDYQALGRVLDERLDGAD-----SG
A1SRV3_PSYIN      ----E-HLQTIACFGAIDEC----------TY-IPEPIG--------------------E
D4ZDG9_SHEVD      ----D-TEEEVAAIGCCKDFFYDE--TTDDNQ-LAMEYQAQRAL------TKN-----QD
E1SVA5_FERBD      ----R-DGEEIAAIGAALDLHFDT--LPSAEE-LDRLYNKYLGA------GQD-----TQ
T2L871_9GAMM      ----DVGTVEYAALGVVRAF-------DSLAA-LQADLATLADS------------GGEQ
C4L9G4_TOLAT      ----E-RDREFAVLGAIREL----------TD-PAQLAELTGQQ---------RPNAGSY
Q5E479_ALIF1      ----D-GEEEVAVLGQVKTF----------TD-PSAAQKVLAP----------------Q
Q7MMF7_VIBVY      ----D-TREEVVALGQLHTF----------VD-PGPAYTILSP----------------G
Q87R70_VIBPA      ----D-TREEVVALGQLHSF----------VE-PGPAYTILGE----------------G
F7YNU9_VIBA7      ----D-TREEVVALGQLYTF----------SE-AEPAYAILGQ----------------E
Q9KQM2_VIBCH      ----D-TREEVVALGQVYTF----------TD-PAPAYAILGD----------------E
M1SHP7_MORMO      ----D-DTETAAVCGEVCRF----------TH-ISDAQALLDTL------PAQ-----SQ
I2B783_SHIBC      ----N-GEQELAALGAVAHF----------PS-LSAGEAFLAQF------PAS-----ER
A6TBV9_KLEP7      ----N-GDEELATLGAVKTF----------TS-LDAANRFLRQA-------GR-----QD
MENF_ECOLI        ----N-GDEEAVVLGAITRF----------TS-LDQAQRFLRQH------PEH-----AD
D2TH10_CITRI      ----N-GDEEAAVLGAVCRF----------SS-LDEAQRFLHQH------PQQ-----TD
A8ADW8_CITK8      ----N-GDEEAAVLGAVETF----------PS-LEQAQHFLRQH------ESQ-----SD
Q8ZNE7_SALTY      ----N-GDEEAAVLGAITVF----------SS-LDLAQRFLRQH-------AQ-----PD
B5RCD5_SALG2      ----N-GDEEAAVLGAITVF----------SS-LDLAQRFLRQH-------AQ-----PD
F4HAZ1_GALAU      ----Q-QQYQIAAVGAVSHI----------SS-FTELSEFKQNY--------------PH
M4RHK0_BIBTR      ----A-QRDTFVALGQVLRF----------QQ-LSAAEAFCHQH---------------Q
B8F6A0_HAEPS      ----D-TEQTIVAVGAVQTF----------EH-LDDVEQFSKQS---------------D
MENF_HAEIN        ----D-EEKALAALGAVQSF----------SQ-LNLAQEFIEES---------------G
A6VMF7_ACTSZ      ----D-NSRCIAAIGKVRSF----------SD-EISAQQFVRRT---------------D
Q65RK8_MANSM      DSPNE-QENHIAAIGQVRTF----------TT-VNHAQTFVRRA---------------D
MENF_PASMU        ----D-GATKWASIGQVRQF----------SD-VSAAAHFIQEQ---------------Q
B0UT52_HISS2      ----D-TNKKILGLGEVCRF----------TQ-VKSAQTFVQQF---------------N
                                *                                             

I0JPY7_HALH3      IVALGGFSFDSKQNDQVP-----WEAFPDSQMTIPAFLLTN-KGPESYLTTNVLIFPEDH
D5DLU6_BACMD      PLLFGGFSFDPNQYRENY-----WSDFPSSKFMIPTVLYTQ-VDKEGYLTVNMMVKG---
A8FGL0_BACP2      PLLFGGFSFDPYEEKARH-----WEAFGEAHFFVPSMMLTV-SKEGTFLTINEWKQVDGN
MENF_BACSU        PVLFGGFSFDPCEERGSQ-----WDHFSEGDFFVPALMLTM-TAEGPFLTVNRWVSGGED
Q65FT1_BACLD      PLLFGGFSFDPLEDRKQH-----WNGYQEGAFFIPAAMLTQ-DGEETFITVNRWKTPEED
B7GK08_ANOFW      PLMFGGFAFDPLKQSDEH-----WIEFPSAQFVVPTFLLTK-QRDEIWLTVNVVHES---
C5D6U9_GEOSW      PIIFGGFSFDPFKPRTEK-----WRAFPHAKMIVPTVLLSL-KNGKATLTVTMCSGQ---
C5BMH8_TERTT      ACWLGGCSFAGNTGVGR------WQEFPAACFVLPLVELRE-TNGFCEVAINMYAESYAQ
L0DUQ2_THIND      TVFLGGLSFDGRSGRGE------WSAFPGARLVLPAIACCQ-RNGEYRLSVHLLADS---
Q2LXF2_SYNAS      IPVFGGFSFDEEPSSPE------WEPFGRFRFTLPLVEIRR-SPEGVRISVNCVNKKEMS
F8L8Z2_SIMNZ      -RFFGGMDFYERKFET-------WKTFPRCRYVLPLVEIEV-RHEMTYLCVNRTCEA---
Q3APX3_CHLCH      LRYFGGFRFNGAELSEEH-----WKHFPPFFFFLPLVTVERFADQRYTVSANLFLAVGDS
Q8KBE9_CHLTE      ARYIGGFCFNNLQKQNKL-----WSAFSPGLFILPLVSIEY-RDGQTLMTCSLWLEPGND
