CLUSTAL format seed alignment for MF_01936

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MENI_ECOLI            MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
A0A2S8DV20_SHIBO      MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
A0A0H2V7M4_ECOL6      MIWKRKITLEALNAMGEGNMVGLLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
Q8X5Y9_ECO57          MIWKRKIPLEALNAMGEGNMVGLLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
Q8ZPQ8_SALTY          MIWKREVTLDALNAMGEGNMVGLLDIRFERIGDDTLEATMPVDHRTKQPFGLLHGGASVV
B7LQ90_ESCF3          MIWKRETNIDALNALGEGNMVGLLDIRFEHIGDDSLEATMPVDSRTKQPFGLLHGGASVV
B5XQF1_KLEP3          MIWKRQATLEQLNRLGEGNMVGLLDIRFETFTDDTLEATMPVDSRTQQPFGLLHGGASVV
A7MP05_CROS8          MIWQRTATLDALNAMGANNMVGLLDIRFTRLDEREIEATMPVDHRTHQPFGLLHGGASVV
C6C3W2_DICP7          MIWKRSIDLEQLNQMSVGCMVGHLGIRMTNLTDDTIEAVMPVDSRTCQPFGLLHGGASVT
C6CFL8_DICC1          MLWKRHVDIEQLNQMAVGGMAGHIGIRMTRLTDDTLEGVMPVDSRTRQPFGLLHGGASVT
A0A3N4BEK2_YERPE      MLWKRAATLEQLNQQSQGCMVGHLGIEFTRLSDDELEATMPVDSRTTQPFGLLHGGASVV
C5B883_EDWI9          MIWKRAITLEQLNQVGEACMVGHLGIAITRIGEDTLEGSMPVDQRTCQPFGLLHGGASAV
                      *:*:*   :: **  .   *.* :.*    : :  :*. **** ** ***********..

MENI_ECOLI            LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD
A0A2S8DV20_SHIBO      LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGICKPLHLGSRHQVWQIEIFD
A0A0H2V7M4_ECOL6      LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD
Q8X5Y9_ECO57          LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEISD
Q8ZPQ8_SALTY          LAESIGSVAGYLCTQGEQKVVGLEVNANHVRSARQGRVRGVCKALHTGARHQVWQIEIFD
B7LQ90_ESCF3          LAETLGSVAGYLCTHGDQKVVGIEVNANHVRSAREGRVRGVCKALHTGTRHQVWQIEIFD
B5XQF1_KLEP3          LAETLGSVAGYLCSEGEQKVVGLEVNANHIRSARGGRVRGVCKALHVGTRHQVWQIEIFD
A7MP05_CROS8          LAETLGSVAGYLCTEGEQNVVGLEVNANHLRSVRSGRVRGVCRAVHVGRRHQVWQIEIFD
C6C3W2_DICP7          LAESLGSIAGYLCTEGEQRVVGVEINANHLRAVTGGEVHGVCRAVHAGRRLQVWQIDIFD
C6CFL8_DICC1          LAESLGSIAGYLCSQGDQRVVGVEINANHLRAVTEGEVRGVCRALHTGKRMQVWQIDIFD
A0A3N4BEK2_YERPE      LAESLGSMAGYLCTVEGQQVVGLEINANHLKSVRSGNVRGCCRAIHVGRSHQVWQIEIFD
C5B883_EDWI9          LAETLGSLAGYLCSEGSQQVVGLEINANHLRAVRSGTVHGVCRALHLGRRHQVWQIDIRD
                      ***::**:*****:   *.***:*:****:::.  * *:* *:.:* *   *****:* *

MENI_ECOLI            EKGRLCCSSRLTTAIL----
A0A2S8DV20_SHIBO      EKGRLCCSSRLTTAIL----
A0A0H2V7M4_ECOL6      EKGRLCCSSRLTTAIL----
Q8X5Y9_ECO57          EKGRLCCSSRLTTAIL----
Q8ZPQ8_SALTY          EQGRLCCSSRLTTAIV----
B7LQ90_ESCF3          EQGRLCCTSRLTTAIL----
B5XQF1_KLEP3          EQSRLCCSSRLTTAVI----
A7MP05_CROS8          EQERLCCSSRLTTAVV----
C6C3W2_DICP7          DQARLCCTSRLTTAVLTPEG
C6CFL8_DICC1          SQDRLCCTSRLTTAVISPDA
A0A3N4BEK2_YERPE      EQGHLCCTSRLTIAVLTR--
C5B883_EDWI9          DRGHLCCTSRLTTALLEKRQ