A1BI73_CHLPD      ARYFGAFRFNNMEEQSEP-----WHSFSSYAFVLPLVGITF-EQERYVLFCNLWLEPGEA
B3QUU3_CHLT3      IRYYGGLKFDSSSPADHD-----WKPFGALLFVLPRYEMTK-SQHGNTFTINLVIQHGNE
D0MFF4_RHOM4      VRFYGGGRFDSRAPVAPH-----WEPFGAGRFWLPRFELRR-EANRYWLVCNLVPEL-D-
Q2S2V7_SALRD      VRYYGGMRFDAGQPTAPNRPDGRWAPFGTYRFVLPRFELVE-ADGTLRLVCTLVLPR-D-
A1SRV3_PSYIN      ACYFGGLAFQQQGVQ--------WADFPEILFIRPALEFTL-EQQKLRLTCHFNGAN---
D4ZDG9_SHEVD      IRYYGGVAFDRSTEA--------WPEFGRARFVLPRVELRR-SGTEFKLVVNLNCDK-QD
E1SVA5_FERBD      LRLYGGHAFDTQQPA--------WPDFGQARFVLPRIEIRR-HGEQAQLLLNLCGQE-RP
T2L871_9GAMM      PDYFGGMAFDPGMSG--------WEHFPGCHFLLPRIELRR-QQAGATLSLNLRFDD-CC
C4L9G4_TOLAT      PRYYGGLAFDYQQPVTGE-----WQDFGQCRFVLPRIELIR-QGNQTELVCNLWFEG---
Q5E479_ALIF1      QRIWGGRSFDGRTERNRR--------CMSSFFFLPQVEITR-LGSSWNIMVNVS-ED---
Q7MMF7_VIBVY      QRVWGGRSFDGSSEKNRR--------CMPSFFFLPQIELIR-LDDKWSLAVNLNGDK---
Q87R70_VIBPA      QRVWGGRSFDGQHEKNRR--------CMPSFFFLPQIELIR-FDQQWSLAVNLTEDK---
F7YNU9_VIBA7      QRVWGGRSFDGHTDKNRR--------CLSSFFFLPQIELIC-CDGQWSLAANITAER---
Q9KQM2_VIBCH      QRVWGGRSFDGHTAKNPR--------CMSSFFFLPQIELIR-RDEQWLLAVNINNEP---
M1SHP7_MORMO      IRIWGLNSWQFDTPSPPQ-------GTGGSYLFVPRAELRI-SGSETHFLVNIDSRR---
I2B783_SHIBC      LLICGLNQFDP----------------ASGSLFLPRLLWQR-QRGQAALTLILHSEH--S
A6TBV9_KLEP7      LRICGLNAFEP----------------QQGSLALPRLEWRR-CGGRAVLRLVLHSDI--S
MENF_ECOLI        LRIWGLNAFDP----------------SQGNLLLPRLEWRR-CGGKATLRLTLFSES--S
D2TH10_CITRI      LRIWGLNAFDP----------------RQGFLFLPRLEWRR-CAGVATLRLHLCSAV--S
A8ADW8_CITK8      LRIWGLNAFEP----------------QQGHLLLPRLEWRR-AGAMATLRLYLYSPV--S
Q8ZNE7_SALTY      LRIWGLNAFEP----------------KEGYLLLPRLEWRR-SGGTATLRLHLHSDV--S
B5RCD5_SALG2      LRIWGLNAFEP----------------KEGYLLLPRMEWRC-SGGTATLRLHLHSDV--S
F4HAZ1_GALAU      FTLVGGVQFR-----------------GEVKFILPRLYLHY-QQQTLTVKLLFEQQI---
M4RHK0_BIBTR      VHLVGGIQFE-----------------GQIHFILPRLLLWQ-TEEQLRAELFGYADE---
B8F6A0_HAEPS      LMVVGGIEFE-----------------GQCHFVLPRSLLVK-NEKKITAWLNLDGRH---
MENF_HAEIN        FPLVGGLQFQ-----------------GTAQFVLPKMLVEQ-DNKGTLVSFFVKNEQ---
A6VMF7_ACTSZ      LLVAGGLTFD-----------------KRATFWLPRMVLEQ-KNNKLYATLYTDGEQ--P
Q65RK8_MANSM      FTLVGGMTFN-----------------GECDFYLPRLLLRQ-VDGELTATLFIDSQK--D
MENF_PASMU        LALLGGLQF-----------------YGDALFVLPRLLLQQ-RQDGMTITLFIDGKQ---
B0UT52_HISS2      LSLIGGCQFN-----------------GEPLFILPRLSFIQ-EQK-LVIQLIIDNKK--P
                      *   :                         *                         

I0JPY7_HALH3      KQQIITQLSNHRETLLR-----AGHKTFEL--PVRTNSE-EIDPSGWKKSIEQATEDIKK
D5DLU6_BACMD      -QDSVKKHINYFEEVQK-LVLCEEYDGESHISPLLLEKE-EIGVEKFKGNIERATTLIKQ
A8FGL0_BACP2      VHQLIQELEQKASQFKT-----LPLRYDGQ--AELVHME-ELDVNEWMKAIQEATDHIRA
MENF_BACSU        AEAVLEGLKAFAAEFMV-----PDFKQEDQ--AVIAAAE-ELDKDDWLKAIETATSQIKE
Q65FT1_BACLD      VRKVLEEIKGAASQLTK----ADDSRYPEKGHTQYTAKE-ELDVPEWLEAVRRATDDIKN
B7GK08_ANOFW      ----LNQIEEMIDSLFH----TRDESDWHR--AHIVKKE-EVARDQWLRAVHYATDLIRN
C5D6U9_GEOSW      NEEIIKKIGMLIRLLYQ----EQKQQTSSL--PPLITYK-EVQKEEWIDAVKKTIENIRK
C5BMH8_TERTT      WQTRLEAIDQLVGEISA----IPSLAGSRL--PALVARRDTISLREWRELVMNALEAIRG
L0DUQ2_THIND      RREFIRRKTQLITALCRLRFRGRARPDAPR--PRVSSRIDDVDFAGCRRRIQAVLREIAA
Q2LXF2_SYNAS      RAQVCRELADALQSLDA---LTRNFPKEFQ--PAVADRQLIPDKPQWNRMIKKALRTIRE
F8L8Z2_SIMNZ      --------LDLSEIRFN----PAPISTISQ--KATSRLD-SPSFPVWDRNIRESLKQIQE
Q3APX3_CHLCH      VDEKINQLIAFIEQLNSRIDNESVLNTLLP--SVEHITR-TPNKAAWNAGCEKALNAFEN
Q8KBE9_CHLTE      RQKGLEQLLAALSAVSA---GDAPETAGIP--EMTQVSY-CPDKAQWIENCETILRNFDE
A1BI73_CHLPD      PDIKIRSICDALENMST-TQSDCDSDRNIP--ALVRISR-NPDVQSWTRQCERALRTFEA
B3QUU3_CHLT3      VEQQLLAEIQTLQTLCS----AAPVSSQPL--PIASIRTDSPNQKEWQEIIDKSIQAFDS
D0MFF4_RHOM4      -RERVETIVEALRALRW----PEMPLTPEL--PLPLDRRDTPDQTGWMRNVARALDAFRR
Q2S2V7_SALRD      -AERVDEIVDALGAVAL----PVPSEHTAL--PRPHQRQDVPGHGEWTDMVRWALDAIDG
A1SRV3_PSYIN      ---SIEKSLLLINCLQK-----PVSPDAVN--NIVVSREDLPNRQQWAELVESAIE--YK
D4ZDG9_SHEVD      TQSERRHAMESLGSLAP----AKPLPPPNK--VSLLGRSDRPDRHHWTELVNRVTDPKFI
E1SVA5_FERBD      WQQELERARTALDAIQS----AAPLSPLGP--AHVLARQDTPDQPRWRELVEQITDPAFL
T2L871_9GAMM      PEVEIAQARACLAALEE----EQLLPCWLP--NVYQRED-RPAQKEWAASVAQVTHPDQL
C4L9G4_TOLAT      -ANAEQEMAAARTALQQ----LQPEKTLRKYLPTQRERQDTPDKPRWMQWLSQVLQPEAL
Q5E479_ALIF1      ----NSRLLSTLNKMTE---EFDDLSELHC--RVTQRIN-TPEKADWSNMVNKALTAIEN
Q7MMF7_VIBVY      -----SRILHTLSKLTT---EAKPLAPLTA--HIQSVEH-LPEREGWCDLVSKVLKGIQA
Q87R70_VIBPA      -----ARTLAGLRKLIC---DVAALPPISS--HIRSIVH-TPVKSEWDALVHKVLTGIEN
F7YNU9_VIBA7      -----QRTLVALHKLQL---EVSPLRGMTS--HIKQVTH-QPNEVKWQQLVNQVLEGIDH
Q9KQM2_VIBCH      -----QRTLTALQKLLV---EVPTLRSMTA--HVTRVEH-TPTAANWHDLVEKVLAGITE
M1SHP7_MORMO      ---PAEETTEFLRSLVW----QTEIPALNS--TVISARH-QPDEAGWTQLVTDAVTAITG
I2B783_SHIBC      LAQDGLQAQALLAALLP----ARPLPALQL--TLLREQQ-TPAWPRWQQLIEQALAGFSR
A6TBV9_KLEP7      LREDAATARAFLASLTT----TQATPGAIP--PLLSERH-SSDYPQWQAMIARATKAISA
MENF_ECOLI        LQHDAIQAKEFIATLVS----IKPLPGLHL--TTTREQH-WPDKTGWTQLIELATKTIAE
D2TH10_CITRI      LREDTERALTFLTSLAG----VKPLSTLRL--TLTAERR-WPEKAGWISLIRKATDTIAA
A8ADW8_CITK8      LREDARRAIAFLSSLRG----VKPIPALRL--HLTGEQH-WPDKAGWTSLIQLATQTIAE
Q8ZNE7_SALTY      LRDDARQAKAFLASLVG----IKPVPALRL--SLTSEQH-WPDKDGWVKLIQQATHTIAQ
B5RCD5_SALG2      LRDDARQAKAFLASLVG----IKPVPALRL--SLTSEQH-WPDKDGWGKLIQQATHTIAQ
F4HAZ1_GALAU      WQQEKQQLLQILQQLPH----TQPCNEIKA--ITPILRHQSSTQSQWRQLIQRALNTIKQ
M4RHK0_BIBTR      ----QANLVAFLAQLDE----PRTFGSTKN--QVIAKKQ-LCSFEQWQTNIQQAISAIKT
B8F6A0_HAEPS      FESEQKECIALLAQFEQ----TAELHPIEN--SLLSTKV-ACDFSRWQHNIELAIEQIQQ
MENF_HAEIN        ---SANDTLAHLKTFEN----LTALSALPK--QIPLHTELRANERTWCDWVNQALVEIKS
A6VMF7_ACTSZ      PQNERQAALDAVKTLSN----YTALLPVRQ--TLRLESQ-KADENRWCEWVQKAVNAIER
Q65RK8_MANSM      LSVEKQLAGKCLKNFTK----SVALEPVVQ--SVRLVEK-KATQAQWCEWVEQALLEIKK
MENF_PASMU        FEQDKLVALACLSTFEK----QTALQTVKQ--EISLISQ-KADQAEWCRWVEQGLQKIKQ
B0UT52_HISS2      WEQEKYDLLNIIHSLEK----QVQLNPIHQ--SIQLITT-KANQTEWCLWVEKALHEIKQ
                                                                              

I0JPY7_HALH3      GLLDKVVLARELRISFNDPVQLAAVIEALAATQPNSYIFAFE-SEGEYFVGATPERLAKL
D5DLU6_BACMD      QAIEKVVLARQLKVKFNEDISTEYVLQRLLKEQPTSYTYILE-GEHQHFIGASPERLVQK
A8FGL0_BACP2      NEYEKVVLAREVLLHYKNQIELAPLLSALLKHQTTSYVFAVE-QGRQAFVGATPERLVKK
MENF_BACSU        KQYDKVVLARELLLTFDGPIQIEPVLKTLLDDQQTSYVFAIE-QEGKTFVGASPERLIKR
Q65FT1_BACLD      GKYDKVVLAREILLTFDQPVELHRVLFNLMSEQKTSYIFAIE-ENGKSFVGASPERLVKK
B7GK08_ANOFW      DAIEKVVLARELFLSFSDRINCSQVLHELHEQQPMSYIFAFE-NGSTCFIGASPEQLVRK
C5D6U9_GEOSW      GKFDKVVLAREARLSFADAIDPSVVLQQLREQQPFSYIFAFE-QEGQCFIGASPEQLVKK
C5BMH8_TERTT      GGFKKVVLAREVELCLTAPADPFAALAQLDRQHNPGYLFALT-SGKDHFFGCSPERLFKQ
L0DUQ2_THIND      GELHKAVLARRVELALTSPVAVFEVLARWREVNPGSFCFAME-RGQDLFMGCSPERLYRR
Q2LXF2_SYNAS      GELKKIVLARKKVITHRDLWNPAQIIASLSRIQENSFTFFYQVDDGIAFLGRSPERLFRM
F8L8Z2_SIMNZ      KSLDKIVLARASLFEFEKPLSPLAFCKALQGKSPTATVFSYQFSTDQAFVGATPESLYSR
Q3APX3_CHLCH      GELEKIMLARQTTLRFTHTFSPLLFLLRYPYPHNAIYRFYLELAPNQAFFSFTPERLFRR
Q8KBE9_CHLTE      GKLDKVILARQTELSFAGKVPAIRFLLDYPFPENTAYRFYFEPVEGHAFISFTPERLYRR
A1BI73_CHLPD      GDMDKIMLARQTILEFSESFSPLLFLINYPYPKNSTYRFYFEPKKNHAFFSFTPERLYRR
B3QUU3_CHLT3      GCMEKIVLARKTTMVFSEELDPIRLLKQLKDVVNRAFHFYFQFDGTPGFIGATPERLYKR
D0MFF4_RHOM4      GQMEKVVLARQVQYAFGEALDGLALLQRLQEATPGCFHFYYQPEPGTAFLGASPERLFRR
Q2S2V7_SALRD      GSLDKVVLARRVALSLGAPMDPLLVLSHLEPATPGCYHFAVRPSRGAAFVGASPERLFRR
A1SRV3_PSYIN      ALIPKVVLSRQTELICEQKVNQWDLINQWQEANPNSFHFAFQFSTNHTFIGCSPERLFSR
D4ZDG9_SHEVD      HETPKVVLSRLTQLEVNEEINPWMLLACWQGRNPSSFQFGFQFSPNRTFISCTPERLYRR
E1SVA5_FERBD      AATPKVVMARETRLTTSALPNHWTVLHAWQLLNPGSYQFGFQFTDSHSFISCTPERLFHR
T2L871_9GAMM      GHTPKVVLSRETCLTTSETPNPWALLARWQAGAVDCFHFGIQFTPHEAFIGCPPERLYKR
C4L9G4_TOLAT      KTIPKVVLSRRSTLTFNEPLEPWSLLASWQCAAPACFHIGFQFSPDSCFIASSPERLYRR
Q5E479_ALIF1      KQFEKVVLARKTTLTLDLNLSSAQFLKASRQSNSHSFHFMMALDSEHCFIGSTPERLYVR
Q7MMF7_VIBVY      KAFKKVVLARKTTVHLDSALCAAQLLKASYLQNHHSFHFMLSLDSKHSFIGSTPERLYLR
Q87R70_VIBPA      DEFKKVVLARRSTVQLDNRLSAAQLLKASYLNNHHSFHFLLSLDSKHSFMGSTPERLYSR
F7YNU9_VIBA7      QAFKKVVLARQTTLSLDKPLSAAQLLKASAAHNHHSFHFLLAFDQKHSFMGSTPERLYAR
Q9KQM2_VIBCH      KQFKKVVLARKTTLTLDAPLSAAQLLKASHAQNHHSFHFLLALDSRHSFMGSTPERLYLR
M1SHP7_MORMO      GEMEKVVTARKTALELSAPVSPAAFMQASCDCNHRCFHYMLATGPNTAFVASPPERLYFR
I2B783_SHIBC      GEMEKVVLARASDLWFSTPVSAAGFLAASRRVNLNCYHFYMAFNAQQGFIGSSPERLWRR
A6TBV9_KLEP7      GEMDKVVLARATDLQFAAPLDAVSIMAASRRSNLNCFHFLMAFNARQAFFGSTPERLWRR
MENF_ECOLI        GELDKVVLARATDLHFASPVNAAAMMAASRRLNLNCYHFYMAFDGENAFLGSSPERLWRR
D2TH10_CITRI      DGFDKVVLARASDLHFSRPVNAAAMMAASRRLNLNCYHFFMAFSANSAFLGSSPERLWRR
A8ADW8_CITK8      DDLDKVVLARATDLQFSHSVNAAAVMASSRRLNLNCYHFFMAFSAGSAFLGSSPERLWRR
Q8ZNE7_SALTY      EAFDKVVLARATDLQFSRPVNAAAMMASSRRLNLNCYHFFMAFSADTAFLGSSPERLWRR
B5RCD5_SALG2      EAFDKVVLARATDLQFSRPVNAAAMMASSRRLNLNCYHFFMAFSADTAFLGSSPERLWRR
F4HAZ1_GALAU      QQFNKVVLAREAVFHLDQPLNGYDFLALSRQTNQYCYHFAVVESAHSMFLGASPECLYRR
M4RHK0_BIBTR      DAFDKVVLANATSWQLSSPLSGYDLLAKSRHLNQGCYHFLWAENLHECFIGSSPERLYQR
B8F6A0_HAEPS      QQMNKVVLANATIKTFTHHISPYVLLFASQQKNLGCYHFLWSEKQGEAFIGSTPERLYLR
MENF_HAEIN        GELTKIVLANETTFHLKQAINAYDFLAESEKQNQGCYHFLWAENSHSVFVGSTPERLFAR
A6VMF7_ACTSZ      GDFTKVVLANESCFIASNPIDSKDFLAESEKQNTGCYHFLYAENPQQVFVGSTPERLFAR
Q65RK8_MANSM      GSFTKVVLANESIFSSRQPINAIDFLAESEKKNTGCYHFFFAQKADYAFIGSSPERLYLR
MENF_PASMU        GELSKIVLANERCFKTAAPLAATDLLAESEKYNLGCYHFMLAESEQRAFIGSSPELLYRR
B0UT52_HISS2      KNLTKVVLANETDFKTDSPLNAKDFLAESEKYNTGCYHFLFAQNNTQAFIGSTPERLYVR
                      * : :.                                      *.. .** *   

I0JPY7_HALH3      DKQHLVSTCLAGTIRRGKTKEEDVQLGEELLYDPKNRQEHQFVVEMIRQAVEACCYNVQI
D5DLU6_BACMD      QGDYVFSTCLAGSIPRGKTRQEDHELGEELLQDPKNLIEHDVVVHMIKEAMNSYCYEVEI
A8FGL0_BACP2      SGGEVFSSCLAGSIVRGKNEEEDKALGEELLHDEKNLIEHQIVVNMIEQAFEANCLRVHK
MENF_BACSU        DGGTVMSSCLAGSIKRGVNEEDDRRIGLELLNDEKNLLEHDIVVGMIHNAFVSSCSEVEK
Q65FT1_BACLD      DGENVLSTCLAGSIKRGESEQEDRMLGLELLNDEKNLIEHDIVVNMIHQALLSNCSNIKK
B7GK08_ANOFW      NGHMCETACLAGSIRRGHTMEEDEELGRWLLQDDKNRREHAFVVDMIKQAMNEVCTEVVI
C5D6U9_GEOSW      EKDTCYSICLAGSIRRGKTLQEDEQLGKWLMNDEKNLREHQFVVQMIKEAIEAVCKRVQI
C5BMH8_TERTT      KGHQLVTEALAGTVRRGLDGDEDAALESRLIQSRKLVHEHQLVADAIHSALCPLALQLSP
L0DUQ2_THIND      HRREFQTESLAGTVRLGRTRDEDVALMARLHRDPKLVQEHDLVTRFVRRQIEPWVTDAQS
Q2LXF2_SYNAS      QNGQILTEAIAGTRPRGKTPFDDQRLEAELLSSPKELEEHRFVAGFIEAGMNRLCADVRM
F8L8Z2_SIMNZ      TGSKVETAAIAGTRQRGKTDAEDKALQADLLENVKEMHEFNVVKEEIEKRLSPLCKALTK
Q3APX3_CHLCH      HESMVETEALAGTCSKELLQATDQHASQTLLGSEKDVREHNYVREMIYQELLPICSSIDM
Q8KBE9_CHLTE      DGDMLETEALAGTVTKEALKADDSIASELLLNSEKDIREHRFVKDTIYRELQPVCSDIDM
A1BI73_CHLPD      DGVTLQTEALAGTSLKENLTGDDNLASEVLLNSEKDIREHKFVKDSIYGELFPVCSEIQM
B3QUU3_CHLT3      IGETIFSEAVAGTRPRGNSPEADLAFAEDLLNSDKDVREHQFVCKSILDVMDELCTDIQS
D0MFF4_RHOM4      ADGHVWSEAVAGTRPRGRTEADDARLAAELLQSEKDRREQYYVQQSIVEELRPLCEALDA
Q2S2V7_SALRD      AGRTVVSEAVAGTRPRGETAAEDARLRQELLQSPKERREHAFVRDAIRDDLDRVCREVRI
A1SRV3_PSYIN      ENNRLKTEALAGTVNRGREPREDAILRQSLLSDKKIDRENYLVQEFIVSSLKRLKAEVTC
D4ZDG9_SHEVD      RHRELFTEALAGTTTRGLNQEEDALLATQLQEDSKNSHENQLVSQHIVDVLSPLSRYVGA
E1SVA5_FERBD      HGRELSTEALAGTTTRGFTEAEDEALANALLADGKNSNENLLVRQLIEQQLGPLSDYVGS
T2L871_9GAMM      KGRHLMTEALAGTTRRGRDAQQDQALADELLADKKNSLENQCVYQQLLTQLESLSSQVDM
C4L9G4_TOLAT      QDRQLLSEALAGSTPRTGDPEQDAELATLLLQDGKNRLENRFVHTDILTRLDGLAETAVV
Q5E479_ALIF1      NGYALKTEALAGTIGRGHDEEEDNQLASWLISDKKNQYENRLVVDDIVHRLSKFSISMNV
Q7MMF7_VIBVY      QGQELYTEALAGTIGRGHNATQDMELASWLSQDVKNLNENQYVVDDIVDRLTPHAASVEV
Q87R70_VIBPA      VGHELHTEALAGTIGRGDNATHDMELANWLSQDSKNLNENQYVVDDIVERLSPHSEIVEV
F7YNU9_VIBA7      QGQTLYTEALAGTIGRGENASQDMELSHWLTQDSKNLNENQYVVDDIIERLTPHSERVDV
Q9KQM2_VIBCH      HGQNLETEALAGTIGRGANATQDMELAHWLTHDSKNLNENQLVVEDIIESLAPHAEQIHT
M1SHP7_MORMO      AGAQLYTEALAGTVANYPEDDRAAQAAQWLLADKKNVHENSVVVDDICQRLQGAVSALDV
I2B783_SHIBC      RGVELRTEALAGTVASSADDAKAARLGEWLMHDDKNQRENMLVVEDICQRLNPIGETLEV
A6TBV9_KLEP7      RGALLRTEALAGTVANHQEDAKAQQLADWLMKDDKNQRENMLVVEDICQRLQSEASTLDV
MENF_ECOLI        RDKALRTEALAGTVANNPDDKQAQQLGEWLMADDKNQRENMLVVEDICQRLQADTQTLDV
D2TH10_CITRI      RDTALRTEALAGTVANHPDDYKAWQLGEWLMKDDKNQRENMLVVEDICQRLQHHTQMLDV
A8ADW8_CITK8      RETALRTEALAGTVANHPDDHQAWQLGEWLMKDDKNQRENMLVVEDICQRLQSCTHSLDV
Q8ZNE7_SALTY      RETALRTEALAGTVANHPDNHKAWQLGEWLMKDDKNQRENMLVVEDICQRLQNCTHSLDV
B5RCD5_SALG2      RETALRTEALAGTVANHPDNHKAWQLGEWLMKDDKNQRENMLVVEDICQRLQNCTHSLDV
F4HAZ1_GALAU      TDSQFQTEALAGTAPIGETDEQQRQYQQWLLQDQKNLLENQFVVDDICQKIQPYCQKIEV
M4RHK0_BIBTR      QNKQLLTEALAGTVAVSHDITETAQNALWLLNDHKNLYENWLVVDDICTNLADCAGDIQV
B8F6A0_HAEPS      QQRQFFTEALAGTVAVTDDPVQTEQNVLWLLNDQKNIYENWLVVDDICSHLADCATDIQV
MENF_HAEIN        EYNLLLTEALAGTASVSESEEETQSQANWLLNDEKNLKENWLVVEDISQNLRKQVESFDV
A6VMF7_ACTSZ      QNNFIRTEALAGTAAMSEDPIQNQREAAWLLSDPKNDNENLLVVKDICDNLADYVRRTDV
Q65RK8_MANSM      NGQYLQTEALAGTAVMSDDEEQNQRQGEWLLKDEKNEYENMLVVEDICGNIESFTQNIEV
MENF_PASMU        HGLQLKTEALAGTAFMGEDEQQNQQQSDWLLHDKKNEYENQLVVDGICQNLQPFVQQITI
B0UT52_HISS2      KENRLITEALAGTAFITNDEHINQQQAQWLLQDPKNIYENSLVVEGICQHLIPYVEEITV
                        : .:**:                *  . *   *   *   :   .         

I0JPY7_HALH3      PKAPVLYPLKNLQHLFTPVTAVLEKG-YTLLDVIEKLHPTPALGGMPQKKSVDYIRTNEK
D5DLU6_BACMD      PSTPSLYKTKHIQHLYTPVKGRIKED-VTLFSFIQKLHPTPALGGYPQQEALPIIRQLES
A8FGL0_BACP2      PNQPSLYKTKNIQHLFTPIVGEIKNS-CSLFSLIEQLHPTPALGGYPKEKAVEVIREIEP
MENF_BACSU        PDGPVLYKTKSVQHLFTPIVGQLRES-ASIFDLIEKLHPTPALGGSPQEKAVDVIREIEP
Q65FT1_BACLD      PAKPGLYKTKNVQHLYTPIVGKMNAE-SSIFDLIEKLHPTPALGGAPQQKAIEVIRELEP
B7GK08_ANOFW      PNEPTLLKMRHIQHLYTPVQGKVKEE-VSIFSLVERLHPTPALGGFPKEKAVQTIREIEP
C5D6U9_GEOSW      PSSPQLLKLQHIQHLYTPVIGEKCRA-ASVLSIVEQMHPTPALGGTPREKAIKEIREAEP
C5BMH8_TERTT      VSDVGVVKLRHIQHSYQKVSAILRPD-VSIGQLFSSLHPTPAICGYPSAQAKAFIRDHEH
L0DUQ2_THIND      PEQAGVFKLDRIQHRYLPIRATLKPG-VLDHPLLDTLHPTPAVCGFPRGAAQALIEREET
Q2LXF2_SYNAS      ESREEILKLQNVQHIVTRFSGRAHSS-FSPLSVAAAFHPTPAVGGLPQEEIRSCLRRHEP
F8L8Z2_SIMNZ      QNEDKIIQTSSVQHIYNLFEGELSEG-IDDTSLIHALHPTPAVGGRPKEAALKEIRKWET
Q3APX3_CHLCH      EDEVQVLQLQRLAHLYTRCSATLKEKSIPTSDILKQLHPTPAVGGVPKEEILEHIRALEP
Q8KBE9_CHLTE      QEKVGVLQLNRLAHLLAKCKARLLPEFSNDSTVLRQLHPTPAVGGVPREKAMSLILSIEP
A1BI73_CHLPD      DEQVHVLQLNRLAHLYTRCSATLKPEFSNDSTLLTRLHPTPAVGGVPRDEALRHILDIEP
B3QUU3_CHLT3      PAQVSLLKLARVQHLYNKYSATLKKG-YGDADLLERIHPTPAVGGVPKKEAIRQIAALEP
D0MFF4_RHOM4      DPQLSEMTLARGRHLYTGIRGRLRPN-VPTGALLEALHPTPAVGGYPRAAAMEAIRTWEP
Q2S2V7_SALRD      PKKRGELALARGRHLHARITGTLRPD-TGTTDVLEALHPTPAVGGVPTDDAVAAIRAREP
A1SRV3_PSYIN      S-EPHVMQLLNVQHLRVEINAKLNAQ-TKDAHLLHNLHPTPAVGGCPKLPALQFINDKEH
D4ZDG9_SHEVD      EESPKVFKLSHIQHLHRSIRAELKPE-VDDFQLLLAMHPTPAVGGLPREAAMDFIRQQEG
E1SVA5_FERBD      EETPTILKLNHIQHLHRSIRAELKAG-VNDLQLLGALHPTPAVGGLPRESAMSFIRQREG
T2L871_9GAMM      G-EAHIIKLRSVQHIRRLIHAELHRD-VTDQQLLAVLPPTPAVGGVPRKSALAFIRQHER
C4L9G4_TOLAT      S-DAHILPLQHIQHIKREIEASLRPD-TTDWQLLKSIHPTPAVGGSPRRKALAQIRALEQ
Q5E479_ALIF1      ADTSELVKLRKVQHLKRPISAEINAE-CSDSQLLDNLQPTAAIAGLPRMSALDFIIDNEP
Q7MMF7_VIBVY      ESEARLVRLRKVQHLKRNIHAQLKAG-VNGVQLLSALQPTAAVAGLPRQESMQFIVENEP
Q87R70_VIBPA      ETEPRLVRLRKVQHLKRNIHASLKTG-TNGVQLLSALQPTAAVAGLPRKESMQFILDNEP
F7YNU9_VIBA7      EQDVRLVRLRKVQHLKRGIHAQLKKG-VNGVQLLNALQPTAAVAGLPRKAAMDFIQANEP
Q9KQM2_VIBCH      QREAQLVRLRKVQHLKKRIDAQLKSG-VNGVQLLGVLQPTAAVAGLPRQAALAFIAENEP
M1SHP7_MORMO      S-AAAVIRLRKVQHLYRVISATLYAP--RDSDCLQRLQPTAAVAGLPRSAALAFLRDNEP
I2B783_SHIBC      L-PPQIMRLRKVQHLRRCIWTTLRQP--DDASCLRQLQPTAAVAGLPRQAASAFIQHNEP
A6TBV9_KLEP7      L-PPQVVRLRKVQHLRRCIWTELAAP--DDSRCLLQLQPTAAVAGLPRRAALAFIQRHEP
MENF_ECOLI        L-PPQVLRLRKVQHLRRCIWTSLNKA--DDVICLHQLQPTAAVAGLPRDLARQFIARHEP
D2TH10_CITRI      L-PPQVLRLRKVQHLRRCIWTALNQP--DDALCLMQLQPTAAVAGIPRDRAKNFIHQHEP
A8ADW8_CITK8      L-PPQVLRLRKVQHLRRCIWTALNQA--DDTLCLLQLQPTAAVAGIPRERARAFIQQHEP
Q8ZNE7_SALTY      L-PPQVLRLRKVQHLRRCIWTALNQA--DDTLCLHQLQPTAAVAGIPREPARCFIEQHEP
B5RCD5_SALG2      L-PPQVLRLRKVQHLRRCIWTALNQA--DDTLCLHQLQPTAAVAGIPREPARCFIEQHEP
F4HAZ1_GALAU      G-NVQLRQLRKVQHLCHPIDASLQPQ-HQYWEPLFALHPTAAVAGYPRQAALSFIKSNEP
M4RHK0_BIBTR      G-DAHIKALKNVQHLRRFIQTELAPD-IGDSQCLARIHPTAAVAGLPRTEAKQFIQQHEP
B8F6A0_HAEPS      S-DAEIKRLHNVQHLRRKIQTQLTEQ-VSDADCLARIHPTAAVAGLPRPKAKQFIQQQEC
MENF_HAEIN        S-NVELKPLRKVQHLIRKIRANLTAH-YADVNILKAIHPTAAVSGLPQQQAKMILSEIET
A6VMF7_ACTSZ      G-EVGLKQLRRVQHLRRRIRAELKPP-FSDAACLRAIHPTAAVSGLPQKNALDFLKNTEN
Q65RK8_MANSM      Q-SVELKRLRLVQHLRRKIFAKLTAL-TADEACLNAIHPTAAVAGLPKQNALRFLAKTET
MENF_PASMU        E-KVELKKLRKVQHLRRRISAQLKAG-CGDKDILLAMHPTAAVAGLPQLEAKQALRKLEN
B0UT52_HISS2      S-ELEIKQLRQIQHLKREISARLKAG-NTDAVCLNAIHPTAAIAGLPQKEAKVFLQNTET
                               *                      : **.*: * *       :   * 

I0JPY7_HALH3      LNRGWYAGPVGWFDMHNNGEFAVAIRSALIK----SDRASLFAGCGVVEDSDPDAEYEET
D5DLU6_BACMD      FDRGWYAAPLGWMDINGNGEFIVGIRSAVIQ----QKEAVLFAGCGIVADSTPESEYEET
A8FGL0_BACP2      LKRGWYAAPVGWIDSQDNGEFAVAIRSGLIE----EDHVRLFAGCGIVEDSLAKQEYEET
MENF_BACSU        MSRGWYAAPIGWIDSQDNGEFAVAIRSGLIE----GSTARLFAGCGIVEDSEPISEYEET
Q65FT1_BACLD      MSRGWYAAPAGWIDMSGNGEFAVAIRSGLID----SNAARIFAGCGVVADSDPLMEYEET
B7GK08_ANOFW      LDRGWYAAPIGWVDANGNGEFAVAIRSALLE----ENKAHLFAGCGIVAHSDPHNEYEET
C5D6U9_GEOSW      LDRGWYAAPIGWMDAEGNGEFAVAIRSGLLQ----GKEASIFAGCGVVGDSDPMSEYEET
C5BMH8_TERTT      FQRGWYSGVAGVIG-AEHAEFSVAIRSGLAR----GDKVWLYSGVGIVRGSNPVGEWREL
L0DUQ2_THIND      AQRGWYSGAVGIVS-PQESEFAVAIRSVLVN----RERILCYSGVGIVAGSDPEEEWTEL
Q2LXF2_SYNAS      FRRGWYAAPIGWMN-RRNAEFAVGIRSALVN----GKALHIFAGAGIVSQSNAHAEWSET
F8L8Z2_SIMNZ      FDRGWYAAPVGWIS-PEQAHILVAIRSALIH----ANELRLFAGTGIVPGSIPEKEWDEL
Q3APX3_CHLCH      FTRGWYAAPVGWVD-SHHAEFAVAIRSGLVN----GNEVHLYSGAGLVKGSNPDAEWEEI
Q8KBE9_CHLTE      FCRGWYAAPVGWLN-RDAAEFAVGIRSALVN----DDRVYLYSGAGLVRGSNPESEWEEV
A1BI73_CHLPD      FNRGWYAGPAGWIS-SNAAEFCVGIRSGVVV----EAMTFLYSGAGLVKGSDPVSEWDEI
B3QUU3_CHLT3      FDRGWYAGPIGWLS-RNESEFAVGIRSALMM----KNQLHIYTGAGIVKGSEAESEWEEI
D0MFF4_RHOM4      FDRGWYTGPIGWLG-ADAAEFAVAIRCGLVA----GRHLYLYSGAGIVEGSVPTLEWDEI
Q2S2V7_SALRD      FDRGWYAGPVGWVG-RDAAEFAVGLRAGLVE----EAQMALFSGAGIVEGSAPDREWDEI
A1SRV3_PSYIN      YNRGWYAGTVGYLR-VDKSDFSVAIRSALVS----SNKIKLFAGAGIVVGSIADQEWQEL
D4ZDG9_SHEVD      YARGWYAGACGYFN-HYESEFAVAIRSALIE----PGRINLFAGAGIVSGSEADAEWAEL
E1SVA5_FERBD      FARGWYAGACGYFG-AHETEFAVAIRSARFE----SERVTLYAGAGIVAHSEADAEWQEL
T2L871_9GAMM      HRRGWYAGVFGRIS-HTSSDLAVAIRCAHIG----PETIRLYAGAGIVAGSQPDEEWHEL
C4L9G4_TOLAT      HQRGWYAGACGFIS-EDVSEFTVAIRSGLWH----DQQLHLYTGAGILTGSDADTEWQEL
Q5E479_ALIF1      FARGWYSGAVGFLS-QQRSEFCVAIRSALVM----GNKLHLFAGAGIVPGSEPSSEWDEL
Q7MMF7_VIBVY      FARGWYAGSVGYIS-HEQAEFCVAIRSALIV----DDSLHLFAGAGIVPGSIAEHEWSEL
Q87R70_VIBPA      FARGWYAGSMGYIS-HERAEFCVAIRSALVL----GDQVQLFAGAGIVPGSVAEHEWAEL
F7YNU9_VIBA7      FARGWYAGSVGYFS-HQQAEFCVAIRSALLV----DNQVQLFAGAGIVPGSVAEHEWQEL
Q9KQM2_VIBCH      FARGWYAGSMGYFS-HAQAEFCVAIRSALVV----DKQVQLYAGAGIVPGSIAEHEWQEL
M1SHP7_MORMO      FDRDWYAGSGGYCS-PSRSEFAVSLRCAKIS----GSRVDLYAGAGIVAGSDPQAEWCEI
I2B783_SHIBC      FERQWYAGSAGYIS-RQQAEFCVSLRSALVD----GDRVRLYAGAGIVPGSDPAEEWREI
A6TBV9_KLEP7      FSREWYAGSAGYLS-LAQSEFCVALRSAKVD----HDTLRLYAGAGIVSGSDAQQEWQEI
MENF_ECOLI        FTREWYAGSAGYLS-LQQSEFCVSLRSAKIS----GNVVRLYAGAGIVRGSDPEQEWQEI
D2TH10_CITRI      FEREWYAGSAGYLS-IQQSEFCVSLRSAKIT----DNVVRLYAGAGIVRGSDPEQEWQEI
A8ADW8_CITK8      FEREWYAGSAGYLS-LQQSEFCVTLRSAKVA----ANVVRLYAGAGIVRGSDPEQEWQEI
Q8ZNE7_SALTY      FEREWYAGSAGYLS-TRQSEFCVTLRSAKVT----ANVVRLYAGAGIVRGSDPEQEWQEI
B5RCD5_SALG2      FEREWYAGSAGYLS-TRQSEFCVTLRSAKVT----ANVVRLYAGAGIVRGSDPEQEWQEI
F4HAZ1_GALAU      FQRGWYAGAIGVIS-HAFAEFCVGLRSAKLT----HQQLHLFAGAGIVKESQADEEWQEI
M4RHK0_BIBTR      FTRGWYAGTLGYFS-PAQAEFCVTLRSALVR----AKEMLVYAGAGIVAESEPESEWLEI
B8F6A0_HAEPS      FERGWYAGALGYFT-PEQAEFCVMLRSALIQ----ANQITFYAGAGIVEKSDPQSEWQEI
MENF_HAEIN        FDRGWYAGTLGVMS-DVCSEFCVAIRSAFIE----GHRIRVFAGAGIVAGSQPLEEWKEI
A6VMF7_ACTSZ      FDRTWYAGTLGVMT-KEHSEFCVTIRSAFIE----SNKIRVFAGAGIVAGSVPLLEWQEI
Q65RK8_MANSM      FERSWYAGTLGFMN-RARAEFCVTLRSAFVE----QNRIRVFAGAGIVAGSVPLLEWQEI
MENF_PASMU        FDRTWYAGTLGVMG-PAYADFCVTIRSAFIEQAENDSQLCVFAGAGIVEGSIPLLEWREI
B0UT52_HISS2      FDRTWYAGALGIMT-ETESEFCVTIRSSFIE----QDYIRIFAGAGIVEGSIPLLEWQEI
                    * **:.  *         : * :*.              ::* *::  * .  *: * 

I0JPY7_HALH3      DVKLKPMLSVLGGC-------------
D5DLU6_BACMD      RIKFNPMLSALGGIMRGTH--------
A8FGL0_BACP2      QVKLRPMLSALGGCPIE----------
MENF_BACSU        QIKLKPMISALGGERR-----------
Q65FT1_BACLD      QIKMKPMLSALGGDIR-----------
B7GK08_ANOFW      NIKFKPMLSALEGGWR-----------
C5D6U9_GEOSW      KVKFTPMLSALGVERDE----------
C5BMH8_TERTT      ESKLQVMLDTLLPHAH-----------
L0DUQ2_THIND      EAKIESFLSVLEC--------------
Q2LXF2_SYNAS      EKKMDNFAAIMKER-------------
F8L8Z2_SIMNZ      GHKISQFI-LWE---------------
Q3APX3_CHLCH      EQKIGDLLSITRMKQ------------
Q8KBE9_CHLTE      DQKIGDILAITQQTS------------
A1BI73_CHLPD      EQKIGDLLTTANGDT------------
B3QUU3_CHLT3      ENKLGSFLAIQQVNGTENA--------
D0MFF4_RHOM4      EHKISDFVNVLGLELRRS---------
Q2S2V7_SALRD      EQKIGDFAAIMGVSDPRMASR------
A1SRV3_PSYIN      ENKIHTILDILSV--------------
D4ZDG9_SHEVD      ENKLTTILSILTEV-------------
E1SVA5_FERBD      NNKLTTVLGILNGL-------------
T2L871_9GAMM      DTKIADIMSLLGMG-------------
C4L9G4_TOLAT      DTKLGSMLGAWHD--------------
Q5E479_ALIF1      DRKTSTLCTLLESDTNVSSDITESQVA
Q7MMF7_VIBVY      DKKMSTLLSLISEHPPLGVAS------
Q87R70_VIBPA      DKKMSTLLTLISDHPPLGVAS------
F7YNU9_VIBA7      DKKMATLLSLISDHFPLGVAS------
Q9KQM2_VIBCH      DKKLSTLLSLITDRLPLGVAS------
M1SHP7_MORMO      ENKAAGLRTLLESDAH-----------
I2B783_SHIBC      NNKAAGLRSLLTEKSE-----------
A6TBV9_KLEP7      DNKAAGLRSLLCP--------------
MENF_ECOLI        DNKAAGLRTLLQME-------------
D2TH10_CITRI      DNKAAGLRSLLQMDG------------
A8ADW8_CITK8      DNKAAGLRTLLQMES------------
Q8ZNE7_SALTY      DNKAAGLRTLLQMDA------------
B5RCD5_SALG2      DNKAAGLRTLLQMDA------------
F4HAZ1_GALAU      ERKMSGLLSLFERK-------------
M4RHK0_BIBTR      ERKALAMTNLVSSD-------------
B8F6A0_HAEPS      DRKAQAMAGLME---------------
MENF_HAEIN        ERKAAGLISLFAEEK------------
A6VMF7_ACTSZ      ERKASGLLTLLTHRGE-----------
Q65RK8_MANSM      ERKASGLLSLLQNSGEHICQ-------
MENF_PASMU        ERKAMGLVSLLQQNQL-----------
B0UT52_HISS2      ERKALGLISLLQKETE-----------
                    *   